F464525

General Info

Members Datasets Scaffolds Average Seq Length
567 272 567 269

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10132300|Ga0307410_101323001
Length 276
Sequence MNESPLFSWRNRIFRRTVMALAASTVLLMLVGFVWLPSAHEDFTVQGLWASICRAAGVPTSWRTGSEVEGQRISSRVSLTPSLARVEGNDAVGRGATLALNCTMCHGVQGMSISNSPNLAGQYPEVVIKQLQDYRSGHRSSPIMEAIASTLSDQDIRDLAAYYAFLPKARTAPTTYDETLPALVRVGDPMRNIAPCISCHGQVDQKLGTPWLEGMPKQYLVDQLNAFIAGTRRNDPGAQMRNMVRAMTPEEINEVATFYARKASAGEPEQAAAVVP

Samples

Sample ID Description Type Environment
1 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
2 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
258 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
259 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
260 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
261 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
262 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
269 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 0.35
Rhizoplane 6.88
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1000116 3300003752 Bacteria 88977
2 Ga0055533_1000016 3300003756 Bacteria 396179
3 Ga0055525_1001924 3300003759 Bacteria 2662
4 Ga0055524_1000061 3300003775 Bacteria 135241
5 Ga0055534_1003031 3300003784 Bacteria 5513
6 Ga0055534_1006182 3300003784 Bacteria 3063
7 Ga0055530_10000646 3300003791 Bacteria 29962
8 Ga0055530_10001932 3300003791 Bacteria 14135
9 Ga0055540_1000026 3300003792 Bacteria 189071
10 Ga0055540_1018701 3300003792 Bacteria 1892
11 Ga0055531_10001026 3300003794 Bacteria 22103
12 Ga0065165_1000292 3300005262 Bacteria 84843
13 Ga0065165_1011948 3300005262 Bacteria 3573
14 Ga0065714_10017685 3300005288 Bacteria 1753
15 Ga0065714_10074155 3300005288 Bacteria 3077
16 Ga0070658_10016866 3300005327 Bacteria 5846
17 Ga0070658_10020329 3300005327 Bacteria 5321
18 Ga0070658_10033011 3300005327 Bacteria 4162
19 Ga0070658_10277439 3300005327 Bacteria 1426
20 Ga0070676_10011161 3300005328 Bacteria 4880
21 Ga0070683_100008291 3300005329 Bacteria 8830
22 Ga0070683_100490964 3300005329 Bacteria 1173
23 Ga0070670_100005171 3300005331 Bacteria 10984
24 Ga0070670_100007752 3300005331 Bacteria 9133
25 Ga0070670_100044343 3300005331 Bacteria 3824
26 Ga0070670_100200583 3300005331 Bacteria 1733
27 Ga0070677_10065364 3300005333 Bacteria 1513
28 Ga0070677_10072526 3300005333 Unclassified 1452
29 Ga0068869_100013863 3300005334 Bacteria 5374
30 Ga0070666_10423091 3300005335 Bacteria 959
31 Ga0070680_100206511 3300005336 Bacteria 1657
32 Ga0068868_100007188 3300005338 Bacteria 7911
33 Ga0068868_100107992 3300005338 Bacteria 2259
34 Ga0068868_100144564 3300005338 Bacteria 1955
35 Ga0068868_100231661 3300005338 Bacteria 1550
36 Ga0068868_100334005 3300005338 Bacteria 1294
37 Ga0070660_100001577 3300005339 Bacteria 15675
38 Ga0070689_100183321 3300005340 Bacteria 1702
39 Ga0070689_100241579 3300005340 Bacteria 1487
40 Ga0070687_100022947 3300005343 Bacteria 2959
41 Ga0070661_100008362 3300005344 Bacteria 7149
42 Ga0070692_10115924 3300005345 Bacteria 1488
43 Ga0070668_100062305 3300005347 Bacteria 2889
44 Ga0070668_100268674 3300005347 Bacteria 1421
45 Ga0070668_100275365 3300005347 Bacteria 1404
46 Ga0070668_100364585 3300005347 Bacteria 1226
47 Ga0070668_100531428 3300005347 Bacteria 1021
48 Ga0070669_100034960 3300005353 Bacteria 3639
49 Ga0070669_100167855 3300005353 Bacteria 1709
50 Ga0070675_100000870 3300005354 Bacteria 21464
51 Ga0070675_100013048 3300005354 Bacteria 6526
52 Ga0070675_100020449 3300005354 Bacteria 5281
53 Ga0070671_100005297 3300005355 Bacteria 10293
54 Ga0070671_100038116 3300005355 Bacteria 3990
55 Ga0070671_100044641 3300005355 Bacteria 3683
56 Ga0070671_100046201 3300005355 Bacteria 3621
57 Ga0070671_100209489 3300005355 Bacteria 1653
58 Ga0070674_100037365 3300005356 Bacteria 3266
59 Ga0070674_100136840 3300005356 Bacteria 1833
60 Ga0070673_100001117 3300005364 Bacteria 15388
61 Ga0070673_100157821 3300005364 Unclassified 1927
62 Ga0070673_100162860 3300005364 Bacteria 1898
63 Ga0070673_100185629 3300005364 Bacteria 1783
64 Ga0070673_100572877 3300005364 Bacteria 1027
65 Ga0070688_100027498 3300005365 Bacteria 3389
66 Ga0070659_100000861 3300005366 Bacteria 22182
67 Ga0070659_100000966 3300005366 Bacteria 21152
68 Ga0070659_100010695 3300005366 Bacteria 6760
69 Ga0070659_100017104 3300005366 Bacteria 5451
70 Ga0070659_100204281 3300005366 Bacteria 1627
71 Ga0070667_100001328 3300005367 Bacteria 22207
72 Ga0070667_100027605 3300005367 Bacteria 4723
73 Ga0070667_100033553 3300005367 Bacteria 4292
74 Ga0070667_100052245 3300005367 Bacteria 3448
75 Ga0070667_100114463 3300005367 Bacteria 2342
76 Ga0070667_100281394 3300005367 Bacteria 1493
77 Ga0070700_100026468 3300005441 Bacteria 3426
78 Ga0070700_100233697 3300005441 Bacteria 1310
79 Ga0070663_100003495 3300005455 Bacteria 9065
80 Ga0070663_100150760 3300005455 Bacteria 1783
81 Ga0070678_100001606 3300005456 Bacteria 12113
82 Ga0070678_100074966 3300005456 Bacteria 2544
83 Ga0070678_100147020 3300005456 Bacteria 1893
84 Ga0070678_100208278 3300005456 Bacteria 1618
85 Ga0070662_100033859 3300005457 Bacteria 3600
86 Ga0070662_100089148 3300005457 Bacteria 2313
87 Ga0070662_100139361 3300005457 Bacteria 1878
88 Ga0068867_100000059 3300005459 Bacteria 68279
89 Ga0068867_100010167 3300005459 Bacteria 6638
90 Ga0068867_100022373 3300005459 Bacteria 4520
91 Ga0068867_100028346 3300005459 Bacteria 4032
92 Ga0068867_100167633 3300005459 Bacteria 1737
93 Ga0068867_100296952 3300005459 Bacteria 1330
94 Ga0068867_100494657 3300005459 Bacteria 1050
95 Ga0070685_10039415 3300005466 Bacteria 2684
96 Ga0070679_100032855 3300005530 Bacteria 5135
97 Ga0070684_100075820 3300005535 Bacteria 2967
98 Ga0068853_100024982 3300005539 Bacteria 5013
99 Ga0070672_100003033 3300005543 Bacteria 10820
100 Ga0070672_100028819 3300005543 Bacteria 4157
101 Ga0070672_100034960 3300005543 Bacteria 3816
102 Ga0070672_100051713 3300005543 Bacteria 3206
103 Ga0070672_100051724 3300005543 Bacteria 3205
104 Ga0070693_100154563 3300005547 Bacteria 1456
105 Ga0070693_100251913 3300005547 Bacteria 1171
106 Ga0070665_100184007 3300005548 Bacteria 2090
107 Ga0070665_100473577 3300005548 Bacteria 1263
108 Ga0068855_100000843 3300005563 Bacteria 37997
109 Ga0068855_100011670 3300005563 Bacteria 10618
110 Ga0070664_100054532 3300005564 Bacteria 3391
111 Ga0070664_100189213 3300005564 Bacteria 1833
112 Ga0070664_100524547 3300005564 Bacteria 1093
113 Ga0068857_100000194 3300005577 Bacteria 39279
114 Ga0068857_100043664 3300005577 Bacteria 3975
115 Ga0068857_100136606 3300005577 Bacteria 2214
116 Ga0068854_100058603 3300005578 Bacteria 2780
117 Ga0068854_100086446 3300005578 Bacteria 2324
118 Ga0068854_100090914 3300005578 Bacteria 2271
119 Ga0068854_100405571 3300005578 Bacteria 1129
120 Ga0068856_100048942 3300005614 Bacteria 4166
121 Ga0068852_100007924 3300005616 Bacteria 7782
122 Ga0068852_100013886 3300005616 Bacteria 6176
123 Ga0068852_100064443 3300005616 Bacteria 3194
124 Ga0068852_100069959 3300005616 Bacteria 3077
125 Ga0068852_100177329 3300005616 Bacteria 2002
126 Ga0068852_100379283 3300005616 Bacteria 1387
127 Ga0068852_100469339 3300005616 Bacteria 1249
128 Ga0068852_100501071 3300005616 Bacteria 1209
129 Ga0068859_100006855 3300005617 Bacteria 11571
130 Ga0068859_100064825 3300005617 Bacteria 3686
131 Ga0068864_100003331 3300005618 Bacteria 13278
132 Ga0068864_100060046 3300005618 Bacteria 3291
133 Ga0068864_100071807 3300005618 Bacteria 3015
134 Ga0068864_100364243 3300005618 Bacteria 1367
135 Ga0068864_100546074 3300005618 Bacteria 1119
136 Ga0068866_10002110 3300005718 Bacteria 8270
137 Ga0068861_100017084 3300005719 Bacteria 5145
138 Ga0068861_100037445 3300005719 Bacteria 3606
139 Ga0068861_100151194 3300005719 Bacteria 1905
140 Ga0068851_10031418 3300005834 Bacteria 2637
141 Ga0068851_10059948 3300005834 Bacteria 1947
142 Ga0068870_10166451 3300005840 Bacteria 1312
143 Ga0068863_100035873 3300005841 Bacteria 4722
144 Ga0068863_100048599 3300005841 Bacteria 4022
145 Ga0068863_100100956 3300005841 Bacteria 2743
146 Ga0068863_100129312 3300005841 Bacteria 2411
147 Ga0068863_100138887 3300005841 Bacteria 2322
148 Ga0068858_100056083 3300005842 Bacteria 3642
149 Ga0068858_100091301 3300005842 Bacteria 2834
150 Ga0068858_100100773 3300005842 Bacteria 2693
151 Ga0068860_100002633 3300005843 Bacteria 18673
152 Ga0068862_100037778 3300005844 Bacteria 4093
153 Ga0075366_10268763 3300006195 Bacteria 1041
154 Ga0097621_100014293 3300006237 Bacteria 5936
155 Ga0097621_100123070 3300006237 Bacteria 2202
156 Ga0097621_100206030 3300006237 Bacteria 1709
157 Ga0068871_100002846 3300006358 Bacteria 11851
158 Ga0068871_100020566 3300006358 Bacteria 5058
159 Ga0068871_100024161 3300006358 Bacteria 4709
160 Ga0068871_100108940 3300006358 Bacteria 2328
161 Ga0097620_100006855 3300006931 Bacteria 11571
162 Ga0097620_100064827 3300006931 Bacteria 3686
163 Ga0079104_1000093 3300006946 Bacteria 130633
164 Ga0111539_10045749 3300009094 Bacteria 5238
165 Ga0111539_10474288 3300009094 Bacteria 1457
166 Ga0105245_10069388 3300009098 Bacteria 3196
167 Ga0105245_10096513 3300009098 Bacteria 2728
168 Ga0105245_10158815 3300009098 Bacteria 2144
169 Ga0105243_10002725 3300009148 Bacteria 14684
170 Ga0105243_10085004 3300009148 Bacteria 2592
171 Ga0105242_10070318 3300009176 Bacteria 2901
172 Ga0105242_10414217 3300009176 Bacteria 1261
173 Ga0105248_10004911 3300009177 Bacteria 14772
174 Ga0105248_10007526 3300009177 Bacteria 11952
175 Ga0105248_10019477 3300009177 Bacteria 7508
176 Ga0105248_10044730 3300009177 Bacteria 4965
177 Ga0105248_10141901 3300009177 Bacteria 2710
178 Ga0105248_10222747 3300009177 Bacteria 2123
179 Ga0105237_10027992 3300009545 Bacteria 5743
180 Ga0105238_10058048 3300009551 Bacteria 3880
181 Ga0105238_10416280 3300009551 Bacteria 1338
182 Ga0105238_10586539 3300009551 Bacteria 1121
183 Ga0105249_10020966 3300009553 Bacteria 5847
184 Ga0105249_10111242 3300009553 Bacteria 2590
185 Ga0157373_10029096 3300013100 Bacteria 3982
186 Ga0157370_10144773 3300013104 Bacteria 2213
187 Ga0157370_10478432 3300013104 Bacteria 1144
188 Ga0157369_10041410 3300013105 Bacteria 5028
189 Ga0157369_10072252 3300013105 Bacteria 3703
190 Ga0157374_10031619 3300013296 Bacteria 4813
191 Ga0157374_10188457 3300013296 Bacteria 2017
192 Ga0157378_10141289 3300013297 Bacteria 2236
193 Ga0157378_10170508 3300013297 Bacteria 2041
194 Ga0157378_10273167 3300013297 Bacteria 1626
195 Ga0157378_10365010 3300013297 Bacteria 1414
196 Ga0163162_10017572 3300013306 Bacteria 6998
197 Ga0163162_10021530 3300013306 Bacteria 6351
198 Ga0163162_10063034 3300013306 Bacteria 3749
199 Ga0163162_10128886 3300013306 Bacteria 2638
200 Ga0163162_10527549 3300013306 Bacteria 1310
201 Ga0157372_10020606 3300013307 Bacteria 7116
202 Ga0157372_10036073 3300013307 Bacteria 5448
203 Ga0157372_10192562 3300013307 Bacteria 2362
204 Ga0157375_10025327 3300013308 Bacteria 5510
205 Ga0157375_10032143 3300013308 Bacteria 4974
206 Ga0157375_10057979 3300013308 Bacteria 3830
207 Ga0157375_10095193 3300013308 Bacteria 3048
208 Ga0157375_10114841 3300013308 Bacteria 2795
209 Ga0157375_10187575 3300013308 Bacteria 2222
210 Ga0157375_10298308 3300013308 Bacteria 1775
211 Ga0157375_10375486 3300013308 Bacteria 1588
212 Ga0163163_10027737 3300014325 Bacteria 5429
213 Ga0163163_10483504 3300014325 Bacteria 1299
214 Ga0157380_10066878 3300014326 Bacteria 2892
215 Ga0157380_10137578 3300014326 Bacteria 2093
216 Ga0157380_10222802 3300014326 Bacteria 1688
217 Ga0182008_10000701 3300014497 Bacteria 24012
218 Ga0157377_10000029 3300014745 Bacteria 134270
219 Ga0157377_10000667 3300014745 Bacteria 14251
220 Ga0157379_10002348 3300014968 Bacteria 15791
221 Ga0157379_10024171 3300014968 Bacteria 5393
222 Ga0157379_10100542 3300014968 Bacteria 2596
223 Ga0157379_10115021 3300014968 Bacteria 2418
224 Ga0157379_10244813 3300014968 Bacteria 1627
225 Ga0157376_10003810 3300014969 Bacteria 10430
226 Ga0157376_10034752 3300014969 Bacteria 4073
227 Ga0157376_10102518 3300014969 Bacteria 2503
228 Ga0157376_10279533 3300014969 Bacteria 1572
229 Ga0182006_1013334 3300015261 Bacteria 3569
230 Ga0182007_10001701 3300015262 Bacteria 11616
231 Ga0182005_1042384 3300015265 Unclassified 1237
232 Ga0182005_1044765 3300015265 Bacteria 1202
233 Ga0163161_10022792 3300017792 Bacteria 4411
234 Ga0163161_10026880 3300017792 Bacteria 4079
235 Ga0163161_10037708 3300017792 Bacteria 3465
236 Ga0163161_10041259 3300017792 Bacteria 3315
237 Ga0163161_10132250 3300017792 Bacteria 1883
238 Ga0213872_10010261 3300021361 Bacteria 4464
239 Ga0213876_10033650 3300021384 Bacteria 2702
240 Ga0209674_100041 3300025226 Bacteria 396231
241 Ga0209563_100043 3300025230 Bacteria 397271
242 Ga0209677_100077 3300025253 Bacteria 126245
243 Ga0209565_1010001 3300025263 Bacteria 2373
244 Ga0209130_1002187 3300025284 Bacteria 10307
245 Ga0209675_1001070 3300025291 Bacteria 16954
246 Ga0209675_1013484 3300025291 Bacteria 2550
247 Ga0209676_1003856 3300025292 Bacteria 8773
248 Ga0209050_1000228 3300025298 Bacteria 123537
249 Ga0209050_1002389 3300025298 Bacteria 16288
250 Ga0209256_1000030 3300025299 Bacteria 414828
251 Ga0209051_1000004 3300025303 Bacteria 1155596
252 Ga0209051_1001028 3300025303 Bacteria 26525
253 Ga0209051_1002715 3300025303 Bacteria 12311
254 Ga0209257_1000423 3300025304 Bacteria 81354
255 Ga0209257_1020086 3300025304 Bacteria 2485
256 Ga0207656_10031946 3300025321 Bacteria 2184
257 Ga0207656_10040179 3300025321 Bacteria 1982
258 Ga0207682_10015787 3300025893 Bacteria 2943
259 Ga0207682_10119016 3300025893 Unclassified 1170
260 Ga0207642_10010207 3300025899 Bacteria 3299
261 Ga0207688_10149106 3300025901 Bacteria 1380
262 Ga0207645_10003883 3300025907 Bacteria 11172
263 Ga0207645_10008444 3300025907 Bacteria 7184
264 Ga0207645_10091160 3300025907 Bacteria 1960
265 Ga0207705_10013439 3300025909 Bacteria 5905
266 Ga0207705_10024942 3300025909 Bacteria 4268
267 Ga0207705_10056995 3300025909 Bacteria 2818
268 Ga0207705_10060500 3300025909 Bacteria 2735
269 Ga0207654_10114102 3300025911 Bacteria 1685
270 Ga0207660_10437152 3300025917 Unclassified 1057
271 Ga0207662_10003115 3300025918 Bacteria 8466
272 Ga0207657_10001557 3300025919 Bacteria 24609
273 Ga0207657_10142446 3300025919 Bacteria 1958
274 Ga0207649_10009302 3300025920 Bacteria 5375
275 Ga0207649_10182210 3300025920 Bacteria 1471
276 Ga0207652_10023145 3300025921 Bacteria 5145
277 Ga0207652_10479483 3300025921 Bacteria 1120
278 Ga0207681_10004565 3300025923 Bacteria 8512
279 Ga0207694_10020004 3300025924 Bacteria 5063
280 Ga0207694_10158182 3300025924 Bacteria 1829
281 Ga0207650_10004204 3300025925 Bacteria 9837
282 Ga0207650_10009549 3300025925 Bacteria 6632
283 Ga0207650_10059182 3300025925 Bacteria 2855
284 Ga0207650_10076123 3300025925 Bacteria 2534
285 Ga0207650_10193354 3300025925 Bacteria 1626
286 Ga0207650_10282801 3300025925 Bacteria 1351
287 Ga0207659_10002086 3300025926 Bacteria 11835
288 Ga0207659_10009153 3300025926 Bacteria 6184
289 Ga0207659_10013255 3300025926 Bacteria 5273
290 Ga0207659_10078549 3300025926 Bacteria 2432
291 Ga0207659_10086656 3300025926 Bacteria 2329
292 Ga0207687_10107995 3300025927 Bacteria 2060
293 Ga0207687_10195813 3300025927 Bacteria 1576
294 Ga0207644_10005655 3300025931 Bacteria 8140
295 Ga0207644_10016274 3300025931 Bacteria 5004
296 Ga0207644_10018266 3300025931 Bacteria 4742
297 Ga0207644_10107903 3300025931 Bacteria 2101
298 Ga0207644_10114399 3300025931 Bacteria 2044
299 Ga0207690_10000648 3300025932 Bacteria 22339
300 Ga0207690_10126328 3300025932 Bacteria 1865
301 Ga0207690_10463951 3300025932 Unclassified 1020
302 Ga0207706_10001684 3300025933 Bacteria 21807
303 Ga0207706_10035026 3300025933 Bacteria 4466
304 Ga0207706_10198755 3300025933 Bacteria 1758
305 Ga0207706_10502532 3300025933 Bacteria 1046
306 Ga0207709_10003391 3300025935 Bacteria 9517
307 Ga0207709_10120088 3300025935 Bacteria 1773
308 Ga0207670_10072598 3300025936 Bacteria 2383
309 Ga0207669_10289219 3300025937 Bacteria 1240
310 Ga0207669_10604131 3300025937 Bacteria 892
311 Ga0207665_10063452 3300025939 Bacteria 2509
312 Ga0207691_10003434 3300025940 Bacteria 15411
313 Ga0207691_10044257 3300025940 Bacteria 4098
314 Ga0207691_10118928 3300025940 Bacteria 2343
315 Ga0207691_10129100 3300025940 Bacteria 2234
316 Ga0207691_10174533 3300025940 Bacteria 1881
317 Ga0207691_10178880 3300025940 Bacteria 1854
318 Ga0207691_10234894 3300025940 Bacteria 1587
319 Ga0207711_10001491 3300025941 Bacteria 21784
320 Ga0207711_10008678 3300025941 Bacteria 8504
321 Ga0207711_10063613 3300025941 Bacteria 3185
322 Ga0207711_10246400 3300025941 Bacteria 1639
323 Ga0207689_10000393 3300025942 Bacteria 41140
324 Ga0207689_10007718 3300025942 Bacteria 9415
325 Ga0207661_10022350 3300025944 Bacteria 4762
326 Ga0207679_10018103 3300025945 Bacteria 4712
327 Ga0207679_10176587 3300025945 Bacteria 1763
328 Ga0207667_10009858 3300025949 Bacteria 11215
329 Ga0207651_10042415 3300025960 Bacteria 3028
330 Ga0207651_10209422 3300025960 Bacteria 1568
331 Ga0207651_10271799 3300025960 Bacteria 1396
332 Ga0207712_10024409 3300025961 Bacteria 4003
333 Ga0207668_10019692 3300025972 Bacteria 4271
334 Ga0207668_10081448 3300025972 Bacteria 2348
335 Ga0207668_10249185 3300025972 Bacteria 1441
336 Ga0207640_10023728 3300025981 Bacteria 3691
337 Ga0207640_10050144 3300025981 Bacteria 2707
338 Ga0207640_10377699 3300025981 Bacteria 1147
339 Ga0207658_10002016 3300025986 Bacteria 15151
340 Ga0207658_10006229 3300025986 Bacteria 8153
341 Ga0207658_10056512 3300025986 Bacteria 2913
342 Ga0207658_10096833 3300025986 Bacteria 2302
343 Ga0207677_10000891 3300026023 Bacteria 16769
344 Ga0207677_10007442 3300026023 Bacteria 6059
345 Ga0207677_10090023 3300026023 Bacteria 2229
346 Ga0207703_10000937 3300026035 Bacteria 28276
347 Ga0207703_10062751 3300026035 Bacteria 3044
348 Ga0207703_10172963 3300026035 Bacteria 1901
349 Ga0207639_10024620 3300026041 Bacteria 4358
350 Ga0207639_10187006 3300026041 Bacteria 1766
351 Ga0207678_10008511 3300026067 Bacteria 9043
352 Ga0207678_10183622 3300026067 Bacteria 1786
353 Ga0207678_10200668 3300026067 Bacteria 1705
354 Ga0207678_10206019 3300026067 Bacteria 1682
355 Ga0207708_10170201 3300026075 Bacteria 1725
356 Ga0207702_10438148 3300026078 Bacteria 1266
357 Ga0207641_10000743 3300026088 Bacteria 35044
358 Ga0207641_10016984 3300026088 Bacteria 5958
359 Ga0207641_10224603 3300026088 Bacteria 1743
360 Ga0207648_10000080 3300026089 Bacteria 92020
361 Ga0207648_10018023 3300026089 Bacteria 6399
362 Ga0207648_10020752 3300026089 Bacteria 5914
363 Ga0207648_10030545 3300026089 Bacteria 4770
364 Ga0207648_10143258 3300026089 Bacteria 2107
365 Ga0207648_10151679 3300026089 Bacteria 2045
366 Ga0207648_10275937 3300026089 Bacteria 1503
367 Ga0207676_10036783 3300026095 Bacteria 3726
368 Ga0207676_10047448 3300026095 Bacteria 3329
369 Ga0207676_10052455 3300026095 Bacteria 3188
370 Ga0207676_10144607 3300026095 Bacteria 2040
371 Ga0207674_10005853 3300026116 Bacteria 14580
372 Ga0207674_10050452 3300026116 Bacteria 4251
373 Ga0207674_10089773 3300026116 Bacteria 3065
374 Ga0207675_100002300 3300026118 Bacteria 18970
375 Ga0207675_100016484 3300026118 Bacteria 6900
376 Ga0207675_100195189 3300026118 Bacteria 1943
377 Ga0207683_10008753 3300026121 Bacteria 8640
378 Ga0207683_10015961 3300026121 Bacteria 6391
379 Ga0207683_10022854 3300026121 Bacteria 5372
380 Ga0207683_10035034 3300026121 Bacteria 4366
381 Ga0207683_10081225 3300026121 Bacteria 2877
382 Ga0207683_10228599 3300026121 Bacteria 1696
383 Ga0207683_10266742 3300026121 Bacteria 1564
384 Ga0207683_10294611 3300026121 Bacteria 1484
385 Ga0207683_10337592 3300026121 Bacteria 1382
386 Ga0207683_10383613 3300026121 Bacteria 1292
387 Ga0207698_10043585 3300026142 Bacteria 3362
388 Ga0207698_10102538 3300026142 Bacteria 2376
389 Ga0207698_10165882 3300026142 Bacteria 1938
390 Ga0209281_1000084 3300027111 Bacteria 254215
391 Ga0207428_10303533 3300027907 Bacteria 1181
392 Ga0268266_10150721 3300028379 Bacteria 2096
393 Ga0268266_10247797 3300028379 Bacteria 1647
394 Ga0268266_10383749 3300028379 Bacteria 1326
395 Ga0268265_10009768 3300028380 Bacteria 6479
396 Ga0268265_10065273 3300028380 Bacteria 2808
397 Ga0268264_10011641 3300028381 Bacteria 7255
398 Ga0265318_10062458 3300028577 Bacteria 1387
399 Ga0307515_10157840 3300028794 Bacteria 2331
400 Ga0265762_1011119 3300030760 Bacteria 1609
401 Ga0307509_10101548 3300031507 Bacteria 2911
402 Ga0307408_100142710 3300031548 Bacteria 1881
403 Ga0307408_100271021 3300031548 Bacteria 1409
404 Ga0307408_100321667 3300031548 Bacteria 1303
405 Ga0307408_100417161 3300031548 Bacteria 1156
406 Ga0307516_10002271 3300031730 Bacteria 25921
407 Ga0307516_10005045 3300031730 Bacteria 15975
408 Ga0307405_10048652 3300031731 Bacteria 2616
409 Ga0307413_10092688 3300031824 Bacteria 1972
410 Ga0307413_10457911 3300031824 Bacteria 1014
411 Ga0307410_10022074 3300031852 Bacteria 3928
412 Ga0307410_10132300 3300031852 Bacteria 1834
413 Ga0307410_10493963 3300031852 Unclassified 1006
414 Ga0307406_10221703 3300031901 Bacteria 1406
415 Ga0307407_10042576 3300031903 Bacteria 2547
416 Ga0307407_10144373 3300031903 Bacteria 1539
417 Ga0307412_10008712 3300031911 Bacteria 5804
418 Ga0307412_10198834 3300031911 Bacteria 1521
419 Ga0307412_10313855 3300031911 Bacteria 1244
420 Ga0307412_10363537 3300031911 Bacteria 1166
421 Ga0307409_100000214 3300031995 Bacteria 23086
422 Ga0307409_100006228 3300031995 Bacteria 6986
423 Ga0307409_100023884 3300031995 Bacteria 4248
424 Ga0307416_100002783 3300032002 Bacteria 10161
425 Ga0307416_100167508 3300032002 Bacteria 2040
426 Ga0307416_100179795 3300032002 Bacteria 1981
427 Ga0307411_10138876 3300032005 Bacteria 1789
428 Ga0307411_10175840 3300032005 Unclassified 1620
429 Ga0307415_100005175 3300032126 Bacteria 6887
430 Ga0307415_100023718 3300032126 Bacteria 3816
431 Ga0307415_100228178 3300032126 Bacteria 1498
432 Ga0373930_0018759 3300034816 Bacteria 1334
433 Ga0373936_0019797 3300035113 Bacteria 2610
434 Ga0373955_0245852 3300035172 Bacteria 1072
435 Ga0373931_0000504 3300035691 Bacteria 15954
436 Ga0373947_0073261 3300035725 Bacteria 2105
437 Ga0373925_0050181 3300037068 Bacteria 3112
438 Ga0395899_0065141 3300037312 Bacteria 2678
439 Ga0395900_0000063 3300037418 Bacteria 201374
440 Ga0395900_0118378 3300037418 Bacteria 2718
441 Ga0395898_0003745 3300037466 Bacteria 16861
442 Ga0395898_0016469 3300037466 Bacteria 7564
443 Ga0395905_0046110 3300037471 Bacteria 4087
444 Ga0395905_0161604 3300037471 Bacteria 2105
445 Ga0395901_0012228 3300038443 Bacteria 8711
446 Ga0436365_1539415 3300039437 Bacteria 5304
447 Ga0436360_0810517 3300039438 Bacteria 1518
448 Ga0436361_0030879 3300039447 Bacteria 8317
449 Ga0451853_0007635 3300041512 Bacteria 2097
450 Ga0451576_0705240 3300045051 Bacteria 1060
451 Ga0495603_0027429 3300046455 Bacteria 3437
452 Ga0495629_0047329 3300046459 Bacteria 3016
453 Ga0495638_0001219 3300046460 Bacteria 24403
454 Ga0495650_0011626 3300046471 Bacteria 4804
455 Ga0495580_0049902 3300046472 Bacteria 2960
456 Ga0495582_0094666 3300046473 Bacteria 1668
457 Ga0495582_0126627 3300046473 Bacteria 1441
458 Ga0495605_0119492 3300046474 Bacteria 1195
459 Ga0495639_0003284 3300046475 Bacteria 7018
460 Ga0495639_0041991 3300046475 Bacteria 2061
461 Ga0495585_0024325 3300046492 Bacteria 3473
462 Ga0495596_0021368 3300046500 Bacteria 2642
463 Ga0495583_0034454 3300046506 Bacteria 2425
464 Ga0495616_0148856 3300046513 Bacteria 1060
465 Ga0495631_0155078 3300046518 Bacteria 982
466 Ga0495648_0081507 3300046524 Bacteria 1840
467 Ga0495666_0000316 3300046526 Bacteria 20956
468 Ga0495642_0003932 3300046528 Bacteria 5813
469 Ga0495642_0008922 3300046528 Bacteria 3837
470 Ga0495654_0072000 3300046530 Bacteria 1637
471 Ga0495665_0008102 3300046531 Bacteria 5699
472 Ga0495586_0299145 3300046535 Bacteria 922
473 Ga0495587_0030309 3300046536 Bacteria 3281
474 Ga0495598_0040032 3300046537 Bacteria 1365
475 Ga0495609_0084414 3300046538 Bacteria 1386
476 Ga0495621_0074763 3300046539 Bacteria 1254
477 Ga0495621_0147130 3300046539 Bacteria 925
478 Ga0495645_0103938 3300046543 Bacteria 2018
479 Ga0495645_0313842 3300046543 Unclassified 1020
480 Ga0495656_0001626 3300046615 Bacteria 7345
481 Ga0495656_0014623 3300046615 Bacteria 2946
482 Ga0495668_0170171 3300046616 Bacteria 1194
483 Ga0495611_0040361 3300046648 Bacteria 2080
484 Ga0495625_0002045 3300046660 Bacteria 22685
485 Ga0495625_0218534 3300046660 Bacteria 1250
486 Ga0495588_0016977 3300046674 Bacteria 3526
487 Ga0495588_0160802 3300046674 Unclassified 1188
488 Ga0495646_0026803 3300046680 Bacteria 3617
489 Ga0495613_0018108 3300046689 Bacteria 5249
490 Ga0495670_0102045 3300046691 Bacteria 1478
491 Ga0495670_0168894 3300046691 Bacteria 1151
492 Ga0495649_0006149 3300046694 Bacteria 7500
493 Ga0495649_0089720 3300046694 Bacteria 1639
494 Ga0495589_0005569 3300046794 Bacteria 6644
495 Ga0495636_0026735 3300047318 Bacteria 2348
496 Ga0495674_0382252 3300047319 Unclassified 1139
497 Ga0495680_0067421 3300047322 Bacteria 2736
498 Ga0495683_0027109 3300047323 Bacteria 2930
499 Ga0495683_0158288 3300047323 Bacteria 1049
500 Ga0495677_0011886 3300047445 Bacteria 3178
501 Ga0495679_041826 3300047446 Bacteria 1417
502 Ga0495673_0000024 3300047469 Bacteria 521349
503 Ga0495681_0050388 3300047470 Bacteria 1963
504 Ga0495686_0002242 3300047472 Bacteria 18646
505 Ga0495602_0119889 3300048088 Bacteria 2119
506 Ga0495614_0009086 3300048089 Bacteria 4403
507 Ga0495615_0003704 3300048090 Bacteria 2590
508 Ga0496100_0004624 3300048903 Bacteria 7319
509 Ga0496100_0225859 3300048903 Bacteria 1376
510 Ga0496101_0001681 3300048904 Bacteria 13256
511 Ga0496101_0103073 3300048904 Bacteria 2138
512 Ga0496102_0008149 3300048905 Bacteria 8965
513 Ga0496102_0181004 3300048905 Bacteria 1986
514 Ga0496103_0022283 3300048906 Bacteria 3814
515 Ga0496104_0000665 3300048907 Bacteria 29449
516 Ga0496104_0156581 3300048907 Bacteria 2186
517 Ga0496104_0240862 3300048907 Bacteria 1721
518 Ga0496104_0260247 3300048907 Bacteria 1648
519 Ga0496105_0006587 3300048908 Bacteria 8940
520 Ga0496105_0057733 3300048908 Bacteria 3204
521 Ga0496105_0320558 3300048908 Bacteria 1242
522 Ga0496106_0035455 3300048909 Bacteria 3730
523 Ga0496107_0026941 3300048910 Bacteria 4079
524 Ga0496107_0028755 3300048910 Bacteria 3951
525 Ga0496108_0040004 3300048911 Bacteria 3907
526 Ga0496108_0109540 3300048911 Bacteria 2360
527 Ga0496108_0133787 3300048911 Bacteria 2132
528 Ga0496108_0368018 3300048911 Bacteria 1255
529 Ga0496108_0412517 3300048911 Bacteria 1180
530 Ga0496109_0026135 3300048912 Bacteria 5205
531 Ga0496109_0144158 3300048912 Bacteria 2228
532 Ga0496109_0469655 3300048912 Bacteria 1188
533 Ga0496110_0010508 3300048913 Bacteria 7535
534 Ga0496110_0057761 3300048913 Bacteria 3416
535 Ga0496110_0168793 3300048913 Bacteria 1985
536 Ga0496110_0230145 3300048913 Bacteria 1686
537 Ga0496111_0014187 3300048914 Bacteria 5437
538 Ga0496111_0043930 3300048914 Bacteria 3213
539 Ga0496112_0012015 3300048915 Bacteria 7941
540 Ga0496113_0013212 3300048916 Bacteria 5583
541 Ga0496114_0110942 3300048917 Bacteria 2350
542 Ga0496114_0114273 3300048917 Bacteria 2315
543 Ga0496114_0187043 3300048917 Bacteria 1810
544 Ga0496114_0331525 3300048917 Bacteria 1345
545 Ga0496114_0502999 3300048917 Bacteria 1072
546 Ga0496115_0039829 3300048918 Bacteria 3734
547 Ga0501292_003776 3300049515 Bacteria 2042
548 Ga0501036_0294799 3300049572 Bacteria 1357
549 Ga0501046_0009486 3300049580 Bacteria 8411
550 Ga0501047_0006196 3300049581 Bacteria 11247
551 Ga0501047_0039852 3300049581 Bacteria 4544
552 Ga0501198_000005 3300049649 Bacteria 156657
553 Ga0501222_000003 3300049662 Bacteria 157406
554 Ga0501223_030253 3300049663 Bacteria 1053
555 Ga0501257_033986 3300049686 Bacteria 1237
556 Ga0501262_000027 3300049759 Bacteria 20078
557 Ga0501265_001002 3300049762 Bacteria 3170
558 Ga0501035_0006200 3300049822 Bacteria 11249
559 Ga0501044_0013597 3300049823 Bacteria 8796
560 nmdc:mga0k408_310657_c1 3300050493 Bacteria 941
561 nmdc:mga08y16_28565_c1 3300050511 Bacteria 5879
562 Ga0495612_0024986 3300053078 Bacteria 2399
563 Ga0500635_0015261 3300053080 Bacteria 2266
564 Ga0500644_0066890 3300053088 Unclassified 1283
565 Ga0500594_0001259 3300053118 Bacteria 5494
566 Ga0500564_071638 3300053138 Bacteria 1562
567 Ga0500622_0004244 3300053156 Bacteria 9116

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025937 Ga0207669_10604131 Ga0207669_106041312 200
2 3300013308 Ga0157375_10298308 Ga0157375_102983082 239
3 3300048917 Ga0496114_0331525 Ga0496114_0331525_75_887 239
4 3300046535 Ga0495586_0299145 Ga0495586_0299145_133_894 244
5 3300047472 Ga0495686_0002242 Ga0495686_0002242_12236_13048 244
6 3300013308 Ga0157375_10025327 Ga0157375_100253275 246
7 3300048907 Ga0496104_0240862 Ga0496104_0240862_198_956 246
8 3300047319 Ga0495674_0382252 Ga0495674_0382252_331_1128 247
9 3300048911 Ga0496108_0412517 Ga0496108_0412517_170_937 247
10 3300005338 Ga0068868_100231661 Ga0068868_1002316612 248
11 3300005364 Ga0070673_100185629 Ga0070673_1001856291 248
12 3300009551 Ga0105238_10586539 Ga0105238_105865392 248
13 3300025960 Ga0207651_10271799 Ga0207651_102717992 248
14 3300030760 Ga0265762_1011119 Ga0265762_10111192 248
15 3300014326 Ga0157380_10137578 Ga0157380_101375782 249
16 3300035113 Ga0373936_0019797 Ga0373936_0019797_1112_1885 249
17 3300046472 Ga0495580_0049902 Ga0495580_0049902_453_1253 250
18 3300005543 Ga0070672_100051713 Ga0070672_1000517133 251
19 3300005618 Ga0068864_100364243 Ga0068864_1003642432 251
20 3300005841 Ga0068863_100048599 Ga0068863_1000485993 251
21 3300006237 Ga0097621_100123070 Ga0097621_1001230702 251
22 3300006358 Ga0068871_100108940 Ga0068871_1001089402 251
23 3300013306 Ga0163162_10128886 Ga0163162_101288862 251
24 3300053156 Ga0500622_0004244 Ga0500622_0004244_5176_5961 251
25 3300005327 Ga0070658_10016866 Ga0070658_100168662 252
26 3300005616 Ga0068852_100501071 Ga0068852_1005010712 252
27 3300025909 Ga0207705_10056995 Ga0207705_100569953 252
28 3300025921 Ga0207652_10479483 Ga0207652_104794832 252
29 3300025932 Ga0207690_10463951 Ga0207690_104639511 252
30 3300037312 Ga0395899_0065141 Ga0395899_0065141_567_1337 252
31 3300037418 Ga0395900_0118378 Ga0395900_0118378_961_1731 252
32 3300037466 Ga0395898_0016469 Ga0395898_0016469_895_1665 252
33 3300037471 Ga0395905_0046110 Ga0395905_0046110_1943_2713 252
34 3300038443 Ga0395901_0012228 Ga0395901_0012228_5465_6235 252
35 3300035725 Ga0373947_0073261 Ga0373947_0073261_1187_2002 253
36 3300037068 Ga0373925_0050181 Ga0373925_0050181_865_1680 253
37 3300053078 Ga0495612_0024986 Ga0495612_0024986_913_1728 253
38 3300031548 Ga0307408_100271021 Ga0307408_1002710212 254
39 3300032002 Ga0307416_100179795 Ga0307416_1001797952 254
40 3300049515 Ga0501292_003776 Ga0501292_003776_778_1587 254
41 3300049663 Ga0501223_030253 Ga0501223_030253_202_1011 254
42 3300049686 Ga0501257_033986 Ga0501257_033986_246_1055 254
43 3300049762 Ga0501265_001002 Ga0501265_001002_2061_2870 254
44 3300005355 Ga0070671_100044641 Ga0070671_1000446412 255
45 3300005841 Ga0068863_100100956 Ga0068863_1001009562 255
46 3300009177 Ga0105248_10019477 Ga0105248_100194772 255
47 3300026088 Ga0207641_10224603 Ga0207641_102246032 255
48 3300031730 Ga0307516_10005045 Ga0307516_100050457 255
49 3300046471 Ga0495650_0011626 Ga0495650_0011626_23_808 255
50 3300046492 Ga0495585_0024325 Ga0495585_0024325_1313_2098 255
51 3300046539 Ga0495621_0147130 Ga0495621_0147130_56_871 255
52 3300046615 Ga0495656_0014623 Ga0495656_0014623_1137_1949 255
53 3300047323 Ga0495683_0158288 Ga0495683_0158288_200_985 255
54 3300048090 Ga0495615_0003704 Ga0495615_0003704_119_931 255
55 3300048907 Ga0496104_0260247 Ga0496104_0260247_500_1294 255
56 3300048911 Ga0496108_0133787 Ga0496108_0133787_817_1611 255
57 3300048915 Ga0496112_0012015 Ga0496112_0012015_5760_6554 255
58 3300005336 Ga0070680_100206511 Ga0070680_1002065111 256
59 3300005530 Ga0070679_100032855 Ga0070679_1000328554 256
60 3300025909 Ga0207705_10013439 Ga0207705_100134392 256
61 3300025917 Ga0207660_10437152 Ga0207660_104371521 256
62 3300025921 Ga0207652_10023145 Ga0207652_100231454 256
63 3300048907 Ga0496104_0156581 Ga0496104_0156581_910_1701 256
64 3300047318 Ga0495636_0026735 Ga0495636_0026735_1504_2298 257
65 3300046473 Ga0495582_0094666 Ga0495582_0094666_431_1225 258
66 3300046539 Ga0495621_0074763 Ga0495621_0074763_156_956 258
67 3300048908 Ga0496105_0057733 Ga0496105_0057733_1624_2424 258
68 3300048917 Ga0496114_0187043 Ga0496114_0187043_375_1175 258
69 3300005364 Ga0070673_100157821 Ga0070673_1001578212 259
70 3300025925 Ga0207650_10193354 Ga0207650_101933542 259
71 3300025937 Ga0207669_10289219 Ga0207669_102892191 259
72 3300026121 Ga0207683_10383613 Ga0207683_103836131 259
73 3300031730 Ga0307516_10002271 Ga0307516_100022716 259
74 3300046475 Ga0495639_0041991 Ga0495639_0041991_702_1499 259
75 3300049572 Ga0501036_0294799 Ga0501036_0294799_519_1322 259
76 3300049580 Ga0501046_0009486 Ga0501046_0009486_6732_7535 259
77 3300049581 Ga0501047_0006196 Ga0501047_0006196_2774_3577 259
78 3300049822 Ga0501035_0006200 Ga0501035_0006200_7674_8477 259
79 3300049823 Ga0501044_0013597 Ga0501044_0013597_4716_5519 259
80 3300003791 Ga0055530_10000646 Ga0055530_100006465 260
81 3300003791 Ga0055530_10001932 Ga0055530_1000193214 260
82 3300003792 Ga0055540_1000026 Ga0055540_100002625 260
83 3300003794 Ga0055531_10001026 Ga0055531_1000102613 260
84 3300005262 Ga0065165_1000292 Ga0065165_100029250 260
85 3300006946 Ga0079104_1000093 Ga0079104_100009375 260
86 3300009094 Ga0111539_10045749 Ga0111539_100457492 260
87 3300025298 Ga0209050_1000228 Ga0209050_100022854 260
88 3300025303 Ga0209051_1000004 Ga0209051_1000004504 260
89 3300025304 Ga0209257_1000423 Ga0209257_100042361 260
90 3300027111 Ga0209281_1000084 Ga0209281_1000084183 260
91 3300031901 Ga0307406_10221703 Ga0307406_102217032 260
92 3300031995 Ga0307409_100000214 Ga0307409_10000021421 260
93 3300032002 Ga0307416_100002783 Ga0307416_1000027837 260
94 3300032126 Ga0307415_100005175 Ga0307415_1000051751 260
95 3300041512 Ga0451853_0007635 Ga0451853_0007635_1162_1962 260
96 3300050511 nmdc:mga08y16_28565_c1 nmdc:mga08y16_28565_c1_2081_2893 260
97 3300005329 Ga0070683_100490964 Ga0070683_1004909642 261
98 3300005339 Ga0070660_100001577 Ga0070660_1000015777 261
99 3300005366 Ga0070659_100000861 Ga0070659_10000086111 261
100 3300005459 Ga0068867_100494657 Ga0068867_1004946571 261
101 3300005563 Ga0068855_100000843 Ga0068855_10000084310 261
102 3300005618 Ga0068864_100546074 Ga0068864_1005460742 261
103 3300025919 Ga0207657_10001557 Ga0207657_1000155719 261
104 3300025949 Ga0207667_10009858 Ga0207667_100098582 261
105 3300026067 Ga0207678_10200668 Ga0207678_102006682 261
106 3300046524 Ga0495648_0081507 Ga0495648_0081507_585_1385 261
107 3300046694 Ga0495649_0006149 Ga0495649_0006149_1663_2463 261
108 3300047469 Ga0495673_0000024 Ga0495673_0000024_403701_404492 261
109 3300049649 Ga0501198_000005 Ga0501198_000005_92994_93809 261
110 3300049662 Ga0501222_000003 Ga0501222_000003_93743_94558 261
111 3300053118 Ga0500594_0001259 Ga0500594_0001259_4647_5447 261
112 3300003775 Ga0055524_1000061 Ga0055524_100006160 262
113 3300005327 Ga0070658_10277439 Ga0070658_102774391 262
114 3300025263 Ga0209565_1010001 Ga0209565_10100012 262
115 3300025291 Ga0209675_1013484 Ga0209675_10134843 262
116 3300025298 Ga0209050_1002389 Ga0209050_10023893 262
117 3300025299 Ga0209256_1000030 Ga0209256_100003060 262
118 3300025925 Ga0207650_10282801 Ga0207650_102828012 262
119 3300028577 Ga0265318_10062458 Ga0265318_100624582 262
120 3300032005 Ga0307411_10175840 Ga0307411_101758402 262
121 3300032126 Ga0307415_100228178 Ga0307415_1002281782 262
122 3300005288 Ga0065714_10017685 Ga0065714_100176852 263
123 3300005288 Ga0065714_10074155 Ga0065714_100741553 263
124 3300005327 Ga0070658_10020329 Ga0070658_100203295 263
125 3300005331 Ga0070670_100005171 Ga0070670_1000051716 263
126 3300005331 Ga0070670_100007752 Ga0070670_1000077522 263
127 3300005333 Ga0070677_10072526 Ga0070677_100725262 263
128 3300005338 Ga0068868_100144564 Ga0068868_1001445643 263
129 3300005338 Ga0068868_100334005 Ga0068868_1003340052 263
130 3300005340 Ga0070689_100241579 Ga0070689_1002415792 263
131 3300005354 Ga0070675_100020449 Ga0070675_1000204496 263
132 3300005355 Ga0070671_100038116 Ga0070671_1000381162 263
133 3300005355 Ga0070671_100046201 Ga0070671_1000462012 263
134 3300005364 Ga0070673_100162860 Ga0070673_1001628602 263
135 3300005366 Ga0070659_100204281 Ga0070659_1002042811 263
136 3300005367 Ga0070667_100033553 Ga0070667_1000335531 263
137 3300005367 Ga0070667_100052245 Ga0070667_1000522453 263
138 3300005367 Ga0070667_100114463 Ga0070667_1001144632 263
139 3300005456 Ga0070678_100074966 Ga0070678_1000749662 263
140 3300005456 Ga0070678_100147020 Ga0070678_1001470202 263
141 3300005457 Ga0070662_100139361 Ga0070662_1001393612 263
142 3300005543 Ga0070672_100003033 Ga0070672_1000030333 263
143 3300005543 Ga0070672_100034960 Ga0070672_1000349602 263
144 3300005547 Ga0070693_100251913 Ga0070693_1002519132 263
145 3300005548 Ga0070665_100184007 Ga0070665_1001840072 263
146 3300005577 Ga0068857_100000194 Ga0068857_10000019425 263
147 3300005616 Ga0068852_100007924 Ga0068852_1000079247 263
148 3300005616 Ga0068852_100177329 Ga0068852_1001773292 263
149 3300005618 Ga0068864_100060046 Ga0068864_1000600463 263
150 3300005719 Ga0068861_100151194 Ga0068861_1001511942 263
151 3300005841 Ga0068863_100129312 Ga0068863_1001293122 263
152 3300006237 Ga0097621_100014293 Ga0097621_1000142936 263
153 3300006358 Ga0068871_100002846 Ga0068871_10000284611 263
154 3300009094 Ga0111539_10474288 Ga0111539_104742882 263
155 3300009098 Ga0105245_10096513 Ga0105245_100965133 263
156 3300009176 Ga0105242_10414217 Ga0105242_104142172 263
157 3300009177 Ga0105248_10007526 Ga0105248_100075267 263
158 3300013296 Ga0157374_10031619 Ga0157374_100316192 263
159 3300013297 Ga0157378_10365010 Ga0157378_103650102 263
160 3300013306 Ga0163162_10021530 Ga0163162_100215307 263
161 3300013308 Ga0157375_10114841 Ga0157375_101148412 263
162 3300013308 Ga0157375_10187575 Ga0157375_101875752 263
163 3300013308 Ga0157375_10375486 Ga0157375_103754862 263
164 3300014497 Ga0182008_10000701 Ga0182008_100007016 263
165 3300014968 Ga0157379_10100542 Ga0157379_101005421 263
166 3300014968 Ga0157379_10244813 Ga0157379_102448132 263
167 3300014969 Ga0157376_10102518 Ga0157376_101025182 263
168 3300015261 Ga0182006_1013334 Ga0182006_10133343 263
169 3300015262 Ga0182007_10001701 Ga0182007_100017018 263
170 3300015265 Ga0182005_1044765 Ga0182005_10447652 263
171 3300017792 Ga0163161_10041259 Ga0163161_100412592 263
172 3300021361 Ga0213872_10010261 Ga0213872_100102614 263
173 3300021384 Ga0213876_10033650 Ga0213876_100336502 263
174 3300025303 Ga0209051_1001028 Ga0209051_100102818 263
175 3300025303 Ga0209051_1002715 Ga0209051_10027158 263
176 3300025893 Ga0207682_10119016 Ga0207682_101190161 263
177 3300025909 Ga0207705_10060500 Ga0207705_100605002 263
178 3300025925 Ga0207650_10004204 Ga0207650_100042048 263
179 3300025926 Ga0207659_10013255 Ga0207659_100132556 263
180 3300025927 Ga0207687_10195813 Ga0207687_101958132 263
181 3300025931 Ga0207644_10018266 Ga0207644_100182665 263
182 3300025931 Ga0207644_10107903 Ga0207644_101079031 263
183 3300025932 Ga0207690_10126328 Ga0207690_101263282 263
184 3300025933 Ga0207706_10502532 Ga0207706_105025322 263
185 3300025935 Ga0207709_10120088 Ga0207709_101200882 263
186 3300025940 Ga0207691_10003434 Ga0207691_100034349 263
187 3300025940 Ga0207691_10118928 Ga0207691_101189282 263
188 3300025940 Ga0207691_10174533 Ga0207691_101745332 263
189 3300025940 Ga0207691_10234894 Ga0207691_102348942 263
190 3300025941 Ga0207711_10001491 Ga0207711_1000149111 263
191 3300025960 Ga0207651_10042415 Ga0207651_100424152 263
192 3300025986 Ga0207658_10056512 Ga0207658_100565122 263
193 3300025986 Ga0207658_10096833 Ga0207658_100968332 263
194 3300026023 Ga0207677_10090023 Ga0207677_100900231 263
195 3300026095 Ga0207676_10052455 Ga0207676_100524553 263
196 3300026116 Ga0207674_10005853 Ga0207674_1000585318 263
197 3300026118 Ga0207675_100195189 Ga0207675_1001951892 263
198 3300026121 Ga0207683_10008753 Ga0207683_100087534 263
199 3300026121 Ga0207683_10266742 Ga0207683_102667421 263
200 3300028379 Ga0268266_10150721 Ga0268266_101507212 263
201 3300028379 Ga0268266_10383749 Ga0268266_103837492 263
202 3300031507 Ga0307509_10101548 Ga0307509_101015482 263
203 3300031548 Ga0307408_100142710 Ga0307408_1001427103 263
204 3300031548 Ga0307408_100321667 Ga0307408_1003216672 263
205 3300031548 Ga0307408_100417161 Ga0307408_1004171612 263
206 3300031731 Ga0307405_10048652 Ga0307405_100486522 263
207 3300031824 Ga0307413_10092688 Ga0307413_100926882 263
208 3300031852 Ga0307410_10022074 Ga0307410_100220743 263
209 3300031852 Ga0307410_10132300 Ga0307410_101323001 263
210 3300031852 Ga0307410_10493963 Ga0307410_104939631 263
211 3300031903 Ga0307407_10042576 Ga0307407_100425762 263
212 3300031903 Ga0307407_10144373 Ga0307407_101443733 263
213 3300031911 Ga0307412_10008712 Ga0307412_100087125 263
214 3300031911 Ga0307412_10313855 Ga0307412_103138552 263
215 3300031911 Ga0307412_10363537 Ga0307412_103635372 263
216 3300031995 Ga0307409_100006228 Ga0307409_1000062286 263
217 3300031995 Ga0307409_100023884 Ga0307409_1000238842 263
218 3300032002 Ga0307416_100167508 Ga0307416_1001675082 263
219 3300032005 Ga0307411_10138876 Ga0307411_101388762 263
220 3300032126 Ga0307415_100023718 Ga0307415_1000237182 263
221 3300037418 Ga0395900_0000063 Ga0395900_0000063_31411_32226 263
222 3300037466 Ga0395898_0003745 Ga0395898_0003745_15963_16778 263
223 3300037471 Ga0395905_0161604 Ga0395905_0161604_100_909 263
224 3300039437 Ga0436365_1539415 Ga0436365_1539415_2260_3072 263
225 3300039447 Ga0436361_0030879 Ga0436361_0030879_7060_7872 263
226 3300045051 Ga0451576_0705240 Ga0451576_0705240_70_897 263
227 3300046460 Ga0495638_0001219 Ga0495638_0001219_14134_14937 263
228 3300046475 Ga0495639_0003284 Ga0495639_0003284_5655_6461 263
229 3300046526 Ga0495666_0000316 Ga0495666_0000316_11738_12559 263
230 3300046531 Ga0495665_0008102 Ga0495665_0008102_3664_4485 263
231 3300046537 Ga0495598_0040032 Ga0495598_0040032_114_923 263
232 3300046660 Ga0495625_0002045 Ga0495625_0002045_21443_22246 263
233 3300046660 Ga0495625_0218534 Ga0495625_0218534_201_1019 263
234 3300046674 Ga0495588_0160802 Ga0495588_0160802_154_975 263
235 3300046691 Ga0495670_0168894 Ga0495670_0168894_333_1139 263
236 3300048088 Ga0495602_0119889 Ga0495602_0119889_525_1346 263
237 3300048903 Ga0496100_0004624 Ga0496100_0004624_862_1668 263
238 3300048903 Ga0496100_0225859 Ga0496100_0225859_402_1211 263
239 3300048904 Ga0496101_0001681 Ga0496101_0001681_8303_9109 263
240 3300048905 Ga0496102_0008149 Ga0496102_0008149_1412_2218 263
241 3300048906 Ga0496103_0022283 Ga0496103_0022283_2077_2883 263
242 3300048907 Ga0496104_0000665 Ga0496104_0000665_14731_15537 263
243 3300048908 Ga0496105_0006587 Ga0496105_0006587_3581_4387 263
244 3300048910 Ga0496107_0028755 Ga0496107_0028755_627_1433 263
245 3300048911 Ga0496108_0109540 Ga0496108_0109540_497_1303 263
246 3300048912 Ga0496109_0144158 Ga0496109_0144158_328_1137 263
247 3300048913 Ga0496110_0010508 Ga0496110_0010508_6020_6826 263
248 3300048914 Ga0496111_0014187 Ga0496111_0014187_3714_4520 263
249 3300048917 Ga0496114_0110942 Ga0496114_0110942_92_898 263
250 3300049581 Ga0501047_0039852 Ga0501047_0039852_1882_2697 263
251 3300049759 Ga0501262_000027 Ga0501262_000027_5290_6099 263
252 3300053080 Ga0500635_0015261 Ga0500635_0015261_733_1542 263
253 3300053138 Ga0500564_071638 Ga0500564_071638_379_1188 263
254 3300003784 Ga0055534_1003031 Ga0055534_10030317 264
255 3300003784 Ga0055534_1006182 Ga0055534_10061822 264
256 3300003792 Ga0055540_1018701 Ga0055540_10187012 264
257 3300005262 Ga0065165_1011948 Ga0065165_10119482 264
258 3300005327 Ga0070658_10033011 Ga0070658_100330114 264
259 3300005328 Ga0070676_10011161 Ga0070676_100111613 264
260 3300005329 Ga0070683_100008291 Ga0070683_1000082917 264
261 3300005331 Ga0070670_100044343 Ga0070670_1000443433 264
262 3300005331 Ga0070670_100200583 Ga0070670_1002005832 264
263 3300005333 Ga0070677_10065364 Ga0070677_100653642 264
264 3300005334 Ga0068869_100013863 Ga0068869_1000138636 264
265 3300005335 Ga0070666_10423091 Ga0070666_104230911 264
266 3300005338 Ga0068868_100007188 Ga0068868_1000071885 264
267 3300005338 Ga0068868_100107992 Ga0068868_1001079921 264
268 3300005340 Ga0070689_100183321 Ga0070689_1001833212 264
269 3300005343 Ga0070687_100022947 Ga0070687_1000229472 264
270 3300005344 Ga0070661_100008362 Ga0070661_1000083621 264
271 3300005345 Ga0070692_10115924 Ga0070692_101159243 264
272 3300005347 Ga0070668_100062305 Ga0070668_1000623053 264
273 3300005347 Ga0070668_100268674 Ga0070668_1002686742 264
274 3300005347 Ga0070668_100275365 Ga0070668_1002753652 264
275 3300005347 Ga0070668_100364585 Ga0070668_1003645852 264
276 3300005347 Ga0070668_100531428 Ga0070668_1005314281 264
277 3300005353 Ga0070669_100034960 Ga0070669_1000349603 264
278 3300005353 Ga0070669_100167855 Ga0070669_1001678552 264
279 3300005354 Ga0070675_100000870 Ga0070675_10000087019 264
280 3300005354 Ga0070675_100013048 Ga0070675_1000130485 264
281 3300005355 Ga0070671_100209489 Ga0070671_1002094892 264
282 3300005356 Ga0070674_100037365 Ga0070674_1000373655 264
283 3300005356 Ga0070674_100136840 Ga0070674_1001368402 264
284 3300005364 Ga0070673_100001117 Ga0070673_1000011179 264
285 3300005364 Ga0070673_100572877 Ga0070673_1005728771 264
286 3300005365 Ga0070688_100027498 Ga0070688_1000274985 264
287 3300005366 Ga0070659_100010695 Ga0070659_1000106953 264
288 3300005366 Ga0070659_100017104 Ga0070659_1000171044 264
289 3300005367 Ga0070667_100001328 Ga0070667_10000132815 264
290 3300005367 Ga0070667_100027605 Ga0070667_1000276053 264
291 3300005367 Ga0070667_100281394 Ga0070667_1002813942 264
292 3300005441 Ga0070700_100026468 Ga0070700_1000264683 264
293 3300005441 Ga0070700_100233697 Ga0070700_1002336972 264
294 3300005455 Ga0070663_100003495 Ga0070663_1000034955 264
295 3300005455 Ga0070663_100150760 Ga0070663_1001507602 264
296 3300005456 Ga0070678_100001606 Ga0070678_1000016068 264
297 3300005456 Ga0070678_100208278 Ga0070678_1002082782 264
298 3300005457 Ga0070662_100033859 Ga0070662_1000338594 264
299 3300005457 Ga0070662_100089148 Ga0070662_1000891482 264
300 3300005459 Ga0068867_100010167 Ga0068867_1000101672 264
301 3300005459 Ga0068867_100022373 Ga0068867_1000223732 264
302 3300005459 Ga0068867_100028346 Ga0068867_1000283463 264
303 3300005459 Ga0068867_100167633 Ga0068867_1001676331 264
304 3300005459 Ga0068867_100296952 Ga0068867_1002969522 264
305 3300005466 Ga0070685_10039415 Ga0070685_100394152 264
306 3300005535 Ga0070684_100075820 Ga0070684_1000758202 264
307 3300005539 Ga0068853_100024982 Ga0068853_1000249822 264
308 3300005543 Ga0070672_100028819 Ga0070672_1000288193 264
309 3300005543 Ga0070672_100051724 Ga0070672_1000517242 264
310 3300005547 Ga0070693_100154563 Ga0070693_1001545631 264
311 3300005548 Ga0070665_100473577 Ga0070665_1004735772 264
312 3300005563 Ga0068855_100011670 Ga0068855_1000116707 264
313 3300005564 Ga0070664_100054532 Ga0070664_1000545324 264
314 3300005564 Ga0070664_100189213 Ga0070664_1001892132 264
315 3300005564 Ga0070664_100524547 Ga0070664_1005245472 264
316 3300005577 Ga0068857_100043664 Ga0068857_1000436645 264
317 3300005577 Ga0068857_100136606 Ga0068857_1001366063 264
318 3300005578 Ga0068854_100058603 Ga0068854_1000586032 264
319 3300005578 Ga0068854_100086446 Ga0068854_1000864462 264
320 3300005578 Ga0068854_100090914 Ga0068854_1000909142 264
321 3300005578 Ga0068854_100405571 Ga0068854_1004055712 264
322 3300005614 Ga0068856_100048942 Ga0068856_1000489425 264
323 3300005616 Ga0068852_100013886 Ga0068852_1000138864 264
324 3300005616 Ga0068852_100064443 Ga0068852_1000644432 264
325 3300005616 Ga0068852_100069959 Ga0068852_1000699593 264
326 3300005616 Ga0068852_100379283 Ga0068852_1003792832 264
327 3300005616 Ga0068852_100469339 Ga0068852_1004693391 264
328 3300005617 Ga0068859_100006855 Ga0068859_1000068554 264
329 3300005617 Ga0068859_100064825 Ga0068859_1000648252 264
330 3300005618 Ga0068864_100003331 Ga0068864_1000033318 264
331 3300005618 Ga0068864_100071807 Ga0068864_1000718073 264
332 3300005718 Ga0068866_10002110 Ga0068866_100021106 264
333 3300005719 Ga0068861_100017084 Ga0068861_1000170843 264
334 3300005719 Ga0068861_100037445 Ga0068861_1000374454 264
335 3300005834 Ga0068851_10031418 Ga0068851_100314183 264
336 3300005834 Ga0068851_10059948 Ga0068851_100599483 264
337 3300005840 Ga0068870_10166451 Ga0068870_101664512 264
338 3300005841 Ga0068863_100035873 Ga0068863_1000358732 264
339 3300005841 Ga0068863_100138887 Ga0068863_1001388872 264
340 3300005842 Ga0068858_100056083 Ga0068858_1000560832 264
341 3300005842 Ga0068858_100091301 Ga0068858_1000913012 264
342 3300005842 Ga0068858_100100773 Ga0068858_1001007732 264
343 3300005843 Ga0068860_100002633 Ga0068860_10000263319 264
344 3300005844 Ga0068862_100037778 Ga0068862_1000377783 264
345 3300006195 Ga0075366_10268763 Ga0075366_102687631 264
346 3300006237 Ga0097621_100206030 Ga0097621_1002060303 264
347 3300006358 Ga0068871_100020566 Ga0068871_1000205662 264
348 3300006358 Ga0068871_100024161 Ga0068871_1000241617 264
349 3300006931 Ga0097620_100006855 Ga0097620_1000068554 264
350 3300006931 Ga0097620_100064827 Ga0097620_1000648272 264
351 3300009098 Ga0105245_10069388 Ga0105245_100693882 264
352 3300009098 Ga0105245_10158815 Ga0105245_101588152 264
353 3300009148 Ga0105243_10085004 Ga0105243_100850042 264
354 3300009176 Ga0105242_10070318 Ga0105242_100703183 264
355 3300009177 Ga0105248_10004911 Ga0105248_1000491111 264
356 3300009177 Ga0105248_10044730 Ga0105248_100447308 264
357 3300009177 Ga0105248_10141901 Ga0105248_101419012 264
358 3300009177 Ga0105248_10222747 Ga0105248_102227472 264
359 3300009545 Ga0105237_10027992 Ga0105237_100279922 264
360 3300009551 Ga0105238_10058048 Ga0105238_100580482 264
361 3300009551 Ga0105238_10416280 Ga0105238_104162802 264
362 3300009553 Ga0105249_10020966 Ga0105249_100209663 264
363 3300009553 Ga0105249_10111242 Ga0105249_101112422 264
364 3300013100 Ga0157373_10029096 Ga0157373_100290962 264
365 3300013104 Ga0157370_10144773 Ga0157370_101447732 264
366 3300013104 Ga0157370_10478432 Ga0157370_104784322 264
367 3300013105 Ga0157369_10041410 Ga0157369_100414106 264
368 3300013105 Ga0157369_10072252 Ga0157369_100722523 264
369 3300013296 Ga0157374_10188457 Ga0157374_101884573 264
370 3300013297 Ga0157378_10141289 Ga0157378_101412892 264
371 3300013297 Ga0157378_10170508 Ga0157378_101705082 264
372 3300013297 Ga0157378_10273167 Ga0157378_102731672 264
373 3300013306 Ga0163162_10017572 Ga0163162_100175724 264
374 3300013306 Ga0163162_10063034 Ga0163162_100630342 264
375 3300013306 Ga0163162_10527549 Ga0163162_105275491 264
376 3300013307 Ga0157372_10020606 Ga0157372_100206067 264
377 3300013307 Ga0157372_10036073 Ga0157372_100360733 264
378 3300013307 Ga0157372_10192562 Ga0157372_101925622 264
379 3300013308 Ga0157375_10032143 Ga0157375_100321435 264
380 3300013308 Ga0157375_10057979 Ga0157375_100579792 264
381 3300013308 Ga0157375_10095193 Ga0157375_100951935 264
382 3300014325 Ga0163163_10027737 Ga0163163_100277378 264
383 3300014325 Ga0163163_10483504 Ga0163163_104835042 264
384 3300014326 Ga0157380_10066878 Ga0157380_100668783 264
385 3300014326 Ga0157380_10222802 Ga0157380_102228022 264
386 3300014745 Ga0157377_10000667 Ga0157377_1000066713 264
387 3300014968 Ga0157379_10002348 Ga0157379_100023489 264
388 3300014968 Ga0157379_10024171 Ga0157379_100241715 264
389 3300014968 Ga0157379_10115021 Ga0157379_101150213 264
390 3300014969 Ga0157376_10003810 Ga0157376_1000381010 264
391 3300014969 Ga0157376_10034752 Ga0157376_100347527 264
392 3300014969 Ga0157376_10279533 Ga0157376_102795332 264
393 3300015265 Ga0182005_1042384 Ga0182005_10423841 264
394 3300017792 Ga0163161_10022792 Ga0163161_100227923 264
395 3300017792 Ga0163161_10026880 Ga0163161_100268805 264
396 3300017792 Ga0163161_10037708 Ga0163161_100377083 264
397 3300017792 Ga0163161_10132250 Ga0163161_101322502 264
398 3300025284 Ga0209130_1002187 Ga0209130_10021878 264
399 3300025291 Ga0209675_1001070 Ga0209675_100107010 264
400 3300025292 Ga0209676_1003856 Ga0209676_10038569 264
401 3300025304 Ga0209257_1020086 Ga0209257_10200863 264
402 3300025321 Ga0207656_10031946 Ga0207656_100319462 264
403 3300025321 Ga0207656_10040179 Ga0207656_100401793 264
404 3300025893 Ga0207682_10015787 Ga0207682_100157873 264
405 3300025899 Ga0207642_10010207 Ga0207642_100102073 264
406 3300025901 Ga0207688_10149106 Ga0207688_101491062 264
407 3300025907 Ga0207645_10003883 Ga0207645_100038836 264
408 3300025907 Ga0207645_10008444 Ga0207645_100084443 264
409 3300025907 Ga0207645_10091160 Ga0207645_100911602 264
410 3300025909 Ga0207705_10024942 Ga0207705_100249422 264
411 3300025911 Ga0207654_10114102 Ga0207654_101141023 264
412 3300025918 Ga0207662_10003115 Ga0207662_100031159 264
413 3300025919 Ga0207657_10142446 Ga0207657_101424463 264
414 3300025920 Ga0207649_10009302 Ga0207649_100093021 264
415 3300025920 Ga0207649_10182210 Ga0207649_101822102 264
416 3300025923 Ga0207681_10004565 Ga0207681_100045659 264
417 3300025924 Ga0207694_10020004 Ga0207694_100200043 264
418 3300025924 Ga0207694_10158182 Ga0207694_101581823 264
419 3300025925 Ga0207650_10009549 Ga0207650_100095493 264
420 3300025925 Ga0207650_10059182 Ga0207650_100591823 264
421 3300025925 Ga0207650_10076123 Ga0207650_100761234 264
422 3300025926 Ga0207659_10002086 Ga0207659_100020863 264
423 3300025926 Ga0207659_10009153 Ga0207659_100091533 264
424 3300025926 Ga0207659_10078549 Ga0207659_100785492 264
425 3300025926 Ga0207659_10086656 Ga0207659_100866562 264
426 3300025927 Ga0207687_10107995 Ga0207687_101079952 264
427 3300025931 Ga0207644_10005655 Ga0207644_100056557 264
428 3300025931 Ga0207644_10114399 Ga0207644_101143992 264
429 3300025933 Ga0207706_10001684 Ga0207706_1000168416 264
430 3300025933 Ga0207706_10035026 Ga0207706_100350268 264
431 3300025933 Ga0207706_10198755 Ga0207706_101987552 264
432 3300025936 Ga0207670_10072598 Ga0207670_100725982 264
433 3300025939 Ga0207665_10063452 Ga0207665_100634523 264
434 3300025940 Ga0207691_10044257 Ga0207691_100442572 264
435 3300025940 Ga0207691_10129100 Ga0207691_101291002 264
436 3300025940 Ga0207691_10178880 Ga0207691_101788802 264
437 3300025941 Ga0207711_10008678 Ga0207711_100086785 264
438 3300025941 Ga0207711_10063613 Ga0207711_100636132 264
439 3300025941 Ga0207711_10246400 Ga0207711_102464002 264
440 3300025942 Ga0207689_10000393 Ga0207689_1000039340 264
441 3300025942 Ga0207689_10007718 Ga0207689_100077183 264
442 3300025944 Ga0207661_10022350 Ga0207661_100223505 264
443 3300025945 Ga0207679_10018103 Ga0207679_100181032 264
444 3300025945 Ga0207679_10176587 Ga0207679_101765872 264
445 3300025960 Ga0207651_10209422 Ga0207651_102094222 264
446 3300025961 Ga0207712_10024409 Ga0207712_100244093 264
447 3300025972 Ga0207668_10019692 Ga0207668_100196922 264
448 3300025972 Ga0207668_10081448 Ga0207668_100814482 264
449 3300025972 Ga0207668_10249185 Ga0207668_102491852 264
450 3300025981 Ga0207640_10023728 Ga0207640_100237285 264
451 3300025981 Ga0207640_10050144 Ga0207640_100501442 264
452 3300025981 Ga0207640_10377699 Ga0207640_103776992 264
453 3300025986 Ga0207658_10002016 Ga0207658_100020169 264
454 3300025986 Ga0207658_10006229 Ga0207658_100062292 264
455 3300026023 Ga0207677_10000891 Ga0207677_100008915 264
456 3300026023 Ga0207677_10007442 Ga0207677_100074423 264
457 3300026035 Ga0207703_10000937 Ga0207703_1000093731 264
458 3300026035 Ga0207703_10062751 Ga0207703_100627512 264
459 3300026035 Ga0207703_10172963 Ga0207703_101729632 264
460 3300026041 Ga0207639_10024620 Ga0207639_100246206 264
461 3300026041 Ga0207639_10187006 Ga0207639_101870061 264
462 3300026067 Ga0207678_10008511 Ga0207678_100085115 264
463 3300026067 Ga0207678_10183622 Ga0207678_101836221 264
464 3300026067 Ga0207678_10206019 Ga0207678_102060192 264
465 3300026075 Ga0207708_10170201 Ga0207708_101702012 264
466 3300026078 Ga0207702_10438148 Ga0207702_104381481 264
467 3300026088 Ga0207641_10000743 Ga0207641_100007439 264
468 3300026088 Ga0207641_10016984 Ga0207641_100169842 264
469 3300026089 Ga0207648_10018023 Ga0207648_100180233 264
470 3300026089 Ga0207648_10020752 Ga0207648_100207522 264
471 3300026089 Ga0207648_10030545 Ga0207648_100305455 264
472 3300026089 Ga0207648_10143258 Ga0207648_101432582 264
473 3300026089 Ga0207648_10151679 Ga0207648_101516792 264
474 3300026089 Ga0207648_10275937 Ga0207648_102759372 264
475 3300026095 Ga0207676_10036783 Ga0207676_100367832 264
476 3300026095 Ga0207676_10047448 Ga0207676_100474484 264
477 3300026095 Ga0207676_10144607 Ga0207676_101446072 264
478 3300026116 Ga0207674_10050452 Ga0207674_100504522 264
479 3300026116 Ga0207674_10089773 Ga0207674_100897732 264
480 3300026118 Ga0207675_100002300 Ga0207675_10000230011 264
481 3300026118 Ga0207675_100016484 Ga0207675_1000164843 264
482 3300026121 Ga0207683_10015961 Ga0207683_100159613 264
483 3300026121 Ga0207683_10022854 Ga0207683_100228548 264
484 3300026121 Ga0207683_10035034 Ga0207683_100350345 264
485 3300026121 Ga0207683_10081225 Ga0207683_100812252 264
486 3300026121 Ga0207683_10228599 Ga0207683_102285993 264
487 3300026121 Ga0207683_10294611 Ga0207683_102946112 264
488 3300026121 Ga0207683_10337592 Ga0207683_103375922 264
489 3300026142 Ga0207698_10043585 Ga0207698_100435851 264
490 3300026142 Ga0207698_10102538 Ga0207698_101025384 264
491 3300026142 Ga0207698_10165882 Ga0207698_101658822 264
492 3300027907 Ga0207428_10303533 Ga0207428_103035332 264
493 3300028379 Ga0268266_10247797 Ga0268266_102477971 264
494 3300028380 Ga0268265_10009768 Ga0268265_100097685 264
495 3300028380 Ga0268265_10065273 Ga0268265_100652733 264
496 3300028381 Ga0268264_10011641 Ga0268264_100116412 264
497 3300028794 Ga0307515_10157840 Ga0307515_101578404 264
498 3300031824 Ga0307413_10457911 Ga0307413_104579111 264
499 3300031911 Ga0307412_10198834 Ga0307412_101988341 264
500 3300034816 Ga0373930_0018759 Ga0373930_0018759_339_1154 264
501 3300035172 Ga0373955_0245852 Ga0373955_0245852_228_1043 264
502 3300035691 Ga0373931_0000504 Ga0373931_0000504_5029_5844 264
503 3300039438 Ga0436360_0810517 Ga0436360_0810517_443_1255 264
504 3300046528 Ga0495642_0003932 Ga0495642_0003932_4736_5554 264
505 3300046615 Ga0495656_0001626 Ga0495656_0001626_4733_5548 264
506 3300046691 Ga0495670_0102045 Ga0495670_0102045_543_1358 264
507 3300048904 Ga0496101_0103073 Ga0496101_0103073_817_1632 264
508 3300048905 Ga0496102_0181004 Ga0496102_0181004_650_1465 264
509 3300048908 Ga0496105_0320558 Ga0496105_0320558_244_1056 264
510 3300048909 Ga0496106_0035455 Ga0496106_0035455_1302_2117 264
511 3300048910 Ga0496107_0026941 Ga0496107_0026941_132_947 264
512 3300048911 Ga0496108_0040004 Ga0496108_0040004_2024_2842 264
513 3300048911 Ga0496108_0368018 Ga0496108_0368018_261_1079 264
514 3300048912 Ga0496109_0026135 Ga0496109_0026135_1896_2714 264
515 3300048912 Ga0496109_0469655 Ga0496109_0469655_13_831 264
516 3300048913 Ga0496110_0057761 Ga0496110_0057761_1311_2129 264
517 3300048913 Ga0496110_0168793 Ga0496110_0168793_399_1217 264
518 3300048913 Ga0496110_0230145 Ga0496110_0230145_126_944 264
519 3300048914 Ga0496111_0043930 Ga0496111_0043930_1035_1853 264
520 3300048916 Ga0496113_0013212 Ga0496113_0013212_4078_4893 264
521 3300048917 Ga0496114_0114273 Ga0496114_0114273_620_1435 264
522 3300048917 Ga0496114_0502999 Ga0496114_0502999_55_873 264
523 3300048918 Ga0496115_0039829 Ga0496115_0039829_676_1491 264
524 3300050493 nmdc:mga0k408_310657_c1 nmdc:mga0k408_310657_c1_85_897 264
525 3300053088 Ga0500644_0066890 Ga0500644_0066890_47_859 264
526 3300003752 Ga0055539_1000116 Ga0055539_100011679 265
527 3300003756 Ga0055533_1000016 Ga0055533_1000016300 265
528 3300003759 Ga0055525_1001924 Ga0055525_10019243 265
529 3300005355 Ga0070671_100005297 Ga0070671_1000052971 265
530 3300005366 Ga0070659_100000966 Ga0070659_1000009665 265
531 3300005459 Ga0068867_100000059 Ga0068867_10000005948 265
532 3300009148 Ga0105243_10002725 Ga0105243_100027252 265
533 3300014745 Ga0157377_10000029 Ga0157377_1000002977 265
534 3300025226 Ga0209674_100041 Ga0209674_10004184 265
535 3300025230 Ga0209563_100043 Ga0209563_10004384 265
536 3300025253 Ga0209677_100077 Ga0209677_10007784 265
537 3300025931 Ga0207644_10016274 Ga0207644_100162745 265
538 3300025932 Ga0207690_10000648 Ga0207690_100006485 265
539 3300025935 Ga0207709_10003391 Ga0207709_1000339112 265
540 3300026089 Ga0207648_10000080 Ga0207648_1000008049 265
541 3300046455 Ga0495603_0027429 Ga0495603_0027429_275_1084 265
542 3300046459 Ga0495629_0047329 Ga0495629_0047329_83_892 265
543 3300046473 Ga0495582_0126627 Ga0495582_0126627_507_1316 265
544 3300046474 Ga0495605_0119492 Ga0495605_0119492_103_912 265
545 3300046500 Ga0495596_0021368 Ga0495596_0021368_1661_2470 265
546 3300046506 Ga0495583_0034454 Ga0495583_0034454_463_1272 265
547 3300046513 Ga0495616_0148856 Ga0495616_0148856_134_943 265
548 3300046518 Ga0495631_0155078 Ga0495631_0155078_29_838 265
549 3300046528 Ga0495642_0008922 Ga0495642_0008922_2144_2953 265
550 3300046530 Ga0495654_0072000 Ga0495654_0072000_123_932 265
551 3300046536 Ga0495587_0030309 Ga0495587_0030309_1681_2490 265
552 3300046538 Ga0495609_0084414 Ga0495609_0084414_118_927 265
553 3300046543 Ga0495645_0103938 Ga0495645_0103938_523_1332 265
554 3300046543 Ga0495645_0313842 Ga0495645_0313842_109_918 265
555 3300046616 Ga0495668_0170171 Ga0495668_0170171_101_913 265
556 3300046648 Ga0495611_0040361 Ga0495611_0040361_1061_1870 265
557 3300046674 Ga0495588_0016977 Ga0495588_0016977_1601_2410 265
558 3300046680 Ga0495646_0026803 Ga0495646_0026803_2344_3153 265
559 3300046689 Ga0495613_0018108 Ga0495613_0018108_550_1359 265
560 3300046694 Ga0495649_0089720 Ga0495649_0089720_800_1609 265
561 3300046794 Ga0495589_0005569 Ga0495589_0005569_2681_3490 265
562 3300047322 Ga0495680_0067421 Ga0495680_0067421_300_1109 265
563 3300047323 Ga0495683_0027109 Ga0495683_0027109_577_1386 265
564 3300047445 Ga0495677_0011886 Ga0495677_0011886_131_940 265
565 3300047446 Ga0495679_041826 Ga0495679_041826_59_868 265
566 3300047470 Ga0495681_0050388 Ga0495681_0050388_143_952 265
567 3300048089 Ga0495614_0009086 Ga0495614_0009086_1293_2102 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

92

164

0.89

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

90

162

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zzs-assembly1.cif.gz_A crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.9667 91 165
4o1w-assembly2.cif.gz_B crystal structure of colwellia psychrerythraea cytochrome c 0.9615 91 165
1cno-assembly1.cif.gz_A structure of pseudomonas nautica cytochrome c552, by mad method 0.9498 91 166
2zzs-assembly29.cif.gz_3 crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.9475 91 165
4o1w-assembly2.cif.gz_B crystal structure of colwellia psychrerythraea cytochrome c 0.9144 91 165
ID Description Score Start End Superfamily
4o1wD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9625 91 165 1.10.760.10
1h1oB02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9572 101 165 1.10.760.10
2zzsM00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9555 92 164 1.10.760.10
2zzsS00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9539 91 165 1.10.760.10
1cnoH00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9521 91 166 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A7Y3AN32-F1-model_v4 C-type cytochrome 0.9719 91 167 GO:0009055
GO:0020037
GO:0046872
AF-A0A0N0JTD0-F1-model_v4 Cytochrome c domain-containing protein 0.9654 94 167 GO:0009055
GO:0020037
GO:0046872
AF-A0A832E710-F1-model_v4 Cytochrome c 0.9622 89 167 GO:0009055
GO:0020037
GO:0046872
AF-A0A6N6P183-F1-model_v4 C-type cytochrome 0.9356 93 171 GO:0009055
GO:0020037
GO:0046872
AF-A0A1Q8GE37-F1-model_v4 Cytochrome C554 0.9309 91 173 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
80.31 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map