F464525
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 272 | 567 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_10132300|Ga0307410_101323001 |
| Length | 276 |
| Sequence | MNESPLFSWRNRIFRRTVMALAASTVLLMLVGFVWLPSAHEDFTVQGLWASICRAAGVPTSWRTGSEVEGQRISSRVSLTPSLARVEGNDAVGRGATLALNCTMCHGVQGMSISNSPNLAGQYPEVVIKQLQDYRSGHRSSPIMEAIASTLSDQDIRDLAAYYAFLPKARTAPTTYDETLPALVRVGDPMRNIAPCISCHGQVDQKLGTPWLEGMPKQYLVDQLNAFIAGTRRNDPGAQMRNMVRAMTPEEINEVATFYARKASAGEPEQAAAVVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 2 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 3 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 258 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 259 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 263 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 269 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 271 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.35 |
| Nodule | 0.35 |
| Rhizoplane | 6.88 |
| Rhizosphere | 85.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055539_1000116 | 3300003752 | Bacteria | 88977 |
| 2 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 3 | Ga0055525_1001924 | 3300003759 | Bacteria | 2662 |
| 4 | Ga0055524_1000061 | 3300003775 | Bacteria | 135241 |
| 5 | Ga0055534_1003031 | 3300003784 | Bacteria | 5513 |
| 6 | Ga0055534_1006182 | 3300003784 | Bacteria | 3063 |
| 7 | Ga0055530_10000646 | 3300003791 | Bacteria | 29962 |
| 8 | Ga0055530_10001932 | 3300003791 | Bacteria | 14135 |
| 9 | Ga0055540_1000026 | 3300003792 | Bacteria | 189071 |
| 10 | Ga0055540_1018701 | 3300003792 | Bacteria | 1892 |
| 11 | Ga0055531_10001026 | 3300003794 | Bacteria | 22103 |
| 12 | Ga0065165_1000292 | 3300005262 | Bacteria | 84843 |
| 13 | Ga0065165_1011948 | 3300005262 | Bacteria | 3573 |
| 14 | Ga0065714_10017685 | 3300005288 | Bacteria | 1753 |
| 15 | Ga0065714_10074155 | 3300005288 | Bacteria | 3077 |
| 16 | Ga0070658_10016866 | 3300005327 | Bacteria | 5846 |
| 17 | Ga0070658_10020329 | 3300005327 | Bacteria | 5321 |
| 18 | Ga0070658_10033011 | 3300005327 | Bacteria | 4162 |
| 19 | Ga0070658_10277439 | 3300005327 | Bacteria | 1426 |
| 20 | Ga0070676_10011161 | 3300005328 | Bacteria | 4880 |
| 21 | Ga0070683_100008291 | 3300005329 | Bacteria | 8830 |
| 22 | Ga0070683_100490964 | 3300005329 | Bacteria | 1173 |
| 23 | Ga0070670_100005171 | 3300005331 | Bacteria | 10984 |
| 24 | Ga0070670_100007752 | 3300005331 | Bacteria | 9133 |
| 25 | Ga0070670_100044343 | 3300005331 | Bacteria | 3824 |
| 26 | Ga0070670_100200583 | 3300005331 | Bacteria | 1733 |
| 27 | Ga0070677_10065364 | 3300005333 | Bacteria | 1513 |
| 28 | Ga0070677_10072526 | 3300005333 | Unclassified | 1452 |
| 29 | Ga0068869_100013863 | 3300005334 | Bacteria | 5374 |
| 30 | Ga0070666_10423091 | 3300005335 | Bacteria | 959 |
| 31 | Ga0070680_100206511 | 3300005336 | Bacteria | 1657 |
| 32 | Ga0068868_100007188 | 3300005338 | Bacteria | 7911 |
| 33 | Ga0068868_100107992 | 3300005338 | Bacteria | 2259 |
| 34 | Ga0068868_100144564 | 3300005338 | Bacteria | 1955 |
| 35 | Ga0068868_100231661 | 3300005338 | Bacteria | 1550 |
| 36 | Ga0068868_100334005 | 3300005338 | Bacteria | 1294 |
| 37 | Ga0070660_100001577 | 3300005339 | Bacteria | 15675 |
| 38 | Ga0070689_100183321 | 3300005340 | Bacteria | 1702 |
| 39 | Ga0070689_100241579 | 3300005340 | Bacteria | 1487 |
| 40 | Ga0070687_100022947 | 3300005343 | Bacteria | 2959 |
| 41 | Ga0070661_100008362 | 3300005344 | Bacteria | 7149 |
| 42 | Ga0070692_10115924 | 3300005345 | Bacteria | 1488 |
| 43 | Ga0070668_100062305 | 3300005347 | Bacteria | 2889 |
| 44 | Ga0070668_100268674 | 3300005347 | Bacteria | 1421 |
| 45 | Ga0070668_100275365 | 3300005347 | Bacteria | 1404 |
| 46 | Ga0070668_100364585 | 3300005347 | Bacteria | 1226 |
| 47 | Ga0070668_100531428 | 3300005347 | Bacteria | 1021 |
| 48 | Ga0070669_100034960 | 3300005353 | Bacteria | 3639 |
| 49 | Ga0070669_100167855 | 3300005353 | Bacteria | 1709 |
| 50 | Ga0070675_100000870 | 3300005354 | Bacteria | 21464 |
| 51 | Ga0070675_100013048 | 3300005354 | Bacteria | 6526 |
| 52 | Ga0070675_100020449 | 3300005354 | Bacteria | 5281 |
| 53 | Ga0070671_100005297 | 3300005355 | Bacteria | 10293 |
| 54 | Ga0070671_100038116 | 3300005355 | Bacteria | 3990 |
| 55 | Ga0070671_100044641 | 3300005355 | Bacteria | 3683 |
| 56 | Ga0070671_100046201 | 3300005355 | Bacteria | 3621 |
| 57 | Ga0070671_100209489 | 3300005355 | Bacteria | 1653 |
| 58 | Ga0070674_100037365 | 3300005356 | Bacteria | 3266 |
| 59 | Ga0070674_100136840 | 3300005356 | Bacteria | 1833 |
| 60 | Ga0070673_100001117 | 3300005364 | Bacteria | 15388 |
| 61 | Ga0070673_100157821 | 3300005364 | Unclassified | 1927 |
| 62 | Ga0070673_100162860 | 3300005364 | Bacteria | 1898 |
| 63 | Ga0070673_100185629 | 3300005364 | Bacteria | 1783 |
| 64 | Ga0070673_100572877 | 3300005364 | Bacteria | 1027 |
| 65 | Ga0070688_100027498 | 3300005365 | Bacteria | 3389 |
| 66 | Ga0070659_100000861 | 3300005366 | Bacteria | 22182 |
| 67 | Ga0070659_100000966 | 3300005366 | Bacteria | 21152 |
| 68 | Ga0070659_100010695 | 3300005366 | Bacteria | 6760 |
| 69 | Ga0070659_100017104 | 3300005366 | Bacteria | 5451 |
| 70 | Ga0070659_100204281 | 3300005366 | Bacteria | 1627 |
| 71 | Ga0070667_100001328 | 3300005367 | Bacteria | 22207 |
| 72 | Ga0070667_100027605 | 3300005367 | Bacteria | 4723 |
| 73 | Ga0070667_100033553 | 3300005367 | Bacteria | 4292 |
| 74 | Ga0070667_100052245 | 3300005367 | Bacteria | 3448 |
| 75 | Ga0070667_100114463 | 3300005367 | Bacteria | 2342 |
| 76 | Ga0070667_100281394 | 3300005367 | Bacteria | 1493 |
| 77 | Ga0070700_100026468 | 3300005441 | Bacteria | 3426 |
| 78 | Ga0070700_100233697 | 3300005441 | Bacteria | 1310 |
| 79 | Ga0070663_100003495 | 3300005455 | Bacteria | 9065 |
| 80 | Ga0070663_100150760 | 3300005455 | Bacteria | 1783 |
| 81 | Ga0070678_100001606 | 3300005456 | Bacteria | 12113 |
| 82 | Ga0070678_100074966 | 3300005456 | Bacteria | 2544 |
| 83 | Ga0070678_100147020 | 3300005456 | Bacteria | 1893 |
| 84 | Ga0070678_100208278 | 3300005456 | Bacteria | 1618 |
| 85 | Ga0070662_100033859 | 3300005457 | Bacteria | 3600 |
| 86 | Ga0070662_100089148 | 3300005457 | Bacteria | 2313 |
| 87 | Ga0070662_100139361 | 3300005457 | Bacteria | 1878 |
| 88 | Ga0068867_100000059 | 3300005459 | Bacteria | 68279 |
| 89 | Ga0068867_100010167 | 3300005459 | Bacteria | 6638 |
| 90 | Ga0068867_100022373 | 3300005459 | Bacteria | 4520 |
| 91 | Ga0068867_100028346 | 3300005459 | Bacteria | 4032 |
| 92 | Ga0068867_100167633 | 3300005459 | Bacteria | 1737 |
| 93 | Ga0068867_100296952 | 3300005459 | Bacteria | 1330 |
| 94 | Ga0068867_100494657 | 3300005459 | Bacteria | 1050 |
| 95 | Ga0070685_10039415 | 3300005466 | Bacteria | 2684 |
| 96 | Ga0070679_100032855 | 3300005530 | Bacteria | 5135 |
| 97 | Ga0070684_100075820 | 3300005535 | Bacteria | 2967 |
| 98 | Ga0068853_100024982 | 3300005539 | Bacteria | 5013 |
| 99 | Ga0070672_100003033 | 3300005543 | Bacteria | 10820 |
| 100 | Ga0070672_100028819 | 3300005543 | Bacteria | 4157 |
| 101 | Ga0070672_100034960 | 3300005543 | Bacteria | 3816 |
| 102 | Ga0070672_100051713 | 3300005543 | Bacteria | 3206 |
| 103 | Ga0070672_100051724 | 3300005543 | Bacteria | 3205 |
| 104 | Ga0070693_100154563 | 3300005547 | Bacteria | 1456 |
| 105 | Ga0070693_100251913 | 3300005547 | Bacteria | 1171 |
| 106 | Ga0070665_100184007 | 3300005548 | Bacteria | 2090 |
| 107 | Ga0070665_100473577 | 3300005548 | Bacteria | 1263 |
| 108 | Ga0068855_100000843 | 3300005563 | Bacteria | 37997 |
| 109 | Ga0068855_100011670 | 3300005563 | Bacteria | 10618 |
| 110 | Ga0070664_100054532 | 3300005564 | Bacteria | 3391 |
| 111 | Ga0070664_100189213 | 3300005564 | Bacteria | 1833 |
| 112 | Ga0070664_100524547 | 3300005564 | Bacteria | 1093 |
| 113 | Ga0068857_100000194 | 3300005577 | Bacteria | 39279 |
| 114 | Ga0068857_100043664 | 3300005577 | Bacteria | 3975 |
| 115 | Ga0068857_100136606 | 3300005577 | Bacteria | 2214 |
| 116 | Ga0068854_100058603 | 3300005578 | Bacteria | 2780 |
| 117 | Ga0068854_100086446 | 3300005578 | Bacteria | 2324 |
| 118 | Ga0068854_100090914 | 3300005578 | Bacteria | 2271 |
| 119 | Ga0068854_100405571 | 3300005578 | Bacteria | 1129 |
| 120 | Ga0068856_100048942 | 3300005614 | Bacteria | 4166 |
| 121 | Ga0068852_100007924 | 3300005616 | Bacteria | 7782 |
| 122 | Ga0068852_100013886 | 3300005616 | Bacteria | 6176 |
| 123 | Ga0068852_100064443 | 3300005616 | Bacteria | 3194 |
| 124 | Ga0068852_100069959 | 3300005616 | Bacteria | 3077 |
| 125 | Ga0068852_100177329 | 3300005616 | Bacteria | 2002 |
| 126 | Ga0068852_100379283 | 3300005616 | Bacteria | 1387 |
| 127 | Ga0068852_100469339 | 3300005616 | Bacteria | 1249 |
| 128 | Ga0068852_100501071 | 3300005616 | Bacteria | 1209 |
| 129 | Ga0068859_100006855 | 3300005617 | Bacteria | 11571 |
| 130 | Ga0068859_100064825 | 3300005617 | Bacteria | 3686 |
| 131 | Ga0068864_100003331 | 3300005618 | Bacteria | 13278 |
| 132 | Ga0068864_100060046 | 3300005618 | Bacteria | 3291 |
| 133 | Ga0068864_100071807 | 3300005618 | Bacteria | 3015 |
| 134 | Ga0068864_100364243 | 3300005618 | Bacteria | 1367 |
| 135 | Ga0068864_100546074 | 3300005618 | Bacteria | 1119 |
| 136 | Ga0068866_10002110 | 3300005718 | Bacteria | 8270 |
| 137 | Ga0068861_100017084 | 3300005719 | Bacteria | 5145 |
| 138 | Ga0068861_100037445 | 3300005719 | Bacteria | 3606 |
| 139 | Ga0068861_100151194 | 3300005719 | Bacteria | 1905 |
| 140 | Ga0068851_10031418 | 3300005834 | Bacteria | 2637 |
| 141 | Ga0068851_10059948 | 3300005834 | Bacteria | 1947 |
| 142 | Ga0068870_10166451 | 3300005840 | Bacteria | 1312 |
| 143 | Ga0068863_100035873 | 3300005841 | Bacteria | 4722 |
| 144 | Ga0068863_100048599 | 3300005841 | Bacteria | 4022 |
| 145 | Ga0068863_100100956 | 3300005841 | Bacteria | 2743 |
| 146 | Ga0068863_100129312 | 3300005841 | Bacteria | 2411 |
| 147 | Ga0068863_100138887 | 3300005841 | Bacteria | 2322 |
| 148 | Ga0068858_100056083 | 3300005842 | Bacteria | 3642 |
| 149 | Ga0068858_100091301 | 3300005842 | Bacteria | 2834 |
| 150 | Ga0068858_100100773 | 3300005842 | Bacteria | 2693 |
| 151 | Ga0068860_100002633 | 3300005843 | Bacteria | 18673 |
| 152 | Ga0068862_100037778 | 3300005844 | Bacteria | 4093 |
| 153 | Ga0075366_10268763 | 3300006195 | Bacteria | 1041 |
| 154 | Ga0097621_100014293 | 3300006237 | Bacteria | 5936 |
| 155 | Ga0097621_100123070 | 3300006237 | Bacteria | 2202 |
| 156 | Ga0097621_100206030 | 3300006237 | Bacteria | 1709 |
| 157 | Ga0068871_100002846 | 3300006358 | Bacteria | 11851 |
| 158 | Ga0068871_100020566 | 3300006358 | Bacteria | 5058 |
| 159 | Ga0068871_100024161 | 3300006358 | Bacteria | 4709 |
| 160 | Ga0068871_100108940 | 3300006358 | Bacteria | 2328 |
| 161 | Ga0097620_100006855 | 3300006931 | Bacteria | 11571 |
| 162 | Ga0097620_100064827 | 3300006931 | Bacteria | 3686 |
| 163 | Ga0079104_1000093 | 3300006946 | Bacteria | 130633 |
| 164 | Ga0111539_10045749 | 3300009094 | Bacteria | 5238 |
| 165 | Ga0111539_10474288 | 3300009094 | Bacteria | 1457 |
| 166 | Ga0105245_10069388 | 3300009098 | Bacteria | 3196 |
| 167 | Ga0105245_10096513 | 3300009098 | Bacteria | 2728 |
| 168 | Ga0105245_10158815 | 3300009098 | Bacteria | 2144 |
| 169 | Ga0105243_10002725 | 3300009148 | Bacteria | 14684 |
| 170 | Ga0105243_10085004 | 3300009148 | Bacteria | 2592 |
| 171 | Ga0105242_10070318 | 3300009176 | Bacteria | 2901 |
| 172 | Ga0105242_10414217 | 3300009176 | Bacteria | 1261 |
| 173 | Ga0105248_10004911 | 3300009177 | Bacteria | 14772 |
| 174 | Ga0105248_10007526 | 3300009177 | Bacteria | 11952 |
| 175 | Ga0105248_10019477 | 3300009177 | Bacteria | 7508 |
| 176 | Ga0105248_10044730 | 3300009177 | Bacteria | 4965 |
| 177 | Ga0105248_10141901 | 3300009177 | Bacteria | 2710 |
| 178 | Ga0105248_10222747 | 3300009177 | Bacteria | 2123 |
| 179 | Ga0105237_10027992 | 3300009545 | Bacteria | 5743 |
| 180 | Ga0105238_10058048 | 3300009551 | Bacteria | 3880 |
| 181 | Ga0105238_10416280 | 3300009551 | Bacteria | 1338 |
| 182 | Ga0105238_10586539 | 3300009551 | Bacteria | 1121 |
| 183 | Ga0105249_10020966 | 3300009553 | Bacteria | 5847 |
| 184 | Ga0105249_10111242 | 3300009553 | Bacteria | 2590 |
| 185 | Ga0157373_10029096 | 3300013100 | Bacteria | 3982 |
| 186 | Ga0157370_10144773 | 3300013104 | Bacteria | 2213 |
| 187 | Ga0157370_10478432 | 3300013104 | Bacteria | 1144 |
| 188 | Ga0157369_10041410 | 3300013105 | Bacteria | 5028 |
| 189 | Ga0157369_10072252 | 3300013105 | Bacteria | 3703 |
| 190 | Ga0157374_10031619 | 3300013296 | Bacteria | 4813 |
| 191 | Ga0157374_10188457 | 3300013296 | Bacteria | 2017 |
| 192 | Ga0157378_10141289 | 3300013297 | Bacteria | 2236 |
| 193 | Ga0157378_10170508 | 3300013297 | Bacteria | 2041 |
| 194 | Ga0157378_10273167 | 3300013297 | Bacteria | 1626 |
| 195 | Ga0157378_10365010 | 3300013297 | Bacteria | 1414 |
| 196 | Ga0163162_10017572 | 3300013306 | Bacteria | 6998 |
| 197 | Ga0163162_10021530 | 3300013306 | Bacteria | 6351 |
| 198 | Ga0163162_10063034 | 3300013306 | Bacteria | 3749 |
| 199 | Ga0163162_10128886 | 3300013306 | Bacteria | 2638 |
| 200 | Ga0163162_10527549 | 3300013306 | Bacteria | 1310 |
| 201 | Ga0157372_10020606 | 3300013307 | Bacteria | 7116 |
| 202 | Ga0157372_10036073 | 3300013307 | Bacteria | 5448 |
| 203 | Ga0157372_10192562 | 3300013307 | Bacteria | 2362 |
| 204 | Ga0157375_10025327 | 3300013308 | Bacteria | 5510 |
| 205 | Ga0157375_10032143 | 3300013308 | Bacteria | 4974 |
| 206 | Ga0157375_10057979 | 3300013308 | Bacteria | 3830 |
| 207 | Ga0157375_10095193 | 3300013308 | Bacteria | 3048 |
| 208 | Ga0157375_10114841 | 3300013308 | Bacteria | 2795 |
| 209 | Ga0157375_10187575 | 3300013308 | Bacteria | 2222 |
| 210 | Ga0157375_10298308 | 3300013308 | Bacteria | 1775 |
| 211 | Ga0157375_10375486 | 3300013308 | Bacteria | 1588 |
| 212 | Ga0163163_10027737 | 3300014325 | Bacteria | 5429 |
| 213 | Ga0163163_10483504 | 3300014325 | Bacteria | 1299 |
| 214 | Ga0157380_10066878 | 3300014326 | Bacteria | 2892 |
| 215 | Ga0157380_10137578 | 3300014326 | Bacteria | 2093 |
| 216 | Ga0157380_10222802 | 3300014326 | Bacteria | 1688 |
| 217 | Ga0182008_10000701 | 3300014497 | Bacteria | 24012 |
| 218 | Ga0157377_10000029 | 3300014745 | Bacteria | 134270 |
| 219 | Ga0157377_10000667 | 3300014745 | Bacteria | 14251 |
| 220 | Ga0157379_10002348 | 3300014968 | Bacteria | 15791 |
| 221 | Ga0157379_10024171 | 3300014968 | Bacteria | 5393 |
| 222 | Ga0157379_10100542 | 3300014968 | Bacteria | 2596 |
| 223 | Ga0157379_10115021 | 3300014968 | Bacteria | 2418 |
| 224 | Ga0157379_10244813 | 3300014968 | Bacteria | 1627 |
| 225 | Ga0157376_10003810 | 3300014969 | Bacteria | 10430 |
| 226 | Ga0157376_10034752 | 3300014969 | Bacteria | 4073 |
| 227 | Ga0157376_10102518 | 3300014969 | Bacteria | 2503 |
| 228 | Ga0157376_10279533 | 3300014969 | Bacteria | 1572 |
| 229 | Ga0182006_1013334 | 3300015261 | Bacteria | 3569 |
| 230 | Ga0182007_10001701 | 3300015262 | Bacteria | 11616 |
| 231 | Ga0182005_1042384 | 3300015265 | Unclassified | 1237 |
| 232 | Ga0182005_1044765 | 3300015265 | Bacteria | 1202 |
| 233 | Ga0163161_10022792 | 3300017792 | Bacteria | 4411 |
| 234 | Ga0163161_10026880 | 3300017792 | Bacteria | 4079 |
| 235 | Ga0163161_10037708 | 3300017792 | Bacteria | 3465 |
| 236 | Ga0163161_10041259 | 3300017792 | Bacteria | 3315 |
| 237 | Ga0163161_10132250 | 3300017792 | Bacteria | 1883 |
| 238 | Ga0213872_10010261 | 3300021361 | Bacteria | 4464 |
| 239 | Ga0213876_10033650 | 3300021384 | Bacteria | 2702 |
| 240 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 241 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 242 | Ga0209677_100077 | 3300025253 | Bacteria | 126245 |
| 243 | Ga0209565_1010001 | 3300025263 | Bacteria | 2373 |
| 244 | Ga0209130_1002187 | 3300025284 | Bacteria | 10307 |
| 245 | Ga0209675_1001070 | 3300025291 | Bacteria | 16954 |
| 246 | Ga0209675_1013484 | 3300025291 | Bacteria | 2550 |
| 247 | Ga0209676_1003856 | 3300025292 | Bacteria | 8773 |
| 248 | Ga0209050_1000228 | 3300025298 | Bacteria | 123537 |
| 249 | Ga0209050_1002389 | 3300025298 | Bacteria | 16288 |
| 250 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 251 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 252 | Ga0209051_1001028 | 3300025303 | Bacteria | 26525 |
| 253 | Ga0209051_1002715 | 3300025303 | Bacteria | 12311 |
| 254 | Ga0209257_1000423 | 3300025304 | Bacteria | 81354 |
| 255 | Ga0209257_1020086 | 3300025304 | Bacteria | 2485 |
| 256 | Ga0207656_10031946 | 3300025321 | Bacteria | 2184 |
| 257 | Ga0207656_10040179 | 3300025321 | Bacteria | 1982 |
| 258 | Ga0207682_10015787 | 3300025893 | Bacteria | 2943 |
| 259 | Ga0207682_10119016 | 3300025893 | Unclassified | 1170 |
| 260 | Ga0207642_10010207 | 3300025899 | Bacteria | 3299 |
| 261 | Ga0207688_10149106 | 3300025901 | Bacteria | 1380 |
| 262 | Ga0207645_10003883 | 3300025907 | Bacteria | 11172 |
| 263 | Ga0207645_10008444 | 3300025907 | Bacteria | 7184 |
| 264 | Ga0207645_10091160 | 3300025907 | Bacteria | 1960 |
| 265 | Ga0207705_10013439 | 3300025909 | Bacteria | 5905 |
| 266 | Ga0207705_10024942 | 3300025909 | Bacteria | 4268 |
| 267 | Ga0207705_10056995 | 3300025909 | Bacteria | 2818 |
| 268 | Ga0207705_10060500 | 3300025909 | Bacteria | 2735 |
| 269 | Ga0207654_10114102 | 3300025911 | Bacteria | 1685 |
| 270 | Ga0207660_10437152 | 3300025917 | Unclassified | 1057 |
| 271 | Ga0207662_10003115 | 3300025918 | Bacteria | 8466 |
| 272 | Ga0207657_10001557 | 3300025919 | Bacteria | 24609 |
| 273 | Ga0207657_10142446 | 3300025919 | Bacteria | 1958 |
| 274 | Ga0207649_10009302 | 3300025920 | Bacteria | 5375 |
| 275 | Ga0207649_10182210 | 3300025920 | Bacteria | 1471 |
| 276 | Ga0207652_10023145 | 3300025921 | Bacteria | 5145 |
| 277 | Ga0207652_10479483 | 3300025921 | Bacteria | 1120 |
| 278 | Ga0207681_10004565 | 3300025923 | Bacteria | 8512 |
| 279 | Ga0207694_10020004 | 3300025924 | Bacteria | 5063 |
| 280 | Ga0207694_10158182 | 3300025924 | Bacteria | 1829 |
| 281 | Ga0207650_10004204 | 3300025925 | Bacteria | 9837 |
| 282 | Ga0207650_10009549 | 3300025925 | Bacteria | 6632 |
| 283 | Ga0207650_10059182 | 3300025925 | Bacteria | 2855 |
| 284 | Ga0207650_10076123 | 3300025925 | Bacteria | 2534 |
| 285 | Ga0207650_10193354 | 3300025925 | Bacteria | 1626 |
| 286 | Ga0207650_10282801 | 3300025925 | Bacteria | 1351 |
| 287 | Ga0207659_10002086 | 3300025926 | Bacteria | 11835 |
| 288 | Ga0207659_10009153 | 3300025926 | Bacteria | 6184 |
| 289 | Ga0207659_10013255 | 3300025926 | Bacteria | 5273 |
| 290 | Ga0207659_10078549 | 3300025926 | Bacteria | 2432 |
| 291 | Ga0207659_10086656 | 3300025926 | Bacteria | 2329 |
| 292 | Ga0207687_10107995 | 3300025927 | Bacteria | 2060 |
| 293 | Ga0207687_10195813 | 3300025927 | Bacteria | 1576 |
| 294 | Ga0207644_10005655 | 3300025931 | Bacteria | 8140 |
| 295 | Ga0207644_10016274 | 3300025931 | Bacteria | 5004 |
| 296 | Ga0207644_10018266 | 3300025931 | Bacteria | 4742 |
| 297 | Ga0207644_10107903 | 3300025931 | Bacteria | 2101 |
| 298 | Ga0207644_10114399 | 3300025931 | Bacteria | 2044 |
| 299 | Ga0207690_10000648 | 3300025932 | Bacteria | 22339 |
| 300 | Ga0207690_10126328 | 3300025932 | Bacteria | 1865 |
| 301 | Ga0207690_10463951 | 3300025932 | Unclassified | 1020 |
| 302 | Ga0207706_10001684 | 3300025933 | Bacteria | 21807 |
| 303 | Ga0207706_10035026 | 3300025933 | Bacteria | 4466 |
| 304 | Ga0207706_10198755 | 3300025933 | Bacteria | 1758 |
| 305 | Ga0207706_10502532 | 3300025933 | Bacteria | 1046 |
| 306 | Ga0207709_10003391 | 3300025935 | Bacteria | 9517 |
| 307 | Ga0207709_10120088 | 3300025935 | Bacteria | 1773 |
| 308 | Ga0207670_10072598 | 3300025936 | Bacteria | 2383 |
| 309 | Ga0207669_10289219 | 3300025937 | Bacteria | 1240 |
| 310 | Ga0207669_10604131 | 3300025937 | Bacteria | 892 |
| 311 | Ga0207665_10063452 | 3300025939 | Bacteria | 2509 |
| 312 | Ga0207691_10003434 | 3300025940 | Bacteria | 15411 |
| 313 | Ga0207691_10044257 | 3300025940 | Bacteria | 4098 |
| 314 | Ga0207691_10118928 | 3300025940 | Bacteria | 2343 |
| 315 | Ga0207691_10129100 | 3300025940 | Bacteria | 2234 |
| 316 | Ga0207691_10174533 | 3300025940 | Bacteria | 1881 |
| 317 | Ga0207691_10178880 | 3300025940 | Bacteria | 1854 |
| 318 | Ga0207691_10234894 | 3300025940 | Bacteria | 1587 |
| 319 | Ga0207711_10001491 | 3300025941 | Bacteria | 21784 |
| 320 | Ga0207711_10008678 | 3300025941 | Bacteria | 8504 |
| 321 | Ga0207711_10063613 | 3300025941 | Bacteria | 3185 |
| 322 | Ga0207711_10246400 | 3300025941 | Bacteria | 1639 |
| 323 | Ga0207689_10000393 | 3300025942 | Bacteria | 41140 |
| 324 | Ga0207689_10007718 | 3300025942 | Bacteria | 9415 |
| 325 | Ga0207661_10022350 | 3300025944 | Bacteria | 4762 |
| 326 | Ga0207679_10018103 | 3300025945 | Bacteria | 4712 |
| 327 | Ga0207679_10176587 | 3300025945 | Bacteria | 1763 |
| 328 | Ga0207667_10009858 | 3300025949 | Bacteria | 11215 |
| 329 | Ga0207651_10042415 | 3300025960 | Bacteria | 3028 |
| 330 | Ga0207651_10209422 | 3300025960 | Bacteria | 1568 |
| 331 | Ga0207651_10271799 | 3300025960 | Bacteria | 1396 |
| 332 | Ga0207712_10024409 | 3300025961 | Bacteria | 4003 |
| 333 | Ga0207668_10019692 | 3300025972 | Bacteria | 4271 |
| 334 | Ga0207668_10081448 | 3300025972 | Bacteria | 2348 |
| 335 | Ga0207668_10249185 | 3300025972 | Bacteria | 1441 |
| 336 | Ga0207640_10023728 | 3300025981 | Bacteria | 3691 |
| 337 | Ga0207640_10050144 | 3300025981 | Bacteria | 2707 |
| 338 | Ga0207640_10377699 | 3300025981 | Bacteria | 1147 |
| 339 | Ga0207658_10002016 | 3300025986 | Bacteria | 15151 |
| 340 | Ga0207658_10006229 | 3300025986 | Bacteria | 8153 |
| 341 | Ga0207658_10056512 | 3300025986 | Bacteria | 2913 |
| 342 | Ga0207658_10096833 | 3300025986 | Bacteria | 2302 |
| 343 | Ga0207677_10000891 | 3300026023 | Bacteria | 16769 |
| 344 | Ga0207677_10007442 | 3300026023 | Bacteria | 6059 |
| 345 | Ga0207677_10090023 | 3300026023 | Bacteria | 2229 |
| 346 | Ga0207703_10000937 | 3300026035 | Bacteria | 28276 |
| 347 | Ga0207703_10062751 | 3300026035 | Bacteria | 3044 |
| 348 | Ga0207703_10172963 | 3300026035 | Bacteria | 1901 |
| 349 | Ga0207639_10024620 | 3300026041 | Bacteria | 4358 |
| 350 | Ga0207639_10187006 | 3300026041 | Bacteria | 1766 |
| 351 | Ga0207678_10008511 | 3300026067 | Bacteria | 9043 |
| 352 | Ga0207678_10183622 | 3300026067 | Bacteria | 1786 |
| 353 | Ga0207678_10200668 | 3300026067 | Bacteria | 1705 |
| 354 | Ga0207678_10206019 | 3300026067 | Bacteria | 1682 |
| 355 | Ga0207708_10170201 | 3300026075 | Bacteria | 1725 |
| 356 | Ga0207702_10438148 | 3300026078 | Bacteria | 1266 |
| 357 | Ga0207641_10000743 | 3300026088 | Bacteria | 35044 |
| 358 | Ga0207641_10016984 | 3300026088 | Bacteria | 5958 |
| 359 | Ga0207641_10224603 | 3300026088 | Bacteria | 1743 |
| 360 | Ga0207648_10000080 | 3300026089 | Bacteria | 92020 |
| 361 | Ga0207648_10018023 | 3300026089 | Bacteria | 6399 |
| 362 | Ga0207648_10020752 | 3300026089 | Bacteria | 5914 |
| 363 | Ga0207648_10030545 | 3300026089 | Bacteria | 4770 |
| 364 | Ga0207648_10143258 | 3300026089 | Bacteria | 2107 |
| 365 | Ga0207648_10151679 | 3300026089 | Bacteria | 2045 |
| 366 | Ga0207648_10275937 | 3300026089 | Bacteria | 1503 |
| 367 | Ga0207676_10036783 | 3300026095 | Bacteria | 3726 |
| 368 | Ga0207676_10047448 | 3300026095 | Bacteria | 3329 |
| 369 | Ga0207676_10052455 | 3300026095 | Bacteria | 3188 |
| 370 | Ga0207676_10144607 | 3300026095 | Bacteria | 2040 |
| 371 | Ga0207674_10005853 | 3300026116 | Bacteria | 14580 |
| 372 | Ga0207674_10050452 | 3300026116 | Bacteria | 4251 |
| 373 | Ga0207674_10089773 | 3300026116 | Bacteria | 3065 |
| 374 | Ga0207675_100002300 | 3300026118 | Bacteria | 18970 |
| 375 | Ga0207675_100016484 | 3300026118 | Bacteria | 6900 |
| 376 | Ga0207675_100195189 | 3300026118 | Bacteria | 1943 |
| 377 | Ga0207683_10008753 | 3300026121 | Bacteria | 8640 |
| 378 | Ga0207683_10015961 | 3300026121 | Bacteria | 6391 |
| 379 | Ga0207683_10022854 | 3300026121 | Bacteria | 5372 |
| 380 | Ga0207683_10035034 | 3300026121 | Bacteria | 4366 |
| 381 | Ga0207683_10081225 | 3300026121 | Bacteria | 2877 |
| 382 | Ga0207683_10228599 | 3300026121 | Bacteria | 1696 |
| 383 | Ga0207683_10266742 | 3300026121 | Bacteria | 1564 |
| 384 | Ga0207683_10294611 | 3300026121 | Bacteria | 1484 |
| 385 | Ga0207683_10337592 | 3300026121 | Bacteria | 1382 |
| 386 | Ga0207683_10383613 | 3300026121 | Bacteria | 1292 |
| 387 | Ga0207698_10043585 | 3300026142 | Bacteria | 3362 |
| 388 | Ga0207698_10102538 | 3300026142 | Bacteria | 2376 |
| 389 | Ga0207698_10165882 | 3300026142 | Bacteria | 1938 |
| 390 | Ga0209281_1000084 | 3300027111 | Bacteria | 254215 |
| 391 | Ga0207428_10303533 | 3300027907 | Bacteria | 1181 |
| 392 | Ga0268266_10150721 | 3300028379 | Bacteria | 2096 |
| 393 | Ga0268266_10247797 | 3300028379 | Bacteria | 1647 |
| 394 | Ga0268266_10383749 | 3300028379 | Bacteria | 1326 |
| 395 | Ga0268265_10009768 | 3300028380 | Bacteria | 6479 |
| 396 | Ga0268265_10065273 | 3300028380 | Bacteria | 2808 |
| 397 | Ga0268264_10011641 | 3300028381 | Bacteria | 7255 |
| 398 | Ga0265318_10062458 | 3300028577 | Bacteria | 1387 |
| 399 | Ga0307515_10157840 | 3300028794 | Bacteria | 2331 |
| 400 | Ga0265762_1011119 | 3300030760 | Bacteria | 1609 |
| 401 | Ga0307509_10101548 | 3300031507 | Bacteria | 2911 |
| 402 | Ga0307408_100142710 | 3300031548 | Bacteria | 1881 |
| 403 | Ga0307408_100271021 | 3300031548 | Bacteria | 1409 |
| 404 | Ga0307408_100321667 | 3300031548 | Bacteria | 1303 |
| 405 | Ga0307408_100417161 | 3300031548 | Bacteria | 1156 |
| 406 | Ga0307516_10002271 | 3300031730 | Bacteria | 25921 |
| 407 | Ga0307516_10005045 | 3300031730 | Bacteria | 15975 |
| 408 | Ga0307405_10048652 | 3300031731 | Bacteria | 2616 |
| 409 | Ga0307413_10092688 | 3300031824 | Bacteria | 1972 |
| 410 | Ga0307413_10457911 | 3300031824 | Bacteria | 1014 |
| 411 | Ga0307410_10022074 | 3300031852 | Bacteria | 3928 |
| 412 | Ga0307410_10132300 | 3300031852 | Bacteria | 1834 |
| 413 | Ga0307410_10493963 | 3300031852 | Unclassified | 1006 |
| 414 | Ga0307406_10221703 | 3300031901 | Bacteria | 1406 |
| 415 | Ga0307407_10042576 | 3300031903 | Bacteria | 2547 |
| 416 | Ga0307407_10144373 | 3300031903 | Bacteria | 1539 |
| 417 | Ga0307412_10008712 | 3300031911 | Bacteria | 5804 |
| 418 | Ga0307412_10198834 | 3300031911 | Bacteria | 1521 |
| 419 | Ga0307412_10313855 | 3300031911 | Bacteria | 1244 |
| 420 | Ga0307412_10363537 | 3300031911 | Bacteria | 1166 |
| 421 | Ga0307409_100000214 | 3300031995 | Bacteria | 23086 |
| 422 | Ga0307409_100006228 | 3300031995 | Bacteria | 6986 |
| 423 | Ga0307409_100023884 | 3300031995 | Bacteria | 4248 |
| 424 | Ga0307416_100002783 | 3300032002 | Bacteria | 10161 |
| 425 | Ga0307416_100167508 | 3300032002 | Bacteria | 2040 |
| 426 | Ga0307416_100179795 | 3300032002 | Bacteria | 1981 |
| 427 | Ga0307411_10138876 | 3300032005 | Bacteria | 1789 |
| 428 | Ga0307411_10175840 | 3300032005 | Unclassified | 1620 |
| 429 | Ga0307415_100005175 | 3300032126 | Bacteria | 6887 |
| 430 | Ga0307415_100023718 | 3300032126 | Bacteria | 3816 |
| 431 | Ga0307415_100228178 | 3300032126 | Bacteria | 1498 |
| 432 | Ga0373930_0018759 | 3300034816 | Bacteria | 1334 |
| 433 | Ga0373936_0019797 | 3300035113 | Bacteria | 2610 |
| 434 | Ga0373955_0245852 | 3300035172 | Bacteria | 1072 |
| 435 | Ga0373931_0000504 | 3300035691 | Bacteria | 15954 |
| 436 | Ga0373947_0073261 | 3300035725 | Bacteria | 2105 |
| 437 | Ga0373925_0050181 | 3300037068 | Bacteria | 3112 |
| 438 | Ga0395899_0065141 | 3300037312 | Bacteria | 2678 |
| 439 | Ga0395900_0000063 | 3300037418 | Bacteria | 201374 |
| 440 | Ga0395900_0118378 | 3300037418 | Bacteria | 2718 |
| 441 | Ga0395898_0003745 | 3300037466 | Bacteria | 16861 |
| 442 | Ga0395898_0016469 | 3300037466 | Bacteria | 7564 |
| 443 | Ga0395905_0046110 | 3300037471 | Bacteria | 4087 |
| 444 | Ga0395905_0161604 | 3300037471 | Bacteria | 2105 |
| 445 | Ga0395901_0012228 | 3300038443 | Bacteria | 8711 |
| 446 | Ga0436365_1539415 | 3300039437 | Bacteria | 5304 |
| 447 | Ga0436360_0810517 | 3300039438 | Bacteria | 1518 |
| 448 | Ga0436361_0030879 | 3300039447 | Bacteria | 8317 |
| 449 | Ga0451853_0007635 | 3300041512 | Bacteria | 2097 |
| 450 | Ga0451576_0705240 | 3300045051 | Bacteria | 1060 |
| 451 | Ga0495603_0027429 | 3300046455 | Bacteria | 3437 |
| 452 | Ga0495629_0047329 | 3300046459 | Bacteria | 3016 |
| 453 | Ga0495638_0001219 | 3300046460 | Bacteria | 24403 |
| 454 | Ga0495650_0011626 | 3300046471 | Bacteria | 4804 |
| 455 | Ga0495580_0049902 | 3300046472 | Bacteria | 2960 |
| 456 | Ga0495582_0094666 | 3300046473 | Bacteria | 1668 |
| 457 | Ga0495582_0126627 | 3300046473 | Bacteria | 1441 |
| 458 | Ga0495605_0119492 | 3300046474 | Bacteria | 1195 |
| 459 | Ga0495639_0003284 | 3300046475 | Bacteria | 7018 |
| 460 | Ga0495639_0041991 | 3300046475 | Bacteria | 2061 |
| 461 | Ga0495585_0024325 | 3300046492 | Bacteria | 3473 |
| 462 | Ga0495596_0021368 | 3300046500 | Bacteria | 2642 |
| 463 | Ga0495583_0034454 | 3300046506 | Bacteria | 2425 |
| 464 | Ga0495616_0148856 | 3300046513 | Bacteria | 1060 |
| 465 | Ga0495631_0155078 | 3300046518 | Bacteria | 982 |
| 466 | Ga0495648_0081507 | 3300046524 | Bacteria | 1840 |
| 467 | Ga0495666_0000316 | 3300046526 | Bacteria | 20956 |
| 468 | Ga0495642_0003932 | 3300046528 | Bacteria | 5813 |
| 469 | Ga0495642_0008922 | 3300046528 | Bacteria | 3837 |
| 470 | Ga0495654_0072000 | 3300046530 | Bacteria | 1637 |
| 471 | Ga0495665_0008102 | 3300046531 | Bacteria | 5699 |
| 472 | Ga0495586_0299145 | 3300046535 | Bacteria | 922 |
| 473 | Ga0495587_0030309 | 3300046536 | Bacteria | 3281 |
| 474 | Ga0495598_0040032 | 3300046537 | Bacteria | 1365 |
| 475 | Ga0495609_0084414 | 3300046538 | Bacteria | 1386 |
| 476 | Ga0495621_0074763 | 3300046539 | Bacteria | 1254 |
| 477 | Ga0495621_0147130 | 3300046539 | Bacteria | 925 |
| 478 | Ga0495645_0103938 | 3300046543 | Bacteria | 2018 |
| 479 | Ga0495645_0313842 | 3300046543 | Unclassified | 1020 |
| 480 | Ga0495656_0001626 | 3300046615 | Bacteria | 7345 |
| 481 | Ga0495656_0014623 | 3300046615 | Bacteria | 2946 |
| 482 | Ga0495668_0170171 | 3300046616 | Bacteria | 1194 |
| 483 | Ga0495611_0040361 | 3300046648 | Bacteria | 2080 |
| 484 | Ga0495625_0002045 | 3300046660 | Bacteria | 22685 |
| 485 | Ga0495625_0218534 | 3300046660 | Bacteria | 1250 |
| 486 | Ga0495588_0016977 | 3300046674 | Bacteria | 3526 |
| 487 | Ga0495588_0160802 | 3300046674 | Unclassified | 1188 |
| 488 | Ga0495646_0026803 | 3300046680 | Bacteria | 3617 |
| 489 | Ga0495613_0018108 | 3300046689 | Bacteria | 5249 |
| 490 | Ga0495670_0102045 | 3300046691 | Bacteria | 1478 |
| 491 | Ga0495670_0168894 | 3300046691 | Bacteria | 1151 |
| 492 | Ga0495649_0006149 | 3300046694 | Bacteria | 7500 |
| 493 | Ga0495649_0089720 | 3300046694 | Bacteria | 1639 |
| 494 | Ga0495589_0005569 | 3300046794 | Bacteria | 6644 |
| 495 | Ga0495636_0026735 | 3300047318 | Bacteria | 2348 |
| 496 | Ga0495674_0382252 | 3300047319 | Unclassified | 1139 |
| 497 | Ga0495680_0067421 | 3300047322 | Bacteria | 2736 |
| 498 | Ga0495683_0027109 | 3300047323 | Bacteria | 2930 |
| 499 | Ga0495683_0158288 | 3300047323 | Bacteria | 1049 |
| 500 | Ga0495677_0011886 | 3300047445 | Bacteria | 3178 |
| 501 | Ga0495679_041826 | 3300047446 | Bacteria | 1417 |
| 502 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 503 | Ga0495681_0050388 | 3300047470 | Bacteria | 1963 |
| 504 | Ga0495686_0002242 | 3300047472 | Bacteria | 18646 |
| 505 | Ga0495602_0119889 | 3300048088 | Bacteria | 2119 |
| 506 | Ga0495614_0009086 | 3300048089 | Bacteria | 4403 |
| 507 | Ga0495615_0003704 | 3300048090 | Bacteria | 2590 |
| 508 | Ga0496100_0004624 | 3300048903 | Bacteria | 7319 |
| 509 | Ga0496100_0225859 | 3300048903 | Bacteria | 1376 |
| 510 | Ga0496101_0001681 | 3300048904 | Bacteria | 13256 |
| 511 | Ga0496101_0103073 | 3300048904 | Bacteria | 2138 |
| 512 | Ga0496102_0008149 | 3300048905 | Bacteria | 8965 |
| 513 | Ga0496102_0181004 | 3300048905 | Bacteria | 1986 |
| 514 | Ga0496103_0022283 | 3300048906 | Bacteria | 3814 |
| 515 | Ga0496104_0000665 | 3300048907 | Bacteria | 29449 |
| 516 | Ga0496104_0156581 | 3300048907 | Bacteria | 2186 |
| 517 | Ga0496104_0240862 | 3300048907 | Bacteria | 1721 |
| 518 | Ga0496104_0260247 | 3300048907 | Bacteria | 1648 |
| 519 | Ga0496105_0006587 | 3300048908 | Bacteria | 8940 |
| 520 | Ga0496105_0057733 | 3300048908 | Bacteria | 3204 |
| 521 | Ga0496105_0320558 | 3300048908 | Bacteria | 1242 |
| 522 | Ga0496106_0035455 | 3300048909 | Bacteria | 3730 |
| 523 | Ga0496107_0026941 | 3300048910 | Bacteria | 4079 |
| 524 | Ga0496107_0028755 | 3300048910 | Bacteria | 3951 |
| 525 | Ga0496108_0040004 | 3300048911 | Bacteria | 3907 |
| 526 | Ga0496108_0109540 | 3300048911 | Bacteria | 2360 |
| 527 | Ga0496108_0133787 | 3300048911 | Bacteria | 2132 |
| 528 | Ga0496108_0368018 | 3300048911 | Bacteria | 1255 |
| 529 | Ga0496108_0412517 | 3300048911 | Bacteria | 1180 |
| 530 | Ga0496109_0026135 | 3300048912 | Bacteria | 5205 |
| 531 | Ga0496109_0144158 | 3300048912 | Bacteria | 2228 |
| 532 | Ga0496109_0469655 | 3300048912 | Bacteria | 1188 |
| 533 | Ga0496110_0010508 | 3300048913 | Bacteria | 7535 |
| 534 | Ga0496110_0057761 | 3300048913 | Bacteria | 3416 |
| 535 | Ga0496110_0168793 | 3300048913 | Bacteria | 1985 |
| 536 | Ga0496110_0230145 | 3300048913 | Bacteria | 1686 |
| 537 | Ga0496111_0014187 | 3300048914 | Bacteria | 5437 |
| 538 | Ga0496111_0043930 | 3300048914 | Bacteria | 3213 |
| 539 | Ga0496112_0012015 | 3300048915 | Bacteria | 7941 |
| 540 | Ga0496113_0013212 | 3300048916 | Bacteria | 5583 |
| 541 | Ga0496114_0110942 | 3300048917 | Bacteria | 2350 |
| 542 | Ga0496114_0114273 | 3300048917 | Bacteria | 2315 |
| 543 | Ga0496114_0187043 | 3300048917 | Bacteria | 1810 |
| 544 | Ga0496114_0331525 | 3300048917 | Bacteria | 1345 |
| 545 | Ga0496114_0502999 | 3300048917 | Bacteria | 1072 |
| 546 | Ga0496115_0039829 | 3300048918 | Bacteria | 3734 |
| 547 | Ga0501292_003776 | 3300049515 | Bacteria | 2042 |
| 548 | Ga0501036_0294799 | 3300049572 | Bacteria | 1357 |
| 549 | Ga0501046_0009486 | 3300049580 | Bacteria | 8411 |
| 550 | Ga0501047_0006196 | 3300049581 | Bacteria | 11247 |
| 551 | Ga0501047_0039852 | 3300049581 | Bacteria | 4544 |
| 552 | Ga0501198_000005 | 3300049649 | Bacteria | 156657 |
| 553 | Ga0501222_000003 | 3300049662 | Bacteria | 157406 |
| 554 | Ga0501223_030253 | 3300049663 | Bacteria | 1053 |
| 555 | Ga0501257_033986 | 3300049686 | Bacteria | 1237 |
| 556 | Ga0501262_000027 | 3300049759 | Bacteria | 20078 |
| 557 | Ga0501265_001002 | 3300049762 | Bacteria | 3170 |
| 558 | Ga0501035_0006200 | 3300049822 | Bacteria | 11249 |
| 559 | Ga0501044_0013597 | 3300049823 | Bacteria | 8796 |
| 560 | nmdc:mga0k408_310657_c1 | 3300050493 | Bacteria | 941 |
| 561 | nmdc:mga08y16_28565_c1 | 3300050511 | Bacteria | 5879 |
| 562 | Ga0495612_0024986 | 3300053078 | Bacteria | 2399 |
| 563 | Ga0500635_0015261 | 3300053080 | Bacteria | 2266 |
| 564 | Ga0500644_0066890 | 3300053088 | Unclassified | 1283 |
| 565 | Ga0500594_0001259 | 3300053118 | Bacteria | 5494 |
| 566 | Ga0500564_071638 | 3300053138 | Bacteria | 1562 |
| 567 | Ga0500622_0004244 | 3300053156 | Bacteria | 9116 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025937 | Ga0207669_10604131 | Ga0207669_106041312 | 200 |
| 2 | 3300013308 | Ga0157375_10298308 | Ga0157375_102983082 | 239 |
| 3 | 3300048917 | Ga0496114_0331525 | Ga0496114_0331525_75_887 | 239 |
| 4 | 3300046535 | Ga0495586_0299145 | Ga0495586_0299145_133_894 | 244 |
| 5 | 3300047472 | Ga0495686_0002242 | Ga0495686_0002242_12236_13048 | 244 |
| 6 | 3300013308 | Ga0157375_10025327 | Ga0157375_100253275 | 246 |
| 7 | 3300048907 | Ga0496104_0240862 | Ga0496104_0240862_198_956 | 246 |
| 8 | 3300047319 | Ga0495674_0382252 | Ga0495674_0382252_331_1128 | 247 |
| 9 | 3300048911 | Ga0496108_0412517 | Ga0496108_0412517_170_937 | 247 |
| 10 | 3300005338 | Ga0068868_100231661 | Ga0068868_1002316612 | 248 |
| 11 | 3300005364 | Ga0070673_100185629 | Ga0070673_1001856291 | 248 |
| 12 | 3300009551 | Ga0105238_10586539 | Ga0105238_105865392 | 248 |
| 13 | 3300025960 | Ga0207651_10271799 | Ga0207651_102717992 | 248 |
| 14 | 3300030760 | Ga0265762_1011119 | Ga0265762_10111192 | 248 |
| 15 | 3300014326 | Ga0157380_10137578 | Ga0157380_101375782 | 249 |
| 16 | 3300035113 | Ga0373936_0019797 | Ga0373936_0019797_1112_1885 | 249 |
| 17 | 3300046472 | Ga0495580_0049902 | Ga0495580_0049902_453_1253 | 250 |
| 18 | 3300005543 | Ga0070672_100051713 | Ga0070672_1000517133 | 251 |
| 19 | 3300005618 | Ga0068864_100364243 | Ga0068864_1003642432 | 251 |
| 20 | 3300005841 | Ga0068863_100048599 | Ga0068863_1000485993 | 251 |
| 21 | 3300006237 | Ga0097621_100123070 | Ga0097621_1001230702 | 251 |
| 22 | 3300006358 | Ga0068871_100108940 | Ga0068871_1001089402 | 251 |
| 23 | 3300013306 | Ga0163162_10128886 | Ga0163162_101288862 | 251 |
| 24 | 3300053156 | Ga0500622_0004244 | Ga0500622_0004244_5176_5961 | 251 |
| 25 | 3300005327 | Ga0070658_10016866 | Ga0070658_100168662 | 252 |
| 26 | 3300005616 | Ga0068852_100501071 | Ga0068852_1005010712 | 252 |
| 27 | 3300025909 | Ga0207705_10056995 | Ga0207705_100569953 | 252 |
| 28 | 3300025921 | Ga0207652_10479483 | Ga0207652_104794832 | 252 |
| 29 | 3300025932 | Ga0207690_10463951 | Ga0207690_104639511 | 252 |
| 30 | 3300037312 | Ga0395899_0065141 | Ga0395899_0065141_567_1337 | 252 |
| 31 | 3300037418 | Ga0395900_0118378 | Ga0395900_0118378_961_1731 | 252 |
| 32 | 3300037466 | Ga0395898_0016469 | Ga0395898_0016469_895_1665 | 252 |
| 33 | 3300037471 | Ga0395905_0046110 | Ga0395905_0046110_1943_2713 | 252 |
| 34 | 3300038443 | Ga0395901_0012228 | Ga0395901_0012228_5465_6235 | 252 |
| 35 | 3300035725 | Ga0373947_0073261 | Ga0373947_0073261_1187_2002 | 253 |
| 36 | 3300037068 | Ga0373925_0050181 | Ga0373925_0050181_865_1680 | 253 |
| 37 | 3300053078 | Ga0495612_0024986 | Ga0495612_0024986_913_1728 | 253 |
| 38 | 3300031548 | Ga0307408_100271021 | Ga0307408_1002710212 | 254 |
| 39 | 3300032002 | Ga0307416_100179795 | Ga0307416_1001797952 | 254 |
| 40 | 3300049515 | Ga0501292_003776 | Ga0501292_003776_778_1587 | 254 |
| 41 | 3300049663 | Ga0501223_030253 | Ga0501223_030253_202_1011 | 254 |
| 42 | 3300049686 | Ga0501257_033986 | Ga0501257_033986_246_1055 | 254 |
| 43 | 3300049762 | Ga0501265_001002 | Ga0501265_001002_2061_2870 | 254 |
| 44 | 3300005355 | Ga0070671_100044641 | Ga0070671_1000446412 | 255 |
| 45 | 3300005841 | Ga0068863_100100956 | Ga0068863_1001009562 | 255 |
| 46 | 3300009177 | Ga0105248_10019477 | Ga0105248_100194772 | 255 |
| 47 | 3300026088 | Ga0207641_10224603 | Ga0207641_102246032 | 255 |
| 48 | 3300031730 | Ga0307516_10005045 | Ga0307516_100050457 | 255 |
| 49 | 3300046471 | Ga0495650_0011626 | Ga0495650_0011626_23_808 | 255 |
| 50 | 3300046492 | Ga0495585_0024325 | Ga0495585_0024325_1313_2098 | 255 |
| 51 | 3300046539 | Ga0495621_0147130 | Ga0495621_0147130_56_871 | 255 |
| 52 | 3300046615 | Ga0495656_0014623 | Ga0495656_0014623_1137_1949 | 255 |
| 53 | 3300047323 | Ga0495683_0158288 | Ga0495683_0158288_200_985 | 255 |
| 54 | 3300048090 | Ga0495615_0003704 | Ga0495615_0003704_119_931 | 255 |
| 55 | 3300048907 | Ga0496104_0260247 | Ga0496104_0260247_500_1294 | 255 |
| 56 | 3300048911 | Ga0496108_0133787 | Ga0496108_0133787_817_1611 | 255 |
| 57 | 3300048915 | Ga0496112_0012015 | Ga0496112_0012015_5760_6554 | 255 |
| 58 | 3300005336 | Ga0070680_100206511 | Ga0070680_1002065111 | 256 |
| 59 | 3300005530 | Ga0070679_100032855 | Ga0070679_1000328554 | 256 |
| 60 | 3300025909 | Ga0207705_10013439 | Ga0207705_100134392 | 256 |
| 61 | 3300025917 | Ga0207660_10437152 | Ga0207660_104371521 | 256 |
| 62 | 3300025921 | Ga0207652_10023145 | Ga0207652_100231454 | 256 |
| 63 | 3300048907 | Ga0496104_0156581 | Ga0496104_0156581_910_1701 | 256 |
| 64 | 3300047318 | Ga0495636_0026735 | Ga0495636_0026735_1504_2298 | 257 |
| 65 | 3300046473 | Ga0495582_0094666 | Ga0495582_0094666_431_1225 | 258 |
| 66 | 3300046539 | Ga0495621_0074763 | Ga0495621_0074763_156_956 | 258 |
| 67 | 3300048908 | Ga0496105_0057733 | Ga0496105_0057733_1624_2424 | 258 |
| 68 | 3300048917 | Ga0496114_0187043 | Ga0496114_0187043_375_1175 | 258 |
| 69 | 3300005364 | Ga0070673_100157821 | Ga0070673_1001578212 | 259 |
| 70 | 3300025925 | Ga0207650_10193354 | Ga0207650_101933542 | 259 |
| 71 | 3300025937 | Ga0207669_10289219 | Ga0207669_102892191 | 259 |
| 72 | 3300026121 | Ga0207683_10383613 | Ga0207683_103836131 | 259 |
| 73 | 3300031730 | Ga0307516_10002271 | Ga0307516_100022716 | 259 |
| 74 | 3300046475 | Ga0495639_0041991 | Ga0495639_0041991_702_1499 | 259 |
| 75 | 3300049572 | Ga0501036_0294799 | Ga0501036_0294799_519_1322 | 259 |
| 76 | 3300049580 | Ga0501046_0009486 | Ga0501046_0009486_6732_7535 | 259 |
| 77 | 3300049581 | Ga0501047_0006196 | Ga0501047_0006196_2774_3577 | 259 |
| 78 | 3300049822 | Ga0501035_0006200 | Ga0501035_0006200_7674_8477 | 259 |
| 79 | 3300049823 | Ga0501044_0013597 | Ga0501044_0013597_4716_5519 | 259 |
| 80 | 3300003791 | Ga0055530_10000646 | Ga0055530_100006465 | 260 |
| 81 | 3300003791 | Ga0055530_10001932 | Ga0055530_1000193214 | 260 |
| 82 | 3300003792 | Ga0055540_1000026 | Ga0055540_100002625 | 260 |
| 83 | 3300003794 | Ga0055531_10001026 | Ga0055531_1000102613 | 260 |
| 84 | 3300005262 | Ga0065165_1000292 | Ga0065165_100029250 | 260 |
| 85 | 3300006946 | Ga0079104_1000093 | Ga0079104_100009375 | 260 |
| 86 | 3300009094 | Ga0111539_10045749 | Ga0111539_100457492 | 260 |
| 87 | 3300025298 | Ga0209050_1000228 | Ga0209050_100022854 | 260 |
| 88 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004504 | 260 |
| 89 | 3300025304 | Ga0209257_1000423 | Ga0209257_100042361 | 260 |
| 90 | 3300027111 | Ga0209281_1000084 | Ga0209281_1000084183 | 260 |
| 91 | 3300031901 | Ga0307406_10221703 | Ga0307406_102217032 | 260 |
| 92 | 3300031995 | Ga0307409_100000214 | Ga0307409_10000021421 | 260 |
| 93 | 3300032002 | Ga0307416_100002783 | Ga0307416_1000027837 | 260 |
| 94 | 3300032126 | Ga0307415_100005175 | Ga0307415_1000051751 | 260 |
| 95 | 3300041512 | Ga0451853_0007635 | Ga0451853_0007635_1162_1962 | 260 |
| 96 | 3300050511 | nmdc:mga08y16_28565_c1 | nmdc:mga08y16_28565_c1_2081_2893 | 260 |
| 97 | 3300005329 | Ga0070683_100490964 | Ga0070683_1004909642 | 261 |
| 98 | 3300005339 | Ga0070660_100001577 | Ga0070660_1000015777 | 261 |
| 99 | 3300005366 | Ga0070659_100000861 | Ga0070659_10000086111 | 261 |
| 100 | 3300005459 | Ga0068867_100494657 | Ga0068867_1004946571 | 261 |
| 101 | 3300005563 | Ga0068855_100000843 | Ga0068855_10000084310 | 261 |
| 102 | 3300005618 | Ga0068864_100546074 | Ga0068864_1005460742 | 261 |
| 103 | 3300025919 | Ga0207657_10001557 | Ga0207657_1000155719 | 261 |
| 104 | 3300025949 | Ga0207667_10009858 | Ga0207667_100098582 | 261 |
| 105 | 3300026067 | Ga0207678_10200668 | Ga0207678_102006682 | 261 |
| 106 | 3300046524 | Ga0495648_0081507 | Ga0495648_0081507_585_1385 | 261 |
| 107 | 3300046694 | Ga0495649_0006149 | Ga0495649_0006149_1663_2463 | 261 |
| 108 | 3300047469 | Ga0495673_0000024 | Ga0495673_0000024_403701_404492 | 261 |
| 109 | 3300049649 | Ga0501198_000005 | Ga0501198_000005_92994_93809 | 261 |
| 110 | 3300049662 | Ga0501222_000003 | Ga0501222_000003_93743_94558 | 261 |
| 111 | 3300053118 | Ga0500594_0001259 | Ga0500594_0001259_4647_5447 | 261 |
| 112 | 3300003775 | Ga0055524_1000061 | Ga0055524_100006160 | 262 |
| 113 | 3300005327 | Ga0070658_10277439 | Ga0070658_102774391 | 262 |
| 114 | 3300025263 | Ga0209565_1010001 | Ga0209565_10100012 | 262 |
| 115 | 3300025291 | Ga0209675_1013484 | Ga0209675_10134843 | 262 |
| 116 | 3300025298 | Ga0209050_1002389 | Ga0209050_10023893 | 262 |
| 117 | 3300025299 | Ga0209256_1000030 | Ga0209256_100003060 | 262 |
| 118 | 3300025925 | Ga0207650_10282801 | Ga0207650_102828012 | 262 |
| 119 | 3300028577 | Ga0265318_10062458 | Ga0265318_100624582 | 262 |
| 120 | 3300032005 | Ga0307411_10175840 | Ga0307411_101758402 | 262 |
| 121 | 3300032126 | Ga0307415_100228178 | Ga0307415_1002281782 | 262 |
| 122 | 3300005288 | Ga0065714_10017685 | Ga0065714_100176852 | 263 |
| 123 | 3300005288 | Ga0065714_10074155 | Ga0065714_100741553 | 263 |
| 124 | 3300005327 | Ga0070658_10020329 | Ga0070658_100203295 | 263 |
| 125 | 3300005331 | Ga0070670_100005171 | Ga0070670_1000051716 | 263 |
| 126 | 3300005331 | Ga0070670_100007752 | Ga0070670_1000077522 | 263 |
| 127 | 3300005333 | Ga0070677_10072526 | Ga0070677_100725262 | 263 |
| 128 | 3300005338 | Ga0068868_100144564 | Ga0068868_1001445643 | 263 |
| 129 | 3300005338 | Ga0068868_100334005 | Ga0068868_1003340052 | 263 |
| 130 | 3300005340 | Ga0070689_100241579 | Ga0070689_1002415792 | 263 |
| 131 | 3300005354 | Ga0070675_100020449 | Ga0070675_1000204496 | 263 |
| 132 | 3300005355 | Ga0070671_100038116 | Ga0070671_1000381162 | 263 |
| 133 | 3300005355 | Ga0070671_100046201 | Ga0070671_1000462012 | 263 |
| 134 | 3300005364 | Ga0070673_100162860 | Ga0070673_1001628602 | 263 |
| 135 | 3300005366 | Ga0070659_100204281 | Ga0070659_1002042811 | 263 |
| 136 | 3300005367 | Ga0070667_100033553 | Ga0070667_1000335531 | 263 |
| 137 | 3300005367 | Ga0070667_100052245 | Ga0070667_1000522453 | 263 |
| 138 | 3300005367 | Ga0070667_100114463 | Ga0070667_1001144632 | 263 |
| 139 | 3300005456 | Ga0070678_100074966 | Ga0070678_1000749662 | 263 |
| 140 | 3300005456 | Ga0070678_100147020 | Ga0070678_1001470202 | 263 |
| 141 | 3300005457 | Ga0070662_100139361 | Ga0070662_1001393612 | 263 |
| 142 | 3300005543 | Ga0070672_100003033 | Ga0070672_1000030333 | 263 |
| 143 | 3300005543 | Ga0070672_100034960 | Ga0070672_1000349602 | 263 |
| 144 | 3300005547 | Ga0070693_100251913 | Ga0070693_1002519132 | 263 |
| 145 | 3300005548 | Ga0070665_100184007 | Ga0070665_1001840072 | 263 |
| 146 | 3300005577 | Ga0068857_100000194 | Ga0068857_10000019425 | 263 |
| 147 | 3300005616 | Ga0068852_100007924 | Ga0068852_1000079247 | 263 |
| 148 | 3300005616 | Ga0068852_100177329 | Ga0068852_1001773292 | 263 |
| 149 | 3300005618 | Ga0068864_100060046 | Ga0068864_1000600463 | 263 |
| 150 | 3300005719 | Ga0068861_100151194 | Ga0068861_1001511942 | 263 |
| 151 | 3300005841 | Ga0068863_100129312 | Ga0068863_1001293122 | 263 |
| 152 | 3300006237 | Ga0097621_100014293 | Ga0097621_1000142936 | 263 |
| 153 | 3300006358 | Ga0068871_100002846 | Ga0068871_10000284611 | 263 |
| 154 | 3300009094 | Ga0111539_10474288 | Ga0111539_104742882 | 263 |
| 155 | 3300009098 | Ga0105245_10096513 | Ga0105245_100965133 | 263 |
| 156 | 3300009176 | Ga0105242_10414217 | Ga0105242_104142172 | 263 |
| 157 | 3300009177 | Ga0105248_10007526 | Ga0105248_100075267 | 263 |
| 158 | 3300013296 | Ga0157374_10031619 | Ga0157374_100316192 | 263 |
| 159 | 3300013297 | Ga0157378_10365010 | Ga0157378_103650102 | 263 |
| 160 | 3300013306 | Ga0163162_10021530 | Ga0163162_100215307 | 263 |
| 161 | 3300013308 | Ga0157375_10114841 | Ga0157375_101148412 | 263 |
| 162 | 3300013308 | Ga0157375_10187575 | Ga0157375_101875752 | 263 |
| 163 | 3300013308 | Ga0157375_10375486 | Ga0157375_103754862 | 263 |
| 164 | 3300014497 | Ga0182008_10000701 | Ga0182008_100007016 | 263 |
| 165 | 3300014968 | Ga0157379_10100542 | Ga0157379_101005421 | 263 |
| 166 | 3300014968 | Ga0157379_10244813 | Ga0157379_102448132 | 263 |
| 167 | 3300014969 | Ga0157376_10102518 | Ga0157376_101025182 | 263 |
| 168 | 3300015261 | Ga0182006_1013334 | Ga0182006_10133343 | 263 |
| 169 | 3300015262 | Ga0182007_10001701 | Ga0182007_100017018 | 263 |
| 170 | 3300015265 | Ga0182005_1044765 | Ga0182005_10447652 | 263 |
| 171 | 3300017792 | Ga0163161_10041259 | Ga0163161_100412592 | 263 |
| 172 | 3300021361 | Ga0213872_10010261 | Ga0213872_100102614 | 263 |
| 173 | 3300021384 | Ga0213876_10033650 | Ga0213876_100336502 | 263 |
| 174 | 3300025303 | Ga0209051_1001028 | Ga0209051_100102818 | 263 |
| 175 | 3300025303 | Ga0209051_1002715 | Ga0209051_10027158 | 263 |
| 176 | 3300025893 | Ga0207682_10119016 | Ga0207682_101190161 | 263 |
| 177 | 3300025909 | Ga0207705_10060500 | Ga0207705_100605002 | 263 |
| 178 | 3300025925 | Ga0207650_10004204 | Ga0207650_100042048 | 263 |
| 179 | 3300025926 | Ga0207659_10013255 | Ga0207659_100132556 | 263 |
| 180 | 3300025927 | Ga0207687_10195813 | Ga0207687_101958132 | 263 |
| 181 | 3300025931 | Ga0207644_10018266 | Ga0207644_100182665 | 263 |
| 182 | 3300025931 | Ga0207644_10107903 | Ga0207644_101079031 | 263 |
| 183 | 3300025932 | Ga0207690_10126328 | Ga0207690_101263282 | 263 |
| 184 | 3300025933 | Ga0207706_10502532 | Ga0207706_105025322 | 263 |
| 185 | 3300025935 | Ga0207709_10120088 | Ga0207709_101200882 | 263 |
| 186 | 3300025940 | Ga0207691_10003434 | Ga0207691_100034349 | 263 |
| 187 | 3300025940 | Ga0207691_10118928 | Ga0207691_101189282 | 263 |
| 188 | 3300025940 | Ga0207691_10174533 | Ga0207691_101745332 | 263 |
| 189 | 3300025940 | Ga0207691_10234894 | Ga0207691_102348942 | 263 |
| 190 | 3300025941 | Ga0207711_10001491 | Ga0207711_1000149111 | 263 |
| 191 | 3300025960 | Ga0207651_10042415 | Ga0207651_100424152 | 263 |
| 192 | 3300025986 | Ga0207658_10056512 | Ga0207658_100565122 | 263 |
| 193 | 3300025986 | Ga0207658_10096833 | Ga0207658_100968332 | 263 |
| 194 | 3300026023 | Ga0207677_10090023 | Ga0207677_100900231 | 263 |
| 195 | 3300026095 | Ga0207676_10052455 | Ga0207676_100524553 | 263 |
| 196 | 3300026116 | Ga0207674_10005853 | Ga0207674_1000585318 | 263 |
| 197 | 3300026118 | Ga0207675_100195189 | Ga0207675_1001951892 | 263 |
| 198 | 3300026121 | Ga0207683_10008753 | Ga0207683_100087534 | 263 |
| 199 | 3300026121 | Ga0207683_10266742 | Ga0207683_102667421 | 263 |
| 200 | 3300028379 | Ga0268266_10150721 | Ga0268266_101507212 | 263 |
| 201 | 3300028379 | Ga0268266_10383749 | Ga0268266_103837492 | 263 |
| 202 | 3300031507 | Ga0307509_10101548 | Ga0307509_101015482 | 263 |
| 203 | 3300031548 | Ga0307408_100142710 | Ga0307408_1001427103 | 263 |
| 204 | 3300031548 | Ga0307408_100321667 | Ga0307408_1003216672 | 263 |
| 205 | 3300031548 | Ga0307408_100417161 | Ga0307408_1004171612 | 263 |
| 206 | 3300031731 | Ga0307405_10048652 | Ga0307405_100486522 | 263 |
| 207 | 3300031824 | Ga0307413_10092688 | Ga0307413_100926882 | 263 |
| 208 | 3300031852 | Ga0307410_10022074 | Ga0307410_100220743 | 263 |
| 209 | 3300031852 | Ga0307410_10132300 | Ga0307410_101323001 | 263 |
| 210 | 3300031852 | Ga0307410_10493963 | Ga0307410_104939631 | 263 |
| 211 | 3300031903 | Ga0307407_10042576 | Ga0307407_100425762 | 263 |
| 212 | 3300031903 | Ga0307407_10144373 | Ga0307407_101443733 | 263 |
| 213 | 3300031911 | Ga0307412_10008712 | Ga0307412_100087125 | 263 |
| 214 | 3300031911 | Ga0307412_10313855 | Ga0307412_103138552 | 263 |
| 215 | 3300031911 | Ga0307412_10363537 | Ga0307412_103635372 | 263 |
| 216 | 3300031995 | Ga0307409_100006228 | Ga0307409_1000062286 | 263 |
| 217 | 3300031995 | Ga0307409_100023884 | Ga0307409_1000238842 | 263 |
| 218 | 3300032002 | Ga0307416_100167508 | Ga0307416_1001675082 | 263 |
| 219 | 3300032005 | Ga0307411_10138876 | Ga0307411_101388762 | 263 |
| 220 | 3300032126 | Ga0307415_100023718 | Ga0307415_1000237182 | 263 |
| 221 | 3300037418 | Ga0395900_0000063 | Ga0395900_0000063_31411_32226 | 263 |
| 222 | 3300037466 | Ga0395898_0003745 | Ga0395898_0003745_15963_16778 | 263 |
| 223 | 3300037471 | Ga0395905_0161604 | Ga0395905_0161604_100_909 | 263 |
| 224 | 3300039437 | Ga0436365_1539415 | Ga0436365_1539415_2260_3072 | 263 |
| 225 | 3300039447 | Ga0436361_0030879 | Ga0436361_0030879_7060_7872 | 263 |
| 226 | 3300045051 | Ga0451576_0705240 | Ga0451576_0705240_70_897 | 263 |
| 227 | 3300046460 | Ga0495638_0001219 | Ga0495638_0001219_14134_14937 | 263 |
| 228 | 3300046475 | Ga0495639_0003284 | Ga0495639_0003284_5655_6461 | 263 |
| 229 | 3300046526 | Ga0495666_0000316 | Ga0495666_0000316_11738_12559 | 263 |
| 230 | 3300046531 | Ga0495665_0008102 | Ga0495665_0008102_3664_4485 | 263 |
| 231 | 3300046537 | Ga0495598_0040032 | Ga0495598_0040032_114_923 | 263 |
| 232 | 3300046660 | Ga0495625_0002045 | Ga0495625_0002045_21443_22246 | 263 |
| 233 | 3300046660 | Ga0495625_0218534 | Ga0495625_0218534_201_1019 | 263 |
| 234 | 3300046674 | Ga0495588_0160802 | Ga0495588_0160802_154_975 | 263 |
| 235 | 3300046691 | Ga0495670_0168894 | Ga0495670_0168894_333_1139 | 263 |
| 236 | 3300048088 | Ga0495602_0119889 | Ga0495602_0119889_525_1346 | 263 |
| 237 | 3300048903 | Ga0496100_0004624 | Ga0496100_0004624_862_1668 | 263 |
| 238 | 3300048903 | Ga0496100_0225859 | Ga0496100_0225859_402_1211 | 263 |
| 239 | 3300048904 | Ga0496101_0001681 | Ga0496101_0001681_8303_9109 | 263 |
| 240 | 3300048905 | Ga0496102_0008149 | Ga0496102_0008149_1412_2218 | 263 |
| 241 | 3300048906 | Ga0496103_0022283 | Ga0496103_0022283_2077_2883 | 263 |
| 242 | 3300048907 | Ga0496104_0000665 | Ga0496104_0000665_14731_15537 | 263 |
| 243 | 3300048908 | Ga0496105_0006587 | Ga0496105_0006587_3581_4387 | 263 |
| 244 | 3300048910 | Ga0496107_0028755 | Ga0496107_0028755_627_1433 | 263 |
| 245 | 3300048911 | Ga0496108_0109540 | Ga0496108_0109540_497_1303 | 263 |
| 246 | 3300048912 | Ga0496109_0144158 | Ga0496109_0144158_328_1137 | 263 |
| 247 | 3300048913 | Ga0496110_0010508 | Ga0496110_0010508_6020_6826 | 263 |
| 248 | 3300048914 | Ga0496111_0014187 | Ga0496111_0014187_3714_4520 | 263 |
| 249 | 3300048917 | Ga0496114_0110942 | Ga0496114_0110942_92_898 | 263 |
| 250 | 3300049581 | Ga0501047_0039852 | Ga0501047_0039852_1882_2697 | 263 |
| 251 | 3300049759 | Ga0501262_000027 | Ga0501262_000027_5290_6099 | 263 |
| 252 | 3300053080 | Ga0500635_0015261 | Ga0500635_0015261_733_1542 | 263 |
| 253 | 3300053138 | Ga0500564_071638 | Ga0500564_071638_379_1188 | 263 |
| 254 | 3300003784 | Ga0055534_1003031 | Ga0055534_10030317 | 264 |
| 255 | 3300003784 | Ga0055534_1006182 | Ga0055534_10061822 | 264 |
| 256 | 3300003792 | Ga0055540_1018701 | Ga0055540_10187012 | 264 |
| 257 | 3300005262 | Ga0065165_1011948 | Ga0065165_10119482 | 264 |
| 258 | 3300005327 | Ga0070658_10033011 | Ga0070658_100330114 | 264 |
| 259 | 3300005328 | Ga0070676_10011161 | Ga0070676_100111613 | 264 |
| 260 | 3300005329 | Ga0070683_100008291 | Ga0070683_1000082917 | 264 |
| 261 | 3300005331 | Ga0070670_100044343 | Ga0070670_1000443433 | 264 |
| 262 | 3300005331 | Ga0070670_100200583 | Ga0070670_1002005832 | 264 |
| 263 | 3300005333 | Ga0070677_10065364 | Ga0070677_100653642 | 264 |
| 264 | 3300005334 | Ga0068869_100013863 | Ga0068869_1000138636 | 264 |
| 265 | 3300005335 | Ga0070666_10423091 | Ga0070666_104230911 | 264 |
| 266 | 3300005338 | Ga0068868_100007188 | Ga0068868_1000071885 | 264 |
| 267 | 3300005338 | Ga0068868_100107992 | Ga0068868_1001079921 | 264 |
| 268 | 3300005340 | Ga0070689_100183321 | Ga0070689_1001833212 | 264 |
| 269 | 3300005343 | Ga0070687_100022947 | Ga0070687_1000229472 | 264 |
| 270 | 3300005344 | Ga0070661_100008362 | Ga0070661_1000083621 | 264 |
| 271 | 3300005345 | Ga0070692_10115924 | Ga0070692_101159243 | 264 |
| 272 | 3300005347 | Ga0070668_100062305 | Ga0070668_1000623053 | 264 |
| 273 | 3300005347 | Ga0070668_100268674 | Ga0070668_1002686742 | 264 |
| 274 | 3300005347 | Ga0070668_100275365 | Ga0070668_1002753652 | 264 |
| 275 | 3300005347 | Ga0070668_100364585 | Ga0070668_1003645852 | 264 |
| 276 | 3300005347 | Ga0070668_100531428 | Ga0070668_1005314281 | 264 |
| 277 | 3300005353 | Ga0070669_100034960 | Ga0070669_1000349603 | 264 |
| 278 | 3300005353 | Ga0070669_100167855 | Ga0070669_1001678552 | 264 |
| 279 | 3300005354 | Ga0070675_100000870 | Ga0070675_10000087019 | 264 |
| 280 | 3300005354 | Ga0070675_100013048 | Ga0070675_1000130485 | 264 |
| 281 | 3300005355 | Ga0070671_100209489 | Ga0070671_1002094892 | 264 |
| 282 | 3300005356 | Ga0070674_100037365 | Ga0070674_1000373655 | 264 |
| 283 | 3300005356 | Ga0070674_100136840 | Ga0070674_1001368402 | 264 |
| 284 | 3300005364 | Ga0070673_100001117 | Ga0070673_1000011179 | 264 |
| 285 | 3300005364 | Ga0070673_100572877 | Ga0070673_1005728771 | 264 |
| 286 | 3300005365 | Ga0070688_100027498 | Ga0070688_1000274985 | 264 |
| 287 | 3300005366 | Ga0070659_100010695 | Ga0070659_1000106953 | 264 |
| 288 | 3300005366 | Ga0070659_100017104 | Ga0070659_1000171044 | 264 |
| 289 | 3300005367 | Ga0070667_100001328 | Ga0070667_10000132815 | 264 |
| 290 | 3300005367 | Ga0070667_100027605 | Ga0070667_1000276053 | 264 |
| 291 | 3300005367 | Ga0070667_100281394 | Ga0070667_1002813942 | 264 |
| 292 | 3300005441 | Ga0070700_100026468 | Ga0070700_1000264683 | 264 |
| 293 | 3300005441 | Ga0070700_100233697 | Ga0070700_1002336972 | 264 |
| 294 | 3300005455 | Ga0070663_100003495 | Ga0070663_1000034955 | 264 |
| 295 | 3300005455 | Ga0070663_100150760 | Ga0070663_1001507602 | 264 |
| 296 | 3300005456 | Ga0070678_100001606 | Ga0070678_1000016068 | 264 |
| 297 | 3300005456 | Ga0070678_100208278 | Ga0070678_1002082782 | 264 |
| 298 | 3300005457 | Ga0070662_100033859 | Ga0070662_1000338594 | 264 |
| 299 | 3300005457 | Ga0070662_100089148 | Ga0070662_1000891482 | 264 |
| 300 | 3300005459 | Ga0068867_100010167 | Ga0068867_1000101672 | 264 |
| 301 | 3300005459 | Ga0068867_100022373 | Ga0068867_1000223732 | 264 |
| 302 | 3300005459 | Ga0068867_100028346 | Ga0068867_1000283463 | 264 |
| 303 | 3300005459 | Ga0068867_100167633 | Ga0068867_1001676331 | 264 |
| 304 | 3300005459 | Ga0068867_100296952 | Ga0068867_1002969522 | 264 |
| 305 | 3300005466 | Ga0070685_10039415 | Ga0070685_100394152 | 264 |
| 306 | 3300005535 | Ga0070684_100075820 | Ga0070684_1000758202 | 264 |
| 307 | 3300005539 | Ga0068853_100024982 | Ga0068853_1000249822 | 264 |
| 308 | 3300005543 | Ga0070672_100028819 | Ga0070672_1000288193 | 264 |
| 309 | 3300005543 | Ga0070672_100051724 | Ga0070672_1000517242 | 264 |
| 310 | 3300005547 | Ga0070693_100154563 | Ga0070693_1001545631 | 264 |
| 311 | 3300005548 | Ga0070665_100473577 | Ga0070665_1004735772 | 264 |
| 312 | 3300005563 | Ga0068855_100011670 | Ga0068855_1000116707 | 264 |
| 313 | 3300005564 | Ga0070664_100054532 | Ga0070664_1000545324 | 264 |
| 314 | 3300005564 | Ga0070664_100189213 | Ga0070664_1001892132 | 264 |
| 315 | 3300005564 | Ga0070664_100524547 | Ga0070664_1005245472 | 264 |
| 316 | 3300005577 | Ga0068857_100043664 | Ga0068857_1000436645 | 264 |
| 317 | 3300005577 | Ga0068857_100136606 | Ga0068857_1001366063 | 264 |
| 318 | 3300005578 | Ga0068854_100058603 | Ga0068854_1000586032 | 264 |
| 319 | 3300005578 | Ga0068854_100086446 | Ga0068854_1000864462 | 264 |
| 320 | 3300005578 | Ga0068854_100090914 | Ga0068854_1000909142 | 264 |
| 321 | 3300005578 | Ga0068854_100405571 | Ga0068854_1004055712 | 264 |
| 322 | 3300005614 | Ga0068856_100048942 | Ga0068856_1000489425 | 264 |
| 323 | 3300005616 | Ga0068852_100013886 | Ga0068852_1000138864 | 264 |
| 324 | 3300005616 | Ga0068852_100064443 | Ga0068852_1000644432 | 264 |
| 325 | 3300005616 | Ga0068852_100069959 | Ga0068852_1000699593 | 264 |
| 326 | 3300005616 | Ga0068852_100379283 | Ga0068852_1003792832 | 264 |
| 327 | 3300005616 | Ga0068852_100469339 | Ga0068852_1004693391 | 264 |
| 328 | 3300005617 | Ga0068859_100006855 | Ga0068859_1000068554 | 264 |
| 329 | 3300005617 | Ga0068859_100064825 | Ga0068859_1000648252 | 264 |
| 330 | 3300005618 | Ga0068864_100003331 | Ga0068864_1000033318 | 264 |
| 331 | 3300005618 | Ga0068864_100071807 | Ga0068864_1000718073 | 264 |
| 332 | 3300005718 | Ga0068866_10002110 | Ga0068866_100021106 | 264 |
| 333 | 3300005719 | Ga0068861_100017084 | Ga0068861_1000170843 | 264 |
| 334 | 3300005719 | Ga0068861_100037445 | Ga0068861_1000374454 | 264 |
| 335 | 3300005834 | Ga0068851_10031418 | Ga0068851_100314183 | 264 |
| 336 | 3300005834 | Ga0068851_10059948 | Ga0068851_100599483 | 264 |
| 337 | 3300005840 | Ga0068870_10166451 | Ga0068870_101664512 | 264 |
| 338 | 3300005841 | Ga0068863_100035873 | Ga0068863_1000358732 | 264 |
| 339 | 3300005841 | Ga0068863_100138887 | Ga0068863_1001388872 | 264 |
| 340 | 3300005842 | Ga0068858_100056083 | Ga0068858_1000560832 | 264 |
| 341 | 3300005842 | Ga0068858_100091301 | Ga0068858_1000913012 | 264 |
| 342 | 3300005842 | Ga0068858_100100773 | Ga0068858_1001007732 | 264 |
| 343 | 3300005843 | Ga0068860_100002633 | Ga0068860_10000263319 | 264 |
| 344 | 3300005844 | Ga0068862_100037778 | Ga0068862_1000377783 | 264 |
| 345 | 3300006195 | Ga0075366_10268763 | Ga0075366_102687631 | 264 |
| 346 | 3300006237 | Ga0097621_100206030 | Ga0097621_1002060303 | 264 |
| 347 | 3300006358 | Ga0068871_100020566 | Ga0068871_1000205662 | 264 |
| 348 | 3300006358 | Ga0068871_100024161 | Ga0068871_1000241617 | 264 |
| 349 | 3300006931 | Ga0097620_100006855 | Ga0097620_1000068554 | 264 |
| 350 | 3300006931 | Ga0097620_100064827 | Ga0097620_1000648272 | 264 |
| 351 | 3300009098 | Ga0105245_10069388 | Ga0105245_100693882 | 264 |
| 352 | 3300009098 | Ga0105245_10158815 | Ga0105245_101588152 | 264 |
| 353 | 3300009148 | Ga0105243_10085004 | Ga0105243_100850042 | 264 |
| 354 | 3300009176 | Ga0105242_10070318 | Ga0105242_100703183 | 264 |
| 355 | 3300009177 | Ga0105248_10004911 | Ga0105248_1000491111 | 264 |
| 356 | 3300009177 | Ga0105248_10044730 | Ga0105248_100447308 | 264 |
| 357 | 3300009177 | Ga0105248_10141901 | Ga0105248_101419012 | 264 |
| 358 | 3300009177 | Ga0105248_10222747 | Ga0105248_102227472 | 264 |
| 359 | 3300009545 | Ga0105237_10027992 | Ga0105237_100279922 | 264 |
| 360 | 3300009551 | Ga0105238_10058048 | Ga0105238_100580482 | 264 |
| 361 | 3300009551 | Ga0105238_10416280 | Ga0105238_104162802 | 264 |
| 362 | 3300009553 | Ga0105249_10020966 | Ga0105249_100209663 | 264 |
| 363 | 3300009553 | Ga0105249_10111242 | Ga0105249_101112422 | 264 |
| 364 | 3300013100 | Ga0157373_10029096 | Ga0157373_100290962 | 264 |
| 365 | 3300013104 | Ga0157370_10144773 | Ga0157370_101447732 | 264 |
| 366 | 3300013104 | Ga0157370_10478432 | Ga0157370_104784322 | 264 |
| 367 | 3300013105 | Ga0157369_10041410 | Ga0157369_100414106 | 264 |
| 368 | 3300013105 | Ga0157369_10072252 | Ga0157369_100722523 | 264 |
| 369 | 3300013296 | Ga0157374_10188457 | Ga0157374_101884573 | 264 |
| 370 | 3300013297 | Ga0157378_10141289 | Ga0157378_101412892 | 264 |
| 371 | 3300013297 | Ga0157378_10170508 | Ga0157378_101705082 | 264 |
| 372 | 3300013297 | Ga0157378_10273167 | Ga0157378_102731672 | 264 |
| 373 | 3300013306 | Ga0163162_10017572 | Ga0163162_100175724 | 264 |
| 374 | 3300013306 | Ga0163162_10063034 | Ga0163162_100630342 | 264 |
| 375 | 3300013306 | Ga0163162_10527549 | Ga0163162_105275491 | 264 |
| 376 | 3300013307 | Ga0157372_10020606 | Ga0157372_100206067 | 264 |
| 377 | 3300013307 | Ga0157372_10036073 | Ga0157372_100360733 | 264 |
| 378 | 3300013307 | Ga0157372_10192562 | Ga0157372_101925622 | 264 |
| 379 | 3300013308 | Ga0157375_10032143 | Ga0157375_100321435 | 264 |
| 380 | 3300013308 | Ga0157375_10057979 | Ga0157375_100579792 | 264 |
| 381 | 3300013308 | Ga0157375_10095193 | Ga0157375_100951935 | 264 |
| 382 | 3300014325 | Ga0163163_10027737 | Ga0163163_100277378 | 264 |
| 383 | 3300014325 | Ga0163163_10483504 | Ga0163163_104835042 | 264 |
| 384 | 3300014326 | Ga0157380_10066878 | Ga0157380_100668783 | 264 |
| 385 | 3300014326 | Ga0157380_10222802 | Ga0157380_102228022 | 264 |
| 386 | 3300014745 | Ga0157377_10000667 | Ga0157377_1000066713 | 264 |
| 387 | 3300014968 | Ga0157379_10002348 | Ga0157379_100023489 | 264 |
| 388 | 3300014968 | Ga0157379_10024171 | Ga0157379_100241715 | 264 |
| 389 | 3300014968 | Ga0157379_10115021 | Ga0157379_101150213 | 264 |
| 390 | 3300014969 | Ga0157376_10003810 | Ga0157376_1000381010 | 264 |
| 391 | 3300014969 | Ga0157376_10034752 | Ga0157376_100347527 | 264 |
| 392 | 3300014969 | Ga0157376_10279533 | Ga0157376_102795332 | 264 |
| 393 | 3300015265 | Ga0182005_1042384 | Ga0182005_10423841 | 264 |
| 394 | 3300017792 | Ga0163161_10022792 | Ga0163161_100227923 | 264 |
| 395 | 3300017792 | Ga0163161_10026880 | Ga0163161_100268805 | 264 |
| 396 | 3300017792 | Ga0163161_10037708 | Ga0163161_100377083 | 264 |
| 397 | 3300017792 | Ga0163161_10132250 | Ga0163161_101322502 | 264 |
| 398 | 3300025284 | Ga0209130_1002187 | Ga0209130_10021878 | 264 |
| 399 | 3300025291 | Ga0209675_1001070 | Ga0209675_100107010 | 264 |
| 400 | 3300025292 | Ga0209676_1003856 | Ga0209676_10038569 | 264 |
| 401 | 3300025304 | Ga0209257_1020086 | Ga0209257_10200863 | 264 |
| 402 | 3300025321 | Ga0207656_10031946 | Ga0207656_100319462 | 264 |
| 403 | 3300025321 | Ga0207656_10040179 | Ga0207656_100401793 | 264 |
| 404 | 3300025893 | Ga0207682_10015787 | Ga0207682_100157873 | 264 |
| 405 | 3300025899 | Ga0207642_10010207 | Ga0207642_100102073 | 264 |
| 406 | 3300025901 | Ga0207688_10149106 | Ga0207688_101491062 | 264 |
| 407 | 3300025907 | Ga0207645_10003883 | Ga0207645_100038836 | 264 |
| 408 | 3300025907 | Ga0207645_10008444 | Ga0207645_100084443 | 264 |
| 409 | 3300025907 | Ga0207645_10091160 | Ga0207645_100911602 | 264 |
| 410 | 3300025909 | Ga0207705_10024942 | Ga0207705_100249422 | 264 |
| 411 | 3300025911 | Ga0207654_10114102 | Ga0207654_101141023 | 264 |
| 412 | 3300025918 | Ga0207662_10003115 | Ga0207662_100031159 | 264 |
| 413 | 3300025919 | Ga0207657_10142446 | Ga0207657_101424463 | 264 |
| 414 | 3300025920 | Ga0207649_10009302 | Ga0207649_100093021 | 264 |
| 415 | 3300025920 | Ga0207649_10182210 | Ga0207649_101822102 | 264 |
| 416 | 3300025923 | Ga0207681_10004565 | Ga0207681_100045659 | 264 |
| 417 | 3300025924 | Ga0207694_10020004 | Ga0207694_100200043 | 264 |
| 418 | 3300025924 | Ga0207694_10158182 | Ga0207694_101581823 | 264 |
| 419 | 3300025925 | Ga0207650_10009549 | Ga0207650_100095493 | 264 |
| 420 | 3300025925 | Ga0207650_10059182 | Ga0207650_100591823 | 264 |
| 421 | 3300025925 | Ga0207650_10076123 | Ga0207650_100761234 | 264 |
| 422 | 3300025926 | Ga0207659_10002086 | Ga0207659_100020863 | 264 |
| 423 | 3300025926 | Ga0207659_10009153 | Ga0207659_100091533 | 264 |
| 424 | 3300025926 | Ga0207659_10078549 | Ga0207659_100785492 | 264 |
| 425 | 3300025926 | Ga0207659_10086656 | Ga0207659_100866562 | 264 |
| 426 | 3300025927 | Ga0207687_10107995 | Ga0207687_101079952 | 264 |
| 427 | 3300025931 | Ga0207644_10005655 | Ga0207644_100056557 | 264 |
| 428 | 3300025931 | Ga0207644_10114399 | Ga0207644_101143992 | 264 |
| 429 | 3300025933 | Ga0207706_10001684 | Ga0207706_1000168416 | 264 |
| 430 | 3300025933 | Ga0207706_10035026 | Ga0207706_100350268 | 264 |
| 431 | 3300025933 | Ga0207706_10198755 | Ga0207706_101987552 | 264 |
| 432 | 3300025936 | Ga0207670_10072598 | Ga0207670_100725982 | 264 |
| 433 | 3300025939 | Ga0207665_10063452 | Ga0207665_100634523 | 264 |
| 434 | 3300025940 | Ga0207691_10044257 | Ga0207691_100442572 | 264 |
| 435 | 3300025940 | Ga0207691_10129100 | Ga0207691_101291002 | 264 |
| 436 | 3300025940 | Ga0207691_10178880 | Ga0207691_101788802 | 264 |
| 437 | 3300025941 | Ga0207711_10008678 | Ga0207711_100086785 | 264 |
| 438 | 3300025941 | Ga0207711_10063613 | Ga0207711_100636132 | 264 |
| 439 | 3300025941 | Ga0207711_10246400 | Ga0207711_102464002 | 264 |
| 440 | 3300025942 | Ga0207689_10000393 | Ga0207689_1000039340 | 264 |
| 441 | 3300025942 | Ga0207689_10007718 | Ga0207689_100077183 | 264 |
| 442 | 3300025944 | Ga0207661_10022350 | Ga0207661_100223505 | 264 |
| 443 | 3300025945 | Ga0207679_10018103 | Ga0207679_100181032 | 264 |
| 444 | 3300025945 | Ga0207679_10176587 | Ga0207679_101765872 | 264 |
| 445 | 3300025960 | Ga0207651_10209422 | Ga0207651_102094222 | 264 |
| 446 | 3300025961 | Ga0207712_10024409 | Ga0207712_100244093 | 264 |
| 447 | 3300025972 | Ga0207668_10019692 | Ga0207668_100196922 | 264 |
| 448 | 3300025972 | Ga0207668_10081448 | Ga0207668_100814482 | 264 |
| 449 | 3300025972 | Ga0207668_10249185 | Ga0207668_102491852 | 264 |
| 450 | 3300025981 | Ga0207640_10023728 | Ga0207640_100237285 | 264 |
| 451 | 3300025981 | Ga0207640_10050144 | Ga0207640_100501442 | 264 |
| 452 | 3300025981 | Ga0207640_10377699 | Ga0207640_103776992 | 264 |
| 453 | 3300025986 | Ga0207658_10002016 | Ga0207658_100020169 | 264 |
| 454 | 3300025986 | Ga0207658_10006229 | Ga0207658_100062292 | 264 |
| 455 | 3300026023 | Ga0207677_10000891 | Ga0207677_100008915 | 264 |
| 456 | 3300026023 | Ga0207677_10007442 | Ga0207677_100074423 | 264 |
| 457 | 3300026035 | Ga0207703_10000937 | Ga0207703_1000093731 | 264 |
| 458 | 3300026035 | Ga0207703_10062751 | Ga0207703_100627512 | 264 |
| 459 | 3300026035 | Ga0207703_10172963 | Ga0207703_101729632 | 264 |
| 460 | 3300026041 | Ga0207639_10024620 | Ga0207639_100246206 | 264 |
| 461 | 3300026041 | Ga0207639_10187006 | Ga0207639_101870061 | 264 |
| 462 | 3300026067 | Ga0207678_10008511 | Ga0207678_100085115 | 264 |
| 463 | 3300026067 | Ga0207678_10183622 | Ga0207678_101836221 | 264 |
| 464 | 3300026067 | Ga0207678_10206019 | Ga0207678_102060192 | 264 |
| 465 | 3300026075 | Ga0207708_10170201 | Ga0207708_101702012 | 264 |
| 466 | 3300026078 | Ga0207702_10438148 | Ga0207702_104381481 | 264 |
| 467 | 3300026088 | Ga0207641_10000743 | Ga0207641_100007439 | 264 |
| 468 | 3300026088 | Ga0207641_10016984 | Ga0207641_100169842 | 264 |
| 469 | 3300026089 | Ga0207648_10018023 | Ga0207648_100180233 | 264 |
| 470 | 3300026089 | Ga0207648_10020752 | Ga0207648_100207522 | 264 |
| 471 | 3300026089 | Ga0207648_10030545 | Ga0207648_100305455 | 264 |
| 472 | 3300026089 | Ga0207648_10143258 | Ga0207648_101432582 | 264 |
| 473 | 3300026089 | Ga0207648_10151679 | Ga0207648_101516792 | 264 |
| 474 | 3300026089 | Ga0207648_10275937 | Ga0207648_102759372 | 264 |
| 475 | 3300026095 | Ga0207676_10036783 | Ga0207676_100367832 | 264 |
| 476 | 3300026095 | Ga0207676_10047448 | Ga0207676_100474484 | 264 |
| 477 | 3300026095 | Ga0207676_10144607 | Ga0207676_101446072 | 264 |
| 478 | 3300026116 | Ga0207674_10050452 | Ga0207674_100504522 | 264 |
| 479 | 3300026116 | Ga0207674_10089773 | Ga0207674_100897732 | 264 |
| 480 | 3300026118 | Ga0207675_100002300 | Ga0207675_10000230011 | 264 |
| 481 | 3300026118 | Ga0207675_100016484 | Ga0207675_1000164843 | 264 |
| 482 | 3300026121 | Ga0207683_10015961 | Ga0207683_100159613 | 264 |
| 483 | 3300026121 | Ga0207683_10022854 | Ga0207683_100228548 | 264 |
| 484 | 3300026121 | Ga0207683_10035034 | Ga0207683_100350345 | 264 |
| 485 | 3300026121 | Ga0207683_10081225 | Ga0207683_100812252 | 264 |
| 486 | 3300026121 | Ga0207683_10228599 | Ga0207683_102285993 | 264 |
| 487 | 3300026121 | Ga0207683_10294611 | Ga0207683_102946112 | 264 |
| 488 | 3300026121 | Ga0207683_10337592 | Ga0207683_103375922 | 264 |
| 489 | 3300026142 | Ga0207698_10043585 | Ga0207698_100435851 | 264 |
| 490 | 3300026142 | Ga0207698_10102538 | Ga0207698_101025384 | 264 |
| 491 | 3300026142 | Ga0207698_10165882 | Ga0207698_101658822 | 264 |
| 492 | 3300027907 | Ga0207428_10303533 | Ga0207428_103035332 | 264 |
| 493 | 3300028379 | Ga0268266_10247797 | Ga0268266_102477971 | 264 |
| 494 | 3300028380 | Ga0268265_10009768 | Ga0268265_100097685 | 264 |
| 495 | 3300028380 | Ga0268265_10065273 | Ga0268265_100652733 | 264 |
| 496 | 3300028381 | Ga0268264_10011641 | Ga0268264_100116412 | 264 |
| 497 | 3300028794 | Ga0307515_10157840 | Ga0307515_101578404 | 264 |
| 498 | 3300031824 | Ga0307413_10457911 | Ga0307413_104579111 | 264 |
| 499 | 3300031911 | Ga0307412_10198834 | Ga0307412_101988341 | 264 |
| 500 | 3300034816 | Ga0373930_0018759 | Ga0373930_0018759_339_1154 | 264 |
| 501 | 3300035172 | Ga0373955_0245852 | Ga0373955_0245852_228_1043 | 264 |
| 502 | 3300035691 | Ga0373931_0000504 | Ga0373931_0000504_5029_5844 | 264 |
| 503 | 3300039438 | Ga0436360_0810517 | Ga0436360_0810517_443_1255 | 264 |
| 504 | 3300046528 | Ga0495642_0003932 | Ga0495642_0003932_4736_5554 | 264 |
| 505 | 3300046615 | Ga0495656_0001626 | Ga0495656_0001626_4733_5548 | 264 |
| 506 | 3300046691 | Ga0495670_0102045 | Ga0495670_0102045_543_1358 | 264 |
| 507 | 3300048904 | Ga0496101_0103073 | Ga0496101_0103073_817_1632 | 264 |
| 508 | 3300048905 | Ga0496102_0181004 | Ga0496102_0181004_650_1465 | 264 |
| 509 | 3300048908 | Ga0496105_0320558 | Ga0496105_0320558_244_1056 | 264 |
| 510 | 3300048909 | Ga0496106_0035455 | Ga0496106_0035455_1302_2117 | 264 |
| 511 | 3300048910 | Ga0496107_0026941 | Ga0496107_0026941_132_947 | 264 |
| 512 | 3300048911 | Ga0496108_0040004 | Ga0496108_0040004_2024_2842 | 264 |
| 513 | 3300048911 | Ga0496108_0368018 | Ga0496108_0368018_261_1079 | 264 |
| 514 | 3300048912 | Ga0496109_0026135 | Ga0496109_0026135_1896_2714 | 264 |
| 515 | 3300048912 | Ga0496109_0469655 | Ga0496109_0469655_13_831 | 264 |
| 516 | 3300048913 | Ga0496110_0057761 | Ga0496110_0057761_1311_2129 | 264 |
| 517 | 3300048913 | Ga0496110_0168793 | Ga0496110_0168793_399_1217 | 264 |
| 518 | 3300048913 | Ga0496110_0230145 | Ga0496110_0230145_126_944 | 264 |
| 519 | 3300048914 | Ga0496111_0043930 | Ga0496111_0043930_1035_1853 | 264 |
| 520 | 3300048916 | Ga0496113_0013212 | Ga0496113_0013212_4078_4893 | 264 |
| 521 | 3300048917 | Ga0496114_0114273 | Ga0496114_0114273_620_1435 | 264 |
| 522 | 3300048917 | Ga0496114_0502999 | Ga0496114_0502999_55_873 | 264 |
| 523 | 3300048918 | Ga0496115_0039829 | Ga0496115_0039829_676_1491 | 264 |
| 524 | 3300050493 | nmdc:mga0k408_310657_c1 | nmdc:mga0k408_310657_c1_85_897 | 264 |
| 525 | 3300053088 | Ga0500644_0066890 | Ga0500644_0066890_47_859 | 264 |
| 526 | 3300003752 | Ga0055539_1000116 | Ga0055539_100011679 | 265 |
| 527 | 3300003756 | Ga0055533_1000016 | Ga0055533_1000016300 | 265 |
| 528 | 3300003759 | Ga0055525_1001924 | Ga0055525_10019243 | 265 |
| 529 | 3300005355 | Ga0070671_100005297 | Ga0070671_1000052971 | 265 |
| 530 | 3300005366 | Ga0070659_100000966 | Ga0070659_1000009665 | 265 |
| 531 | 3300005459 | Ga0068867_100000059 | Ga0068867_10000005948 | 265 |
| 532 | 3300009148 | Ga0105243_10002725 | Ga0105243_100027252 | 265 |
| 533 | 3300014745 | Ga0157377_10000029 | Ga0157377_1000002977 | 265 |
| 534 | 3300025226 | Ga0209674_100041 | Ga0209674_10004184 | 265 |
| 535 | 3300025230 | Ga0209563_100043 | Ga0209563_10004384 | 265 |
| 536 | 3300025253 | Ga0209677_100077 | Ga0209677_10007784 | 265 |
| 537 | 3300025931 | Ga0207644_10016274 | Ga0207644_100162745 | 265 |
| 538 | 3300025932 | Ga0207690_10000648 | Ga0207690_100006485 | 265 |
| 539 | 3300025935 | Ga0207709_10003391 | Ga0207709_1000339112 | 265 |
| 540 | 3300026089 | Ga0207648_10000080 | Ga0207648_1000008049 | 265 |
| 541 | 3300046455 | Ga0495603_0027429 | Ga0495603_0027429_275_1084 | 265 |
| 542 | 3300046459 | Ga0495629_0047329 | Ga0495629_0047329_83_892 | 265 |
| 543 | 3300046473 | Ga0495582_0126627 | Ga0495582_0126627_507_1316 | 265 |
| 544 | 3300046474 | Ga0495605_0119492 | Ga0495605_0119492_103_912 | 265 |
| 545 | 3300046500 | Ga0495596_0021368 | Ga0495596_0021368_1661_2470 | 265 |
| 546 | 3300046506 | Ga0495583_0034454 | Ga0495583_0034454_463_1272 | 265 |
| 547 | 3300046513 | Ga0495616_0148856 | Ga0495616_0148856_134_943 | 265 |
| 548 | 3300046518 | Ga0495631_0155078 | Ga0495631_0155078_29_838 | 265 |
| 549 | 3300046528 | Ga0495642_0008922 | Ga0495642_0008922_2144_2953 | 265 |
| 550 | 3300046530 | Ga0495654_0072000 | Ga0495654_0072000_123_932 | 265 |
| 551 | 3300046536 | Ga0495587_0030309 | Ga0495587_0030309_1681_2490 | 265 |
| 552 | 3300046538 | Ga0495609_0084414 | Ga0495609_0084414_118_927 | 265 |
| 553 | 3300046543 | Ga0495645_0103938 | Ga0495645_0103938_523_1332 | 265 |
| 554 | 3300046543 | Ga0495645_0313842 | Ga0495645_0313842_109_918 | 265 |
| 555 | 3300046616 | Ga0495668_0170171 | Ga0495668_0170171_101_913 | 265 |
| 556 | 3300046648 | Ga0495611_0040361 | Ga0495611_0040361_1061_1870 | 265 |
| 557 | 3300046674 | Ga0495588_0016977 | Ga0495588_0016977_1601_2410 | 265 |
| 558 | 3300046680 | Ga0495646_0026803 | Ga0495646_0026803_2344_3153 | 265 |
| 559 | 3300046689 | Ga0495613_0018108 | Ga0495613_0018108_550_1359 | 265 |
| 560 | 3300046694 | Ga0495649_0089720 | Ga0495649_0089720_800_1609 | 265 |
| 561 | 3300046794 | Ga0495589_0005569 | Ga0495589_0005569_2681_3490 | 265 |
| 562 | 3300047322 | Ga0495680_0067421 | Ga0495680_0067421_300_1109 | 265 |
| 563 | 3300047323 | Ga0495683_0027109 | Ga0495683_0027109_577_1386 | 265 |
| 564 | 3300047445 | Ga0495677_0011886 | Ga0495677_0011886_131_940 | 265 |
| 565 | 3300047446 | Ga0495679_041826 | Ga0495679_041826_59_868 | 265 |
| 566 | 3300047470 | Ga0495681_0050388 | Ga0495681_0050388_143_952 | 265 |
| 567 | 3300048089 | Ga0495614_0009086 | Ga0495614_0009086_1293_2102 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zzs-assembly1.cif.gz_A | crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 | 0.9667 | 91 | 165 |
| 4o1w-assembly2.cif.gz_B | crystal structure of colwellia psychrerythraea cytochrome c | 0.9615 | 91 | 165 |
| 1cno-assembly1.cif.gz_A | structure of pseudomonas nautica cytochrome c552, by mad method | 0.9498 | 91 | 166 |
| 2zzs-assembly29.cif.gz_3 | crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 | 0.9475 | 91 | 165 |
| 4o1w-assembly2.cif.gz_B | crystal structure of colwellia psychrerythraea cytochrome c | 0.9144 | 91 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4o1wD00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9625 | 91 | 165 | 1.10.760.10 |
| 1h1oB02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9572 | 101 | 165 | 1.10.760.10 |
| 2zzsM00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9555 | 92 | 164 | 1.10.760.10 |
| 2zzsS00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9539 | 91 | 165 | 1.10.760.10 |
| 1cnoH00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9521 | 91 | 166 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y3AN32-F1-model_v4 | C-type cytochrome | 0.9719 | 91 | 167 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A0N0JTD0-F1-model_v4 | Cytochrome c domain-containing protein | 0.9654 | 94 | 167 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A832E710-F1-model_v4 | Cytochrome c | 0.9622 | 89 | 167 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A6N6P183-F1-model_v4 | C-type cytochrome | 0.9356 | 93 | 171 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A1Q8GE37-F1-model_v4 | Cytochrome C554 | 0.9309 | 91 | 173 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar