F464530

General Info

Members Datasets Scaffolds Average Seq Length
567 277 1128 344

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0119300|Ga0395901_0119300_1340_2497
Length 385
Sequence MAWGNDRERLGNMEYRTLTDPLPAEGSNGLTGDGSIRVQSDGIASRPSPLALPAPYLLFLGDVTEPSYAKTAFGLHDWASERCVGEFVSDPRAVRTGLPRLSPAEAAAKGARAMVIAVANSGGYIPESWHPSLLEALGAGLDLVAGMHVKLASIPAVAQAAQDLGRQLIDVRTPPRNIPVATGEKRSGKRLLTVGTDCALGKKYTALALAHAFARRGLKVDFRATGQTGIMIAGGGIPMDAVVSDFEAGAAELLSPDAAPDHWDVIEGQGSLLHPAYSAVSMGLLHGSQPDVFVVCHDPSRSTMLGHPNFPIPAIEEIISLTTELGRRTNPAIRCGGVAYNTSALRAEDAAALMERDSERLGLEIADPIRRGPAFDRLVNSCLEA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
155 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
179 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
258 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
262 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
263 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
269 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
270 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
271 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
272 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
273 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
274 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
275 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
276 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
277 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.35
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.11
Nodule 0.18
Rhizoplane 1.94
Rhizosphere 74.25
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0119300 3300038443 Bacteria 2772
2 JGI24740J21852_10000019 3300001979 Bacteria 54662
3 JGI24739J22299_10006255 3300001989 Bacteria 4495
4 JGI25150J39212_1000044 3300002774 Bacteria 83125
5 JGI25406J46586_10003744 3300003203 Bacteria 7115
6 JGI25153J46596_10000043 3300003215 Bacteria 156407
7 Ga0055526_1005425 3300003771 Bacteria 7334
8 Ga0055537_1001605 3300003773 Bacteria 8512
9 Ga0055536_1000733 3300003781 Bacteria 22058
10 Ga0055536_1001202 3300003781 Bacteria 16081
11 Ga0055536_1001466 3300003781 Bacteria 14175
12 Ga0055536_1001810 3300003781 Bacteria 12568
13 Ga0055536_1003951 3300003781 Bacteria 7772
14 Ga0055536_1007638 3300003781 Bacteria 4796
15 Ga0055536_1015188 3300003781 Bacteria 2651
16 Ga0055530_10000106 3300003791 Bacteria 71921
17 Ga0055530_10000164 3300003791 Bacteria 60316
18 Ga0055530_10000181 3300003791 Bacteria 56843
19 Ga0055530_10000465 3300003791 Bacteria 35593
20 Ga0055530_10021805 3300003791 Bacteria 1879
21 Ga0055530_10023840 3300003791 Bacteria 1750
22 Ga0055530_10041273 3300003791 Bacteria 1127
23 Ga0055540_1006239 3300003792 Bacteria 4779
24 Ga0055531_10000012 3300003794 Bacteria 191187
25 Ga0055531_10001005 3300003794 Bacteria 22405
26 Ga0055531_10001314 3300003794 Bacteria 18656
27 Ga0055531_10004289 3300003794 Bacteria 8747
28 Ga0055531_10004380 3300003794 Bacteria 8625
29 Ga0055531_10005744 3300003794 Bacteria 7187
30 Ga0055531_10006349 3300003794 Bacteria 6727
31 Ga0055531_10024604 3300003794 Bacteria 2215
32 Ga0055531_10024606 3300003794 Bacteria 2215
33 Ga0065165_1007814 3300005262 Bacteria 5151
34 Ga0065715_10101304 3300005293 Bacteria 3218
35 Ga0070683_100221658 3300005329 Bacteria 1798
36 Ga0070690_100052877 3300005330 Bacteria 2597
37 Ga0070670_100148246 3300005331 Bacteria 2030
38 Ga0070670_100279037 3300005331 Bacteria 1459
39 Ga0070666_10001021 3300005335 Bacteria 17164
40 Ga0070682_100063474 3300005337 Bacteria 2342
41 Ga0068868_100038055 3300005338 Bacteria 3733
42 Ga0070689_100005710 3300005340 Bacteria 8527
43 Ga0070689_100143957 3300005340 Bacteria 1919
44 Ga0070691_10109888 3300005341 Bacteria 1378
45 Ga0070687_100020844 3300005343 Bacteria 3072
46 Ga0070661_100006044 3300005344 Bacteria 8327
47 Ga0070661_100087735 3300005344 Bacteria 2302
48 Ga0070661_100111003 3300005344 Bacteria 2048
49 Ga0070668_100045018 3300005347 Bacteria 3386
50 Ga0070669_100013818 3300005353 Bacteria 5739
51 Ga0070669_100144466 3300005353 Bacteria 1837
52 Ga0070675_100198646 3300005354 Bacteria 1740
53 Ga0070675_100288289 3300005354 Bacteria 1444
54 Ga0070667_100099738 3300005367 Bacteria 2507
55 Ga0070667_100165132 3300005367 Bacteria 1952
56 Ga0070667_100235003 3300005367 Bacteria 1635
57 Ga0070714_100230939 3300005435 Bacteria 1704
58 Ga0070705_100020633 3300005440 Bacteria 3491
59 Ga0070700_100020690 3300005441 Bacteria 3817
60 Ga0070663_100000022 3300005455 Bacteria 111612
61 Ga0070678_100006730 3300005456 Bacteria 6768
62 Ga0070678_100110169 3300005456 Bacteria 2153
63 Ga0070662_100002305 3300005457 Bacteria 11720
64 Ga0070662_100002608 3300005457 Bacteria 11121
65 Ga0070662_100004914 3300005457 Bacteria 8491
66 Ga0070662_100070678 3300005457 Bacteria 2572
67 Ga0070681_10003155 3300005458 Bacteria 15329
68 Ga0070681_10177753 3300005458 Bacteria 2050
69 Ga0068867_100016202 3300005459 Bacteria 5292
70 Ga0068867_100368207 3300005459 Bacteria 1204
71 Ga0070685_10000152 3300005466 Bacteria 45620
72 Ga0070685_10001858 3300005466 Bacteria 11018
73 Ga0070684_100008538 3300005535 Bacteria 8016
74 Ga0068853_100028737 3300005539 Bacteria 4679
75 Ga0068853_100032342 3300005539 Bacteria 4431
76 Ga0068853_100044493 3300005539 Bacteria 3800
77 Ga0068853_100068560 3300005539 Bacteria 3084
78 Ga0068853_100316742 3300005539 Bacteria 1445
79 Ga0070686_100002514 3300005544 Bacteria 10102
80 Ga0070665_100000928 3300005548 Bacteria 37485
81 Ga0070665_100004102 3300005548 Bacteria 15321
82 Ga0070665_100007710 3300005548 Bacteria 10930
83 Ga0070665_100008614 3300005548 Bacteria 10322
84 Ga0070665_100009713 3300005548 Bacteria 9725
85 Ga0070665_100030126 3300005548 Bacteria 5460
86 Ga0070665_100104488 3300005548 Bacteria 2835
87 Ga0070665_100105961 3300005548 Bacteria 2813
88 Ga0068855_100069899 3300005563 Unclassified 4085
89 Ga0070664_100220201 3300005564 Bacteria 1698
90 Ga0068857_100022630 3300005577 Bacteria 5528
91 Ga0068854_100006701 3300005578 Bacteria 7343
92 Ga0068856_100000041 3300005614 Bacteria 112613
93 Ga0068856_100015602 3300005614 Bacteria 7345
94 Ga0070702_100021737 3300005615 Bacteria 3382
95 Ga0068852_100290638 3300005616 Bacteria 1579
96 Ga0068859_100002362 3300005617 Bacteria 19216
97 Ga0068864_100029869 3300005618 Bacteria 4619
98 Ga0068866_10146072 3300005718 Bacteria 1364
99 Ga0068861_100000062 3300005719 Bacteria 51049
100 Ga0068861_100000366 3300005719 Bacteria 25904
101 Ga0068851_10007007 3300005834 Bacteria 5169
102 Ga0068870_10018123 3300005840 Bacteria 3395
103 Ga0068863_100030711 3300005841 Bacteria 5130
104 Ga0068863_100084928 3300005841 Bacteria 2999
105 Ga0068863_100246254 3300005841 Bacteria 1726
106 Ga0068858_100002262 3300005842 Bacteria 19472
107 Ga0068858_100049301 3300005842 Bacteria 3899
108 Ga0068860_100006757 3300005843 Bacteria 11505
109 Ga0068860_100448429 3300005843 Bacteria 1283
110 Ga0068862_100000722 3300005844 Bacteria 33471
111 Ga0068862_100276589 3300005844 Bacteria 1537
112 Ga0081539_10000004 3300005985 Bacteria 555600
113 Ga0070717_10282795 3300006028 Bacteria 1472
114 Ga0070716_100121766 3300006173 Bacteria 1634
115 Ga0070716_100209304 3300006173 Bacteria 1302
116 Ga0097621_100019694 3300006237 Bacteria 5186
117 Ga0097621_100024669 3300006237 Bacteria 4699
118 Ga0097621_100034130 3300006237 Bacteria 4056
119 Ga0097621_100137657 3300006237 Bacteria 2084
120 Ga0068871_100051777 3300006358 Bacteria 3324
121 Ga0075428_100000920 3300006844 Bacteria 31094
122 Ga0075428_100282823 3300006844 Bacteria 1785
123 Ga0075430_100004783 3300006846 Bacteria 11391
124 Ga0075430_100008166 3300006846 Bacteria 8848
125 Ga0075430_100060288 3300006846 Bacteria 3189
126 Ga0075430_100141229 3300006846 Bacteria 2006
127 Ga0075431_100000221 3300006847 Bacteria 42473
128 Ga0075431_100000267 3300006847 Bacteria 40345
129 Ga0075431_100003861 3300006847 Bacteria 14570
130 Ga0075434_100213628 3300006871 Bacteria 1949
131 Ga0075429_100003103 3300006880 Bacteria 14111
132 Ga0068865_100023649 3300006881 Bacteria 4025
133 Ga0097620_100002362 3300006931 Bacteria 19216
134 Ga0079104_1018097 3300006946 Bacteria 2005
135 Ga0105240_10010664 3300009093 Bacteria 12896
136 Ga0105240_10016387 3300009093 Bacteria 10035
137 Ga0105240_10067374 3300009093 Bacteria 4437
138 Ga0105240_10069692 3300009093 Bacteria 4352
139 Ga0105240_10175389 3300009093 Bacteria 2535
140 Ga0111539_10000989 3300009094 Bacteria 37233
141 Ga0111539_10007571 3300009094 Bacteria 13881
142 Ga0111539_10025836 3300009094 Bacteria 7191
143 Ga0111539_10127795 3300009094 Bacteria 2977
144 Ga0111539_10401226 3300009094 Bacteria 1597
145 Ga0105245_10078920 3300009098 Bacteria 3004
146 Ga0105245_10153917 3300009098 Bacteria 2176
147 Ga0105247_10059784 3300009101 Bacteria 2360
148 Ga0114129_10003655 3300009147 Bacteria 21639
149 Ga0114129_10079198 3300009147 Bacteria 4569
150 Ga0114129_10247926 3300009147 Bacteria 2392
151 Ga0105242_10016940 3300009176 Bacteria 5671
152 Ga0105248_10037039 3300009177 Bacteria 5455
153 Ga0105237_10005186 3300009545 Bacteria 14738
154 Ga0105237_10037935 3300009545 Bacteria 4868
155 Ga0105237_10073498 3300009545 Bacteria 3411
156 Ga0105237_10109291 3300009545 Bacteria 2757
157 Ga0105237_10291681 3300009545 Bacteria 1634
158 Ga0105238_10000192 3300009551 Bacteria 67306
159 Ga0105238_10004676 3300009551 Bacteria 13548
160 Ga0105238_10025058 3300009551 Bacteria 6081
161 Ga0105238_10069026 3300009551 Bacteria 3535
162 Ga0105238_10085639 3300009551 Bacteria 3139
163 Ga0105238_10144200 3300009551 Bacteria 2358
164 Ga0105238_10179831 3300009551 Bacteria 2092
165 Ga0105238_10567708 3300009551 Bacteria 1140
166 Ga0105249_10001944 3300009553 Bacteria 17939
167 Ga0105249_10018875 3300009553 Bacteria 6145
168 Ga0105249_10029931 3300009553 Bacteria 4918
169 Ga0105249_10041664 3300009553 Bacteria 4175
170 Ga0105239_10029287 3300010375 Bacteria 6054
171 Ga0157373_10000046 3300013100 Bacteria 112179
172 Ga0157370_10000071 3300013104 Bacteria 111640
173 Ga0157369_10011583 3300013105 Bacteria 10011
174 Ga0163162_10000004 3300013306 Bacteria 505593
175 Ga0163162_10023244 3300013306 Bacteria 6115
176 Ga0163162_10298450 3300013306 Bacteria 1743
177 Ga0163162_10369090 3300013306 Bacteria 1568
178 Ga0157372_10529003 3300013307 Unclassified 1374
179 Ga0157375_10001172 3300013308 Bacteria 22634
180 Ga0157375_10030306 3300013308 Bacteria 5100
181 Ga0157375_10137437 3300013308 Bacteria 2569
182 Ga0157375_10206807 3300013308 Bacteria 2119
183 Ga0163163_10004078 3300014325 Bacteria 12454
184 Ga0157380_10053565 3300014326 Bacteria 3199
185 Ga0182008_10110260 3300014497 Bacteria 1364
186 Ga0157377_10003544 3300014745 Bacteria 7065
187 Ga0157379_10033075 3300014968 Bacteria 4610
188 Ga0157379_10100880 3300014968 Unclassified 2591
189 Ga0157379_10179162 3300014968 Bacteria 1915
190 Ga0157376_10032388 3300014969 Bacteria 4197
191 Ga0157376_10033821 3300014969 Bacteria 4120
192 Ga0163161_10064637 3300017792 Bacteria 2669
193 Ga0207425_1000047 3300025245 Bacteria 189158
194 Ga0209129_1000497 3300025258 Bacteria 28640
195 Ga0209565_1000089 3300025263 Bacteria 150511
196 Ga0209675_1000183 3300025291 Bacteria 70391
197 Ga0209675_1000202 3300025291 Bacteria 62955
198 Ga0209675_1000384 3300025291 Bacteria 36771
199 Ga0209676_1000155 3300025292 Bacteria 165151
200 Ga0209676_1000234 3300025292 Bacteria 119888
201 Ga0209676_1000384 3300025292 Bacteria 81053
202 Ga0209676_1000475 3300025292 Bacteria 66299
203 Ga0209676_1000693 3300025292 Bacteria 47361
204 Ga0209676_1004605 3300025292 Bacteria 7600
205 Ga0209676_1004674 3300025292 Bacteria 7513
206 Ga0209676_1007388 3300025292 Bacteria 5168
207 Ga0209025_1000150 3300025294 Bacteria 172834
208 Ga0209025_1007902 3300025294 Bacteria 7794
209 Ga0209025_1020691 3300025294 Bacteria 3582
210 Ga0209025_1054244 3300025294 Bacteria 1563
211 Ga0209564_1001696 3300025295 Bacteria 20847
212 Ga0209758_1000009 3300025297 Bacteria 1123483
213 Ga0209758_1023933 3300025297 Bacteria 2741
214 Ga0209050_1000005 3300025298 Bacteria 1557793
215 Ga0209050_1000039 3300025298 Bacteria 410069
216 Ga0209050_1000112 3300025298 Bacteria 210320
217 Ga0209050_1000132 3300025298 Bacteria 185906
218 Ga0209050_1000776 3300025298 Bacteria 45644
219 Ga0209050_1007994 3300025298 Bacteria 5770
220 Ga0209050_1008503 3300025298 Bacteria 5468
221 Ga0209050_1015174 3300025298 Bacteria 3257
222 Ga0209050_1032064 3300025298 Bacteria 1624
223 Ga0209051_1000396 3300025303 Bacteria 60690
224 Ga0209051_1004840 3300025303 Bacteria 8098
225 Ga0209257_1000051 3300025304 Bacteria 434166
226 Ga0209257_1000176 3300025304 Bacteria 161436
227 Ga0209257_1000337 3300025304 Bacteria 97941
228 Ga0209257_1000523 3300025304 Bacteria 66624
229 Ga0209257_1000600 3300025304 Bacteria 59824
230 Ga0209257_1001283 3300025304 Bacteria 30714
231 Ga0209257_1001567 3300025304 Bacteria 26417
232 Ga0209257_1001840 3300025304 Bacteria 23128
233 Ga0209257_1004585 3300025304 Bacteria 10546
234 Ga0209257_1015830 3300025304 Bacteria 3101
235 Ga0207656_10068433 3300025321 Bacteria 1573
236 Ga0207656_10090192 3300025321 Bacteria 1390
237 Ga0207688_10024861 3300025901 Bacteria 3286
238 Ga0207680_10098946 3300025903 Bacteria 1870
239 Ga0207647_10010944 3300025904 Bacteria 6381
240 Ga0207699_10077829 3300025906 Unclassified 2048
241 Ga0207705_10040583 3300025909 Bacteria 3339
242 Ga0207654_10000032 3300025911 Bacteria 120553
243 Ga0207654_10165274 3300025911 Bacteria 1432
244 Ga0207707_10160951 3300025912 Bacteria 1963
245 Ga0207707_10189494 3300025912 Bacteria 1794
246 Ga0207695_10000082 3300025913 Bacteria 284333
247 Ga0207695_10019407 3300025913 Bacteria 7831
248 Ga0207695_10022352 3300025913 Bacteria 7182
249 Ga0207695_10039411 3300025913 Bacteria 5079
250 Ga0207695_10041929 3300025913 Bacteria 4894
251 Ga0207695_10180159 3300025913 Bacteria 2034
252 Ga0207695_10206882 3300025913 Bacteria 1875
253 Ga0207671_10013633 3300025914 Bacteria 6464
254 Ga0207671_10102256 3300025914 Bacteria 2172
255 Ga0207671_10180622 3300025914 Bacteria 1642
256 Ga0207662_10006576 3300025918 Bacteria 6275
257 Ga0207649_10092171 3300025920 Bacteria 1986
258 Ga0207649_10097669 3300025920 Bacteria 1937
259 Ga0207681_10004757 3300025923 Bacteria 8355
260 Ga0207694_10000812 3300025924 Bacteria 27924
261 Ga0207694_10000832 3300025924 Bacteria 27463
262 Ga0207694_10003663 3300025924 Bacteria 12162
263 Ga0207694_10009691 3300025924 Bacteria 7263
264 Ga0207694_10148020 3300025924 Bacteria 1891
265 Ga0207659_10016381 3300025926 Bacteria 4823
266 Ga0207687_10207998 3300025927 Bacteria 1533
267 Ga0207644_10078015 3300025931 Bacteria 2441
268 Ga0207644_10178680 3300025931 Bacteria 1662
269 Ga0207690_10121698 3300025932 Bacteria 1897
270 Ga0207706_10001608 3300025933 Bacteria 22419
271 Ga0207706_10004158 3300025933 Bacteria 13642
272 Ga0207706_10004347 3300025933 Bacteria 13306
273 Ga0207706_10025788 3300025933 Bacteria 5266
274 Ga0207706_10097441 3300025933 Bacteria 2586
275 Ga0207686_10014243 3300025934 Bacteria 4422
276 Ga0207686_10209828 3300025934 Bacteria 1399
277 Ga0207709_10070099 3300025935 Bacteria 2222
278 Ga0207670_10030464 3300025936 Bacteria 3447
279 Ga0207670_10266101 3300025936 Bacteria 1331
280 Ga0207704_10012534 3300025938 Bacteria 4210
281 Ga0207704_10067079 3300025938 Bacteria 2256
282 Ga0207691_10057179 3300025940 Bacteria 3551
283 Ga0207691_10164062 3300025940 Bacteria 1948
284 Ga0207711_10073099 3300025941 Bacteria 2980
285 Ga0207689_10014175 3300025942 Bacteria 6781
286 Ga0207689_10321950 3300025942 Bacteria 1283
287 Ga0207679_10291434 3300025945 Bacteria 1403
288 Ga0207667_10447490 3300025949 Bacteria 1313
289 Ga0207651_10129805 3300025960 Bacteria 1927
290 Ga0207651_10137253 3300025960 Bacteria 1883
291 Ga0207712_10003759 3300025961 Bacteria 9584
292 Ga0207712_10062960 3300025961 Bacteria 2639
293 Ga0207668_10010127 3300025972 Bacteria 5683
294 Ga0207668_10241018 3300025972 Bacteria 1463
295 Ga0207668_10301709 3300025972 Bacteria 1322
296 Ga0207640_10002942 3300025981 Bacteria 9160
297 Ga0207658_10062115 3300025986 Bacteria 2794
298 Ga0207658_10138969 3300025986 Bacteria 1963
299 Ga0207677_10017144 3300026023 Bacteria 4310
300 Ga0207677_10054397 3300026023 Bacteria 2731
301 Ga0207703_10001706 3300026035 Bacteria 19722
302 Ga0207703_10139793 3300026035 Bacteria 2100
303 Ga0207703_10279642 3300026035 Bacteria 1515
304 Ga0207639_10000173 3300026041 Bacteria 50109
305 Ga0207639_10047697 3300026041 Bacteria 3239
306 Ga0207678_10000038 3300026067 Bacteria 101262
307 Ga0207678_10034501 3300026067 Bacteria 4406
308 Ga0207678_10040586 3300026067 Bacteria 4036
309 Ga0207708_10022675 3300026075 Bacteria 4741
310 Ga0207702_10000061 3300026078 Bacteria 125368
311 Ga0207641_10025983 3300026088 Bacteria 4831
312 Ga0207641_10057654 3300026088 Bacteria 3303
313 Ga0207641_10191196 3300026088 Bacteria 1881
314 Ga0207648_10019230 3300026089 Bacteria 6165
315 Ga0207648_10025282 3300026089 Bacteria 5291
316 Ga0207648_10148662 3300026089 Bacteria 2067
317 Ga0207676_10070454 3300026095 Bacteria 2804
318 Ga0207676_10111641 3300026095 Bacteria 2288
319 Ga0207674_10006655 3300026116 Bacteria 13575
320 Ga0207674_10013363 3300026116 Bacteria 9115
321 Ga0207674_10015160 3300026116 Bacteria 8481
322 Ga0207674_10022806 3300026116 Bacteria 6717
323 Ga0207674_10084276 3300026116 Bacteria 3177
324 Ga0207674_10127050 3300026116 Bacteria 2515
325 Ga0207675_100000614 3300026118 Bacteria 34802
326 Ga0207675_100000736 3300026118 Bacteria 32456
327 Ga0207675_100095114 3300026118 Bacteria 2803
328 Ga0207675_100106504 3300026118 Bacteria 2643
329 Ga0207675_100162179 3300026118 Bacteria 2133
330 Ga0207683_10161832 3300026121 Bacteria 2024
331 Ga0207683_10169408 3300026121 Bacteria 1977
332 Ga0207698_10055479 3300026142 Bacteria 3054
333 Ga0207428_10002156 3300027907 Bacteria 19753
334 Ga0207428_10018186 3300027907 Bacteria 6010
335 Ga0207428_10078567 3300027907 Bacteria 2582
336 Ga0265356_1002953 3300028017 Bacteria 2183
337 Ga0265355_1003744 3300028036 Bacteria 1125
338 Ga0268266_10000007 3300028379 Bacteria 1372921
339 Ga0268266_10000796 3300028379 Bacteria 41984
340 Ga0268266_10000890 3300028379 Bacteria 38685
341 Ga0268266_10001872 3300028379 Bacteria 23748
342 Ga0268266_10068644 3300028379 Bacteria 3070
343 Ga0268266_10158720 3300028379 Bacteria 2045
344 Ga0268266_10187776 3300028379 Bacteria 1886
345 Ga0268265_10000547 3300028380 Bacteria 38290
346 Ga0268265_10025331 3300028380 Bacteria 4208
347 Ga0268265_10045506 3300028380 Bacteria 3275
348 Ga0268264_10000176 3300028381 Bacteria 136166
349 Ga0268264_10004326 3300028381 Bacteria 12121
350 Ga0307515_10270587 3300028794 Bacteria 1421
351 Ga0265770_1011066 3300030878 Bacteria 1319
352 Ga0265760_10000405 3300031090 Bacteria 12088
353 Ga0307509_10000003 3300031507 Bacteria 577578
354 Ga0307509_10000021 3300031507 Bacteria 250589
355 Ga0307408_100019644 3300031548 Bacteria 4551
356 Ga0307408_100021968 3300031548 Bacteria 4328
357 Ga0307408_100051994 3300031548 Bacteria 2954
358 Ga0307508_10005849 3300031616 Bacteria 11614
359 Ga0307405_10005713 3300031731 Bacteria 6037
360 Ga0307413_10183726 3300031824 Bacteria 1494
361 Ga0307413_10336716 3300031824 Bacteria 1159
362 Ga0307406_10058025 3300031901 Bacteria 2486
363 Ga0307406_10104578 3300031901 Bacteria 1936
364 Ga0307406_10121945 3300031901 Bacteria 1814
365 Ga0307412_10041499 3300031911 Bacteria 2983
366 Ga0307416_100007495 3300032002 Bacteria 6946
367 Ga0307416_100041648 3300032002 Bacteria 3579
368 Ga0307414_10000242 3300032004 Bacteria 34787
369 Ga0307414_10022597 3300032004 Bacteria 3971
370 Ga0307414_10280657 3300032004 Bacteria 1399
371 Ga0307411_10140496 3300032005 Bacteria 1780
372 Ga0307415_100130236 3300032126 Bacteria 1903
373 Ga0307510_10000002 3300033180 Bacteria 801565
374 Ga0373944_0032432 3300035089 Bacteria 1578
375 Ga0373956_0040630 3300035119 Bacteria 2064
376 Ga0373937_0017549 3300036401 Bacteria 6379
377 Ga0373937_0281564 3300036401 Bacteria 1570
378 Ga0373937_0295818 3300036401 Bacteria 1530
379 Ga0395905_0022952 3300037471 Bacteria 5897
380 Ga0237819_00302 3300038705 Bacteria 18159
381 Ga0237816_00554 3300039145 Bacteria 3167
382 Ga0436360_1257731 3300039438 Bacteria 1377
383 Ga0439448_0021987 3300042005 Bacteria 1979
384 Ga0466959_0018673 3300045049 Bacteria 5092
385 Ga0466959_0036457 3300045049 Bacteria 3634
386 Ga0451576_0606388 3300045051 Bacteria 1151
387 Ga0495627_000060 3300046453 Bacteria 140874
388 Ga0495627_045249 3300046453 Bacteria 1341
389 Ga0495638_0000123 3300046460 Bacteria 125420
390 Ga0495638_0018112 3300046460 Bacteria 4681
391 Ga0495651_0258507 3300046462 Bacteria 1186
392 Ga0495583_0000027 3300046506 Bacteria 256299
393 Ga0495583_0049273 3300046506 Bacteria 1930
394 Ga0495583_0053714 3300046506 Bacteria 1827
395 Ga0495643_0019082 3300046522 Bacteria 3970
396 Ga0495643_0040398 3300046522 Bacteria 2548
397 Ga0495648_0001235 3300046524 Bacteria 25568
398 Ga0495663_0004107 3300046525 Bacteria 4121
399 Ga0495587_0103931 3300046536 Bacteria 1635
400 Ga0495633_0070807 3300046558 Bacteria 1627
401 Ga0495668_0000013 3300046616 Bacteria 452938
402 Ga0495668_0000031 3300046616 Bacteria 256576
403 Ga0495625_0000351 3300046660 Bacteria 70408
404 Ga0495625_0000352 3300046660 Bacteria 70308
405 Ga0495625_0000842 3300046660 Bacteria 41902
406 Ga0495625_0004906 3300046660 Bacteria 12458
407 Ga0495657_0137951 3300046675 Bacteria 1522
408 Ga0495670_0000002 3300046691 Bacteria 601814
409 Ga0495670_0000005 3300046691 Bacteria 289725
410 Ga0495672_0017800 3300047320 Bacteria 4741
411 Ga0495672_0141557 3300047320 Bacteria 1256
412 Ga0495675_0104529 3300047444 Bacteria 1770
413 Ga0495677_0007618 3300047445 Bacteria 4040
414 Ga0495681_0036416 3300047470 Bacteria 2433
415 Ga0496101_0175749 3300048904 Bacteria 1647
416 Ga0496102_0100081 3300048905 Bacteria 2691
417 Ga0496102_0311198 3300048905 Bacteria 1484
418 Ga0496103_0028932 3300048906 Bacteria 3366
419 Ga0496105_0000016 3300048908 Bacteria 212909
420 Ga0496106_0048714 3300048909 Bacteria 3192
421 Ga0496108_0072223 3300048911 Bacteria 2913
422 Ga0496109_0084314 3300048912 Bacteria 2932
423 Ga0496113_0086252 3300048916 Bacteria 2412
424 Ga0496115_0000123 3300048918 Bacteria 70348
425 Ga0496115_0000127 3300048918 Bacteria 68926
426 Ga0496116_0000039 3300048919 Bacteria 349134
427 Ga0496117_0061865 3300048920 Bacteria 2570
428 Ga0496118_0005341 3300048921 Bacteria 14638
429 Ga0496118_0014069 3300048921 Bacteria 7511
430 Ga0496118_0027227 3300048921 Bacteria 4844
431 Ga0496118_0072201 3300048921 Bacteria 2480
432 Ga0496118_0136005 3300048921 Bacteria 1568
433 Ga0496121_0000147 3300048924 Bacteria 154342
434 Ga0496121_0000248 3300048924 Bacteria 114460
435 Ga0496122_0003069 3300048925 Bacteria 22525
436 Ga0496122_0035627 3300048925 Bacteria 4043
437 Ga0496123_0002020 3300048926 Bacteria 26197
438 Ga0496123_0007652 3300048926 Bacteria 10109
439 Ga0496124_0007676 3300048927 Bacteria 11412
440 Ga0496124_0096522 3300048927 Bacteria 2401
441 Ga0496125_0030423 3300048928 Bacteria 4831
442 Ga0496125_0063893 3300048928 Bacteria 2931
443 Ga0496125_0148461 3300048928 Bacteria 1615
444 Ga0496126_0000185 3300048929 Bacteria 140051
445 Ga0496126_0001292 3300048929 Bacteria 40032
446 Ga0496126_0166137 3300048929 Bacteria 1883
447 Ga0501032_0002816 3300049569 Bacteria 13525
448 Ga0501032_0010024 3300049569 Bacteria 6840
449 Ga0501033_0000329 3300049570 Bacteria 45324
450 Ga0501033_0023149 3300049570 Bacteria 4684
451 Ga0501034_0014426 3300049571 Bacteria 8136
452 Ga0501036_0014176 3300049572 Bacteria 6631
453 Ga0501037_0000815 3300049573 Bacteria 23310
454 Ga0501038_0003503 3300049574 Bacteria 14613
455 Ga0501038_0023794 3300049574 Bacteria 5472
456 Ga0501038_0047155 3300049574 Bacteria 3733
457 Ga0501039_0007089 3300049575 Bacteria 8538
458 Ga0501039_0069538 3300049575 Bacteria 2734
459 Ga0501041_0003593 3300049577 Bacteria 8922
460 Ga0501043_0004404 3300049579 Bacteria 11439
461 Ga0501043_0233302 3300049579 Bacteria 1421
462 Ga0501046_0069803 3300049580 Bacteria 2733
463 Ga0501047_0003926 3300049581 Bacteria 13971
464 Ga0501047_0018202 3300049581 Bacteria 6732
465 Ga0501067_0005300 3300049583 Bacteria 7163
466 Ga0501067_0047450 3300049583 Bacteria 2382
467 Ga0501068_0002075 3300049584 Bacteria 10681
468 Ga0501068_0028273 3300049584 Bacteria 3315
469 Ga0501069_0004652 3300049585 Bacteria 7093
470 Ga0501069_0098246 3300049585 Bacteria 1660
471 Ga0501071_0014415 3300049587 Bacteria 5407
472 Ga0501071_0020499 3300049587 Bacteria 4595
473 Ga0501072_0058773 3300049588 Bacteria 3030
474 Ga0501072_0094477 3300049588 Bacteria 2376
475 Ga0501073_0005069 3300049589 Bacteria 9879
476 Ga0501073_0006164 3300049589 Bacteria 8950
477 Ga0501074_0004513 3300049590 Bacteria 9965
478 Ga0501074_0012183 3300049590 Bacteria 6251
479 Ga0501074_0096077 3300049590 Bacteria 2122
480 Ga0501075_0002474 3300049591 Bacteria 12320
481 Ga0501076_0004871 3300049592 Bacteria 9594
482 Ga0501079_0014213 3300049741 Bacteria 6070
483 Ga0501079_0047389 3300049741 Bacteria 3316
484 Ga0501079_0075386 3300049741 Bacteria 2608
485 Ga0501080_0010166 3300049742 Bacteria 8604
486 Ga0501080_0040536 3300049742 Bacteria 4343
487 Ga0501080_0054204 3300049742 Bacteria 3734
488 Ga0501080_0069603 3300049742 Bacteria 3273
489 Ga0501080_0148241 3300049742 Bacteria 2169
490 Ga0501081_0009626 3300049743 Bacteria 6298
491 Ga0501083_0067366 3300049744 Bacteria 2383
492 Ga0501083_0074497 3300049744 Bacteria 2255
493 Ga0501035_0156314 3300049822 Bacteria 1976
494 Ga0501044_0016877 3300049823 Bacteria 7834
495 Ga0501044_0034372 3300049823 Bacteria 5316
496 Ga0501044_0131375 3300049823 Bacteria 2498
497 Ga0501044_0186366 3300049823 Bacteria 2039
498 Ga0501045_0048418 3300049824 Bacteria 3099
499 Ga0501045_0061914 3300049824 Bacteria 2746
500 Ga0501045_0086356 3300049824 Bacteria 2316
501 nmdc:mga05p37_1249_c1 3300050507 Bacteria 29520
502 nmdc:mga05p37_216945_c1 3300050507 Bacteria 2310
503 nmdc:mga05p37_72423_c1 3300050507 Bacteria 4240
504 nmdc:mga05p37_99156_c1 3300050507 Bacteria 3589
505 nmdc:mga09592_131875_c1 3300050508 Bacteria 2151
506 nmdc:mga09592_15383_c1 3300050508 Bacteria 6249
507 nmdc:mga09592_248690_c1 3300050508 Bacteria 1541
508 nmdc:mga09592_619_c1 3300050508 Bacteria 27079
509 nmdc:mga0qj67_2796_c1 3300050509 Bacteria 12520
510 nmdc:mga0qj67_444_c1 3300050509 Bacteria 28230
511 nmdc:mga06r32_155459_c1 3300050510 Bacteria 2268
512 nmdc:mga06r32_1942_c1 3300050510 Bacteria 18424
513 nmdc:mga06r32_233042_c1 3300050510 Bacteria 1829
514 nmdc:mga06r32_450_c1 3300050510 Bacteria 34949
515 nmdc:mga06r32_63_c1 3300050510 Bacteria 68165
516 nmdc:mga08y16_254_c1 3300050511 Bacteria 48008
517 nmdc:mga08y16_261384_c1 3300050511 Bacteria 1787
518 nmdc:mga08y16_381084_c1 3300050511 Bacteria 1446
519 nmdc:mga08y16_55406_c1 3300050511 Bacteria 4143
520 nmdc:mga0n895_331619_c1 3300050512 Bacteria 1541
521 Ga0500643_001692 3300053087 Bacteria 12255
522 Ga0500643_013071 3300053087 Bacteria 2947
523 Ga0500566_0004070 3300053094 Bacteria 8705
524 Ga0500566_0021562 3300053094 Bacteria 3785
525 Ga0500641_0039552 3300053096 Bacteria 1901
526 Ga0500555_000034 3300053103 Bacteria 82796
527 Ga0500555_012142 3300053103 Bacteria 2477
528 Ga0500569_007134 3300053109 Unclassified 2494
529 Ga0500592_006066 3300053116 Bacteria 1924
530 Ga0500626_101768 3300053128 Bacteria 1251
531 Ga0500658_0001214 3300053134 Bacteria 10475
532 Ga0500658_0001253 3300053134 Bacteria 10292
533 Ga0500658_0050600 3300053134 Bacteria 1696
534 Ga0500658_0071297 3300053134 Bacteria 1467
535 Ga0500568_0000179 3300053139 Bacteria 55301
536 Ga0500568_0000884 3300053139 Bacteria 20977
537 Ga0500568_0003290 3300053139 Bacteria 9115
538 Ga0500568_0016680 3300053139 Bacteria 3257
539 Ga0500573_0000010 3300053140 Bacteria 210704
540 Ga0500588_0002054 3300053146 Bacteria 4008
541 Ga0500590_053889 3300053148 Bacteria 2038
542 Ga0500627_0000001 3300053158 Bacteria 251552
543 Ga0500627_0002161 3300053158 Bacteria 5724
544 Ga0501084_0005608 3300054114 Bacteria 10307
545 Ga0501084_0062233 3300054114 Bacteria 3124
546 Ga0501084_0125449 3300054114 Bacteria 2160
547 Ga0501082_0002143 3300060353 Bacteria 17305
548 Ga0501082_0002981 3300060353 Bacteria 14786
549 Ga0501082_0177121 3300060353 Bacteria 1854
550 Ga0530510_0069565 3300061734 Bacteria 2554
551 2512642818 2512564014 Bacteria 4639632
552 2643822570 2643221560 Bacteria 4801179
553 2643832733 2643221563 Bacteria 4726935
554 2643835254 2643221563 Bacteria 4726935
555 2643836496 2643221563 Bacteria 4726935
556 2644038602 2643221605 Bacteria 4772303
557 2644052973 2643221608 Bacteria 4724829
558 2644053472 2643221608 Bacteria 4724829
559 2644056180 2643221608 Bacteria 4724829
560 2644128922 2643221622 Bacteria 4212502
561 2852654768 2852653556 Bacteria 4050083
562 2852683938 2852680915 Bacteria 4100189
563 2882808734 2882806704 Bacteria 3007728
564 8057104913 8057101203 Bacteria 5034064
565 Ga0395901_0119300
566 JGI24740J21852_10000019
567 JGI24739J22299_10006255
568 JGI25150J39212_1000044
569 JGI25406J46586_10003744
570 JGI25153J46596_10000043
571 Ga0055526_1005425
572 Ga0055537_1001605
573 Ga0055536_1000733
574 Ga0055536_1001202
575 Ga0055536_1001466
576 Ga0055536_1001810
577 Ga0055536_1003951
578 Ga0055536_1007638
579 Ga0055536_1015188
580 Ga0055530_10000106
581 Ga0055530_10000164
582 Ga0055530_10000181
583 Ga0055530_10000465
584 Ga0055530_10021805
585 Ga0055530_10023840
586 Ga0055530_10041273
587 Ga0055540_1006239
588 Ga0055531_10000012
589 Ga0055531_10001005
590 Ga0055531_10001314
591 Ga0055531_10004289
592 Ga0055531_10004380
593 Ga0055531_10005744
594 Ga0055531_10006349
595 Ga0055531_10024604
596 Ga0055531_10024606
597 Ga0065165_1007814
598 Ga0065715_10101304
599 Ga0070683_100221658
600 Ga0070690_100052877
601 Ga0070670_100148246
602 Ga0070670_100279037
603 Ga0070666_10001021
604 Ga0070682_100063474
605 Ga0068868_100038055
606 Ga0070689_100005710
607 Ga0070689_100143957
608 Ga0070691_10109888
609 Ga0070687_100020844
610 Ga0070661_100006044
611 Ga0070661_100087735
612 Ga0070661_100111003
613 Ga0070668_100045018
614 Ga0070669_100013818
615 Ga0070669_100144466
616 Ga0070675_100198646
617 Ga0070675_100288289
618 Ga0070667_100099738
619 Ga0070667_100165132
620 Ga0070667_100235003
621 Ga0070714_100230939
622 Ga0070705_100020633
623 Ga0070700_100020690
624 Ga0070663_100000022
625 Ga0070678_100006730
626 Ga0070678_100110169
627 Ga0070662_100002305
628 Ga0070662_100002608
629 Ga0070662_100004914
630 Ga0070662_100070678
631 Ga0070681_10003155
632 Ga0070681_10177753
633 Ga0068867_100016202
634 Ga0068867_100368207
635 Ga0070685_10000152
636 Ga0070685_10001858
637 Ga0070684_100008538
638 Ga0068853_100028737
639 Ga0068853_100032342
640 Ga0068853_100044493
641 Ga0068853_100068560
642 Ga0068853_100316742
643 Ga0070686_100002514
644 Ga0070665_100000928
645 Ga0070665_100004102
646 Ga0070665_100007710
647 Ga0070665_100008614
648 Ga0070665_100009713
649 Ga0070665_100030126
650 Ga0070665_100104488
651 Ga0070665_100105961
652 Ga0068855_100069899
653 Ga0070664_100220201
654 Ga0068857_100022630
655 Ga0068854_100006701
656 Ga0068856_100000041
657 Ga0068856_100015602
658 Ga0070702_100021737
659 Ga0068852_100290638
660 Ga0068859_100002362
661 Ga0068864_100029869
662 Ga0068866_10146072
663 Ga0068861_100000062
664 Ga0068861_100000366
665 Ga0068851_10007007
666 Ga0068870_10018123
667 Ga0068863_100030711
668 Ga0068863_100084928
669 Ga0068863_100246254
670 Ga0068858_100002262
671 Ga0068858_100049301
672 Ga0068860_100006757
673 Ga0068860_100448429
674 Ga0068862_100000722
675 Ga0068862_100276589
676 Ga0081539_10000004
677 Ga0070717_10282795
678 Ga0070716_100121766
679 Ga0070716_100209304
680 Ga0097621_100019694
681 Ga0097621_100024669
682 Ga0097621_100034130
683 Ga0097621_100137657
684 Ga0068871_100051777
685 Ga0075428_100000920
686 Ga0075428_100282823
687 Ga0075430_100004783
688 Ga0075430_100008166
689 Ga0075430_100060288
690 Ga0075430_100141229
691 Ga0075431_100000221
692 Ga0075431_100000267
693 Ga0075431_100003861
694 Ga0075434_100213628
695 Ga0075429_100003103
696 Ga0068865_100023649
697 Ga0097620_100002362
698 Ga0079104_1018097
699 Ga0105240_10010664
700 Ga0105240_10016387
701 Ga0105240_10067374
702 Ga0105240_10069692
703 Ga0105240_10175389
704 Ga0111539_10000989
705 Ga0111539_10007571
706 Ga0111539_10025836
707 Ga0111539_10127795
708 Ga0111539_10401226
709 Ga0105245_10078920
710 Ga0105245_10153917
711 Ga0105247_10059784
712 Ga0114129_10003655
713 Ga0114129_10079198
714 Ga0114129_10247926
715 Ga0105242_10016940
716 Ga0105248_10037039
717 Ga0105237_10005186
718 Ga0105237_10037935
719 Ga0105237_10073498
720 Ga0105237_10109291
721 Ga0105237_10291681
722 Ga0105238_10000192
723 Ga0105238_10004676
724 Ga0105238_10025058
725 Ga0105238_10069026
726 Ga0105238_10085639
727 Ga0105238_10144200
728 Ga0105238_10179831
729 Ga0105238_10567708
730 Ga0105249_10001944
731 Ga0105249_10018875
732 Ga0105249_10029931
733 Ga0105249_10041664
734 Ga0105239_10029287
735 Ga0157373_10000046
736 Ga0157370_10000071
737 Ga0157369_10011583
738 Ga0163162_10000004
739 Ga0163162_10023244
740 Ga0163162_10298450
741 Ga0163162_10369090
742 Ga0157372_10529003
743 Ga0157375_10001172
744 Ga0157375_10030306
745 Ga0157375_10137437
746 Ga0157375_10206807
747 Ga0163163_10004078
748 Ga0157380_10053565
749 Ga0182008_10110260
750 Ga0157377_10003544
751 Ga0157379_10033075
752 Ga0157379_10100880
753 Ga0157379_10179162
754 Ga0157376_10032388
755 Ga0157376_10033821
756 Ga0163161_10064637
757 Ga0207425_1000047
758 Ga0209129_1000497
759 Ga0209565_1000089
760 Ga0209675_1000183
761 Ga0209675_1000202
762 Ga0209675_1000384
763 Ga0209676_1000155
764 Ga0209676_1000234
765 Ga0209676_1000384
766 Ga0209676_1000475
767 Ga0209676_1000693
768 Ga0209676_1004605
769 Ga0209676_1004674
770 Ga0209676_1007388
771 Ga0209025_1000150
772 Ga0209025_1007902
773 Ga0209025_1020691
774 Ga0209025_1054244
775 Ga0209564_1001696
776 Ga0209758_1000009
777 Ga0209758_1023933
778 Ga0209050_1000005
779 Ga0209050_1000039
780 Ga0209050_1000112
781 Ga0209050_1000132
782 Ga0209050_1000776
783 Ga0209050_1007994
784 Ga0209050_1008503
785 Ga0209050_1015174
786 Ga0209050_1032064
787 Ga0209051_1000396
788 Ga0209051_1004840
789 Ga0209257_1000051
790 Ga0209257_1000176
791 Ga0209257_1000337
792 Ga0209257_1000523
793 Ga0209257_1000600
794 Ga0209257_1001283
795 Ga0209257_1001567
796 Ga0209257_1001840
797 Ga0209257_1004585
798 Ga0209257_1015830
799 Ga0207656_10068433
800 Ga0207656_10090192
801 Ga0207688_10024861
802 Ga0207680_10098946
803 Ga0207647_10010944
804 Ga0207699_10077829
805 Ga0207705_10040583
806 Ga0207654_10000032
807 Ga0207654_10165274
808 Ga0207707_10160951
809 Ga0207707_10189494
810 Ga0207695_10000082
811 Ga0207695_10019407
812 Ga0207695_10022352
813 Ga0207695_10039411
814 Ga0207695_10041929
815 Ga0207695_10180159
816 Ga0207695_10206882
817 Ga0207671_10013633
818 Ga0207671_10102256
819 Ga0207671_10180622
820 Ga0207662_10006576
821 Ga0207649_10092171
822 Ga0207649_10097669
823 Ga0207681_10004757
824 Ga0207694_10000812
825 Ga0207694_10000832
826 Ga0207694_10003663
827 Ga0207694_10009691
828 Ga0207694_10148020
829 Ga0207659_10016381
830 Ga0207687_10207998
831 Ga0207644_10078015
832 Ga0207644_10178680
833 Ga0207690_10121698
834 Ga0207706_10001608
835 Ga0207706_10004158
836 Ga0207706_10004347
837 Ga0207706_10025788
838 Ga0207706_10097441
839 Ga0207686_10014243
840 Ga0207686_10209828
841 Ga0207709_10070099
842 Ga0207670_10030464
843 Ga0207670_10266101
844 Ga0207704_10012534
845 Ga0207704_10067079
846 Ga0207691_10057179
847 Ga0207691_10164062
848 Ga0207711_10073099
849 Ga0207689_10014175
850 Ga0207689_10321950
851 Ga0207679_10291434
852 Ga0207667_10447490
853 Ga0207651_10129805
854 Ga0207651_10137253
855 Ga0207712_10003759
856 Ga0207712_10062960
857 Ga0207668_10010127
858 Ga0207668_10241018
859 Ga0207668_10301709
860 Ga0207640_10002942
861 Ga0207658_10062115
862 Ga0207658_10138969
863 Ga0207677_10017144
864 Ga0207677_10054397
865 Ga0207703_10001706
866 Ga0207703_10139793
867 Ga0207703_10279642
868 Ga0207639_10000173
869 Ga0207639_10047697
870 Ga0207678_10000038
871 Ga0207678_10034501
872 Ga0207678_10040586
873 Ga0207708_10022675
874 Ga0207702_10000061
875 Ga0207641_10025983
876 Ga0207641_10057654
877 Ga0207641_10191196
878 Ga0207648_10019230
879 Ga0207648_10025282
880 Ga0207648_10148662
881 Ga0207676_10070454
882 Ga0207676_10111641
883 Ga0207674_10006655
884 Ga0207674_10013363
885 Ga0207674_10015160
886 Ga0207674_10022806
887 Ga0207674_10084276
888 Ga0207674_10127050
889 Ga0207675_100000614
890 Ga0207675_100000736
891 Ga0207675_100095114
892 Ga0207675_100106504
893 Ga0207675_100162179
894 Ga0207683_10161832
895 Ga0207683_10169408
896 Ga0207698_10055479
897 Ga0207428_10002156
898 Ga0207428_10018186
899 Ga0207428_10078567
900 Ga0265356_1002953
901 Ga0265355_1003744
902 Ga0268266_10000007
903 Ga0268266_10000796
904 Ga0268266_10000890
905 Ga0268266_10001872
906 Ga0268266_10068644
907 Ga0268266_10158720
908 Ga0268266_10187776
909 Ga0268265_10000547
910 Ga0268265_10025331
911 Ga0268265_10045506
912 Ga0268264_10000176
913 Ga0268264_10004326
914 Ga0307515_10270587
915 Ga0265770_1011066
916 Ga0265760_10000405
917 Ga0307509_10000003
918 Ga0307509_10000021
919 Ga0307408_100019644
920 Ga0307408_100021968
921 Ga0307408_100051994
922 Ga0307508_10005849
923 Ga0307405_10005713
924 Ga0307413_10183726
925 Ga0307413_10336716
926 Ga0307406_10058025
927 Ga0307406_10104578
928 Ga0307406_10121945
929 Ga0307412_10041499
930 Ga0307416_100007495
931 Ga0307416_100041648
932 Ga0307414_10000242
933 Ga0307414_10022597
934 Ga0307414_10280657
935 Ga0307411_10140496
936 Ga0307415_100130236
937 Ga0307510_10000002
938 Ga0373944_0032432
939 Ga0373956_0040630
940 Ga0373937_0017549
941 Ga0373937_0281564
942 Ga0373937_0295818
943 Ga0395905_0022952
944 Ga0237819_00302
945 Ga0237816_00554
946 Ga0436360_1257731
947 Ga0439448_0021987
948 Ga0466959_0018673
949 Ga0466959_0036457
950 Ga0451576_0606388
951 Ga0495627_000060
952 Ga0495627_045249
953 Ga0495638_0000123
954 Ga0495638_0018112
955 Ga0495651_0258507
956 Ga0495583_0000027
957 Ga0495583_0049273
958 Ga0495583_0053714
959 Ga0495643_0019082
960 Ga0495643_0040398
961 Ga0495648_0001235
962 Ga0495663_0004107
963 Ga0495587_0103931
964 Ga0495633_0070807
965 Ga0495668_0000013
966 Ga0495668_0000031
967 Ga0495625_0000351
968 Ga0495625_0000352
969 Ga0495625_0000842
970 Ga0495625_0004906
971 Ga0495657_0137951
972 Ga0495670_0000002
973 Ga0495670_0000005
974 Ga0495672_0017800
975 Ga0495672_0141557
976 Ga0495675_0104529
977 Ga0495677_0007618
978 Ga0495681_0036416
979 Ga0496101_0175749
980 Ga0496102_0100081
981 Ga0496102_0311198
982 Ga0496103_0028932
983 Ga0496105_0000016
984 Ga0496106_0048714
985 Ga0496108_0072223
986 Ga0496109_0084314
987 Ga0496113_0086252
988 Ga0496115_0000123
989 Ga0496115_0000127
990 Ga0496116_0000039
991 Ga0496117_0061865
992 Ga0496118_0005341
993 Ga0496118_0014069
994 Ga0496118_0027227
995 Ga0496118_0072201
996 Ga0496118_0136005
997 Ga0496121_0000147
998 Ga0496121_0000248
999 Ga0496122_0003069
1000 Ga0496122_0035627
1001 Ga0496123_0002020
1002 Ga0496123_0007652
1003 Ga0496124_0007676
1004 Ga0496124_0096522
1005 Ga0496125_0030423
1006 Ga0496125_0063893
1007 Ga0496125_0148461
1008 Ga0496126_0000185
1009 Ga0496126_0001292
1010 Ga0496126_0166137
1011 Ga0501032_0002816
1012 Ga0501032_0010024
1013 Ga0501033_0000329
1014 Ga0501033_0023149
1015 Ga0501034_0014426
1016 Ga0501036_0014176
1017 Ga0501037_0000815
1018 Ga0501038_0003503
1019 Ga0501038_0023794
1020 Ga0501038_0047155
1021 Ga0501039_0007089
1022 Ga0501039_0069538
1023 Ga0501041_0003593
1024 Ga0501043_0004404
1025 Ga0501043_0233302
1026 Ga0501046_0069803
1027 Ga0501047_0003926
1028 Ga0501047_0018202
1029 Ga0501067_0005300
1030 Ga0501067_0047450
1031 Ga0501068_0002075
1032 Ga0501068_0028273
1033 Ga0501069_0004652
1034 Ga0501069_0098246
1035 Ga0501071_0014415
1036 Ga0501071_0020499
1037 Ga0501072_0058773
1038 Ga0501072_0094477
1039 Ga0501073_0005069
1040 Ga0501073_0006164
1041 Ga0501074_0004513
1042 Ga0501074_0012183
1043 Ga0501074_0096077
1044 Ga0501075_0002474
1045 Ga0501076_0004871
1046 Ga0501079_0014213
1047 Ga0501079_0047389
1048 Ga0501079_0075386
1049 Ga0501080_0010166
1050 Ga0501080_0040536
1051 Ga0501080_0054204
1052 Ga0501080_0069603
1053 Ga0501080_0148241
1054 Ga0501081_0009626
1055 Ga0501083_0067366
1056 Ga0501083_0074497
1057 Ga0501035_0156314
1058 Ga0501044_0016877
1059 Ga0501044_0034372
1060 Ga0501044_0131375
1061 Ga0501044_0186366
1062 Ga0501045_0048418
1063 Ga0501045_0061914
1064 Ga0501045_0086356
1065 nmdc:mga05p37_1249_c1
1066 nmdc:mga05p37_216945_c1
1067 nmdc:mga05p37_72423_c1
1068 nmdc:mga05p37_99156_c1
1069 nmdc:mga09592_131875_c1
1070 nmdc:mga09592_15383_c1
1071 nmdc:mga09592_248690_c1
1072 nmdc:mga09592_619_c1
1073 nmdc:mga0qj67_2796_c1
1074 nmdc:mga0qj67_444_c1
1075 nmdc:mga06r32_155459_c1
1076 nmdc:mga06r32_1942_c1
1077 nmdc:mga06r32_233042_c1
1078 nmdc:mga06r32_450_c1
1079 nmdc:mga06r32_63_c1
1080 nmdc:mga08y16_254_c1
1081 nmdc:mga08y16_261384_c1
1082 nmdc:mga08y16_381084_c1
1083 nmdc:mga08y16_55406_c1
1084 nmdc:mga0n895_331619_c1
1085 Ga0500643_001692
1086 Ga0500643_013071
1087 Ga0500566_0004070
1088 Ga0500566_0021562
1089 Ga0500641_0039552
1090 Ga0500555_000034
1091 Ga0500555_012142
1092 Ga0500569_007134
1093 Ga0500592_006066
1094 Ga0500626_101768
1095 Ga0500658_0001214
1096 Ga0500658_0001253
1097 Ga0500658_0050600
1098 Ga0500658_0071297
1099 Ga0500568_0000179
1100 Ga0500568_0000884
1101 Ga0500568_0003290
1102 Ga0500568_0016680
1103 Ga0500573_0000010
1104 Ga0500588_0002054
1105 Ga0500590_053889
1106 Ga0500627_0000001
1107 Ga0500627_0002161
1108 Ga0501084_0005608
1109 Ga0501084_0062233
1110 Ga0501084_0125449
1111 Ga0501082_0002143
1112 Ga0501082_0002981
1113 Ga0501082_0177121
1114 Ga0530510_0069565
1115 2512642818
1116 2643822570
1117 2643832733
1118 2643835254
1119 2643836496
1120 2644038602
1121 2644052973
1122 2644053472
1123 2644056180
1124 2644128922
1125 2852654768
1126 2852683938
1127 2882808734
1128 8057104913

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07755

DUF1611

Domain of unknown function (DUF1611_C) P-loop domain

179

379

0.97

PF17396

DUF1611_N

Domain of unknown function (DUF1611_N) Rossmann-like domain

81

174

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrj-assembly1.cif.gz_A crystal structure of n-acetyltransferase dgcn-25328 0.9588 11 341
7xrj-assembly1.cif.gz_A crystal structure of n-acetyltransferase dgcn-25328 0.9504 11 341
2obn-assembly1.cif.gz_B crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution 0.839 12 339
2obn-assembly1.cif.gz_A crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution 0.8213 12 339
2obn-assembly2.cif.gz_C crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution 0.8157 11 339
ID Description Score Start End Superfamily
2obnD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.906 132 341 3.40.50.300
2obnD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8977 132 341 3.40.50.300
2g0tB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.824 136 338 3.40.50.300
2g0tB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.812 136 338 3.40.50.300
af_Q4DA36_188_506_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7659 145 179 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A258BV82-F1-model_v4 EBNA-1 nuclear protein 0.9935 206 341
AF-A0A4V2BKK6-F1-model_v4 DUF1611 domain-containing protein 0.9917 118 341
AF-A0A1H1BVK5-F1-model_v4 Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase family 0.9912 7 341
AF-A0A349Z5P4-F1-model_v4 DUF1611 domain-containing protein 0.9896 151 266
AF-A0A4V1SCZ4-F1-model_v4 TonB-dependent receptor 0.9889 5 341 GO:0006826
GO:0009279

Map