F464533

General Info

Members Datasets Scaffolds Average Seq Length
567 188 1134 293

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0039451|Ga0466969_0039451_779_1666
Length 286
Sequence MTAKLIDGKAAAAEVREQVATAAASFRTATGRAPGLAVVLVGEHPPSAAYVRMKIKATLEAGMESFEHRIPAETSQQDLLALIDRLNADETVDGILVQLPLPRHVDEQAILTGFHPINVGRLSIGLDSLVPCTPLGCLVLLQRELGDLSGKDAIVIGRSNIVGKPMAQLLLGANCTVTVAHSRSRDLASLTRRADIVVAAVGRPELVRGSWLKPGATVIDVGQERVEQPDGSRKLLGDVAFDEAMEVAGAITPVPGGVGPMTIAMLLRNTVVAAHRRMGLPDPEGL

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
187 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
188 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.18
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.35
Rhizoplane 3
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0039451 3300044656 Bacteria 2371
2 MBSR1b_contig_8754477 2162886012 Bacteria 1833
3 JGI24736J21556_1004038 3300001904 Bacteria 2525
4 JGI24740J21852_10000089 3300001979 Bacteria 31515
5 JGI24739J22299_10000097 3300001989 Bacteria 25965
6 JGI24737J22298_10000037 3300001990 Bacteria 37991
7 JGI24737J22298_10000930 3300001990 Bacteria 10388
8 JGI24737J22298_10033425 3300001990 Bacteria 1597
9 JGI24743J22301_10002872 3300001991 Bacteria 2655
10 JGI24735J21928_10004142 3300002067 Bacteria 4898
11 JGI24735J21928_10037844 3300002067 Bacteria 1413
12 JGI24738J21930_10000023 3300002075 Bacteria 29088
13 Ga0065715_10095614 3300005293 Bacteria 4044
14 Ga0070658_10000377 3300005327 Bacteria 38853
15 Ga0070658_10020877 3300005327 Bacteria 5247
16 Ga0070658_10091831 3300005327 Bacteria 2502
17 Ga0070658_10109501 3300005327 Bacteria 2287
18 Ga0070658_10116380 3300005327 Bacteria 2218
19 Ga0070658_10119188 3300005327 Bacteria 2192
20 Ga0070658_10306175 3300005327 Bacteria 1355
21 Ga0070676_10104483 3300005328 Bacteria 1755
22 Ga0070683_100001819 3300005329 Bacteria 16631
23 Ga0070683_100039504 3300005329 Bacteria 4332
24 Ga0070683_100228118 3300005329 Bacteria 1770
25 Ga0070670_100003109 3300005331 Bacteria 13741
26 Ga0070670_100003400 3300005331 Bacteria 13192
27 Ga0070670_100042597 3300005331 Bacteria 3903
28 Ga0070670_100159246 3300005331 Bacteria 1956
29 Ga0070670_100177227 3300005331 Bacteria 1850
30 Ga0070670_100395907 3300005331 Bacteria 1219
31 Ga0070677_10008918 3300005333 Bacteria 3388
32 Ga0070677_10047425 3300005333 Bacteria 1722
33 Ga0070666_10000779 3300005335 Bacteria 19305
34 Ga0070666_10005953 3300005335 Bacteria 7486
35 Ga0070666_10024629 3300005335 Bacteria 3922
36 Ga0070666_10065966 3300005335 Bacteria 2456
37 Ga0070682_100006873 3300005337 Bacteria 6393
38 Ga0068868_100000259 3300005338 Bacteria 36003
39 Ga0068868_100015245 3300005338 Bacteria 5681
40 Ga0068868_100048166 3300005338 Bacteria 3343
41 Ga0068868_100061889 3300005338 Bacteria 2966
42 Ga0070660_100000986 3300005339 Bacteria 19065
43 Ga0070660_100058544 3300005339 Bacteria 2986
44 Ga0070660_100081729 3300005339 Bacteria 2537
45 Ga0070660_100171964 3300005339 Bacteria 1750
46 Ga0070689_100028985 3300005340 Bacteria 4187
47 Ga0070689_100158173 3300005340 Bacteria 1830
48 Ga0070661_100000187 3300005344 Bacteria 51095
49 Ga0070661_100004695 3300005344 Bacteria 9409
50 Ga0070661_100011962 3300005344 Bacteria 6062
51 Ga0070661_100072913 3300005344 Bacteria 2527
52 Ga0070661_100165569 3300005344 Bacteria 1676
53 Ga0070661_100209843 3300005344 Bacteria 1490
54 Ga0070661_100224334 3300005344 Bacteria 1442
55 Ga0070692_10034116 3300005345 Bacteria 2568
56 Ga0070692_10057624 3300005345 Bacteria 2038
57 Ga0070668_100035371 3300005347 Bacteria 3809
58 Ga0070669_100000174 3300005353 Bacteria 56290
59 Ga0070669_100033518 3300005353 Bacteria 3715
60 Ga0070669_100131253 3300005353 Bacteria 1922
61 Ga0070669_100164872 3300005353 Bacteria 1724
62 Ga0070675_100002370 3300005354 Bacteria 14027
63 Ga0070675_100010543 3300005354 Bacteria 7221
64 Ga0070675_100023558 3300005354 Bacteria 4925
65 Ga0070675_100102492 3300005354 Bacteria 2411
66 Ga0070671_100001282 3300005355 Bacteria 18862
67 Ga0070671_100029886 3300005355 Bacteria 4495
68 Ga0070671_100054381 3300005355 Bacteria 3329
69 Ga0070671_100128547 3300005355 Bacteria 2133
70 Ga0070674_100007200 3300005356 Bacteria 6548
71 Ga0070674_100161329 3300005356 Bacteria 1701
72 Ga0070674_100168299 3300005356 Bacteria 1669
73 Ga0070673_100000337 3300005364 Bacteria 24629
74 Ga0070673_100010120 3300005364 Bacteria 6367
75 Ga0070673_100011602 3300005364 Bacteria 6020
76 Ga0070673_100011732 3300005364 Bacteria 5992
77 Ga0070673_100031597 3300005364 Bacteria 3976
78 Ga0070659_100000191 3300005366 Bacteria 47035
79 Ga0070659_100000674 3300005366 Bacteria 24835
80 Ga0070659_100028122 3300005366 Bacteria 4339
81 Ga0070659_100039493 3300005366 Bacteria 3685
82 Ga0070659_100052281 3300005366 Bacteria 3213
83 Ga0070659_100141643 3300005366 Bacteria 1958
84 Ga0070659_100183630 3300005366 Bacteria 1717
85 Ga0070659_100209052 3300005366 Bacteria 1608
86 Ga0070659_100212634 3300005366 Bacteria 1594
87 Ga0070667_100001311 3300005367 Bacteria 22374
88 Ga0070667_100003559 3300005367 Bacteria 13269
89 Ga0070667_100011671 3300005367 Bacteria 7263
90 Ga0070667_100104177 3300005367 Bacteria 2454
91 Ga0070667_100263107 3300005367 Bacteria 1545
92 Ga0070667_100300977 3300005367 Bacteria 1444
93 Ga0070714_100055739 3300005435 Bacteria 3379
94 Ga0070714_100065718 3300005435 Bacteria 3124
95 Ga0070663_100000754 3300005455 Bacteria 17546
96 Ga0070663_100029193 3300005455 Bacteria 3765
97 Ga0070663_100077044 3300005455 Bacteria 2440
98 Ga0070663_100108487 3300005455 Bacteria 2082
99 Ga0070663_100110707 3300005455 Bacteria 2063
100 Ga0070663_100128264 3300005455 Bacteria 1923
101 Ga0070678_100034382 3300005456 Bacteria 3529
102 Ga0070662_100000012 3300005457 Bacteria 129380
103 Ga0070662_100001658 3300005457 Bacteria 13697
104 Ga0070662_100004211 3300005457 Bacteria 9062
105 Ga0070662_100005641 3300005457 Bacteria 8004
106 Ga0070662_100007787 3300005457 Bacteria 6960
107 Ga0070662_100122185 3300005457 Bacteria 1997
108 Ga0070662_100222646 3300005457 Bacteria 1506
109 Ga0068867_100006572 3300005459 Bacteria 8214
110 Ga0068867_100008577 3300005459 Bacteria 7215
111 Ga0068867_100214457 3300005459 Bacteria 1548
112 Ga0070685_10068101 3300005466 Bacteria 2102
113 Ga0070679_100162601 3300005530 Bacteria 2206
114 Ga0070679_100522698 3300005530 Bacteria 1131
115 Ga0070684_100003278 3300005535 Bacteria 12122
116 Ga0070684_100009174 3300005535 Bacteria 7780
117 Ga0070684_100107569 3300005535 Bacteria 2498
118 Ga0068853_100000032 3300005539 Bacteria 114306
119 Ga0068853_100000811 3300005539 Bacteria 21781
120 Ga0068853_100311023 3300005539 Bacteria 1458
121 Ga0070672_100000945 3300005543 Bacteria 17467
122 Ga0070672_100004830 3300005543 Bacteria 8857
123 Ga0070672_100015335 3300005543 Bacteria 5454
124 Ga0070686_100032521 3300005544 Bacteria 3199
125 Ga0070693_100000332 3300005547 Bacteria 21624
126 Ga0070665_100013547 3300005548 Bacteria 8203
127 Ga0070665_100021059 3300005548 Bacteria 6556
128 Ga0070665_100031747 3300005548 Bacteria 5316
129 Ga0070665_100104758 3300005548 Bacteria 2831
130 Ga0068855_100000591 3300005563 Bacteria 44412
131 Ga0068855_100003900 3300005563 Bacteria 18212
132 Ga0070664_100000187 3300005564 Bacteria 43750
133 Ga0070664_100001469 3300005564 Bacteria 18785
134 Ga0070664_100012642 3300005564 Bacteria 6872
135 Ga0070664_100039187 3300005564 Bacteria 3992
136 Ga0070664_100159072 3300005564 Bacteria 1997
137 Ga0070664_100229423 3300005564 Bacteria 1664
138 Ga0070664_100321093 3300005564 Bacteria 1403
139 Ga0068857_100004021 3300005577 Bacteria 12383
140 Ga0068857_100034073 3300005577 Bacteria 4505
141 Ga0068857_100078693 3300005577 Bacteria 2943
142 Ga0068854_100000664 3300005578 Bacteria 20511
143 Ga0068854_100025831 3300005578 Bacteria 4031
144 Ga0068854_100491376 3300005578 Bacteria 1032
145 Ga0068856_100000291 3300005614 Bacteria 54890
146 Ga0068856_100013426 3300005614 Bacteria 7930
147 Ga0068856_100100639 3300005614 Bacteria 2882
148 Ga0068856_100124219 3300005614 Bacteria 2583
149 Ga0068856_100156559 3300005614 Bacteria 2288
150 Ga0068852_100000906 3300005616 Bacteria 19629
151 Ga0068852_100102337 3300005616 Bacteria 2588
152 Ga0068852_100104429 3300005616 Bacteria 2564
153 Ga0068852_100141397 3300005616 Bacteria 2228
154 Ga0068852_100325452 3300005616 Bacteria 1494
155 Ga0068859_100002786 3300005617 Bacteria 17711
156 Ga0068864_100002633 3300005618 Bacteria 14809
157 Ga0068864_100224571 3300005618 Bacteria 1734
158 Ga0068866_10098458 3300005718 Bacteria 1608
159 Ga0068861_100027898 3300005719 Bacteria 4117
160 Ga0068861_100264410 3300005719 Bacteria 1474
161 Ga0068851_10022469 3300005834 Bacteria 3073
162 Ga0068851_10042459 3300005834 Bacteria 2289
163 Ga0068863_100002317 3300005841 Bacteria 18934
164 Ga0068858_100000620 3300005842 Bacteria 36979
165 Ga0068858_100009881 3300005842 Bacteria 9065
166 Ga0068860_100003524 3300005843 Bacteria 16093
167 Ga0097620_100002786 3300006931 Bacteria 17711
168 Ga0105240_10048201 3300009093 Bacteria 5386
169 Ga0105240_10152373 3300009093 Bacteria 2752
170 Ga0105240_10221098 3300009093 Bacteria 2206
171 Ga0105240_10481935 3300009093 Bacteria 1383
172 Ga0105245_10000229 3300009098 Bacteria 53255
173 Ga0105245_10023282 3300009098 Bacteria 5437
174 Ga0105245_10198795 3300009098 Bacteria 1924
175 Ga0105247_10237929 3300009101 Bacteria 1239
176 Ga0105243_10030827 3300009148 Bacteria 4132
177 Ga0105241_10109553 3300009174 Bacteria 2208
178 Ga0105241_10236893 3300009174 Bacteria 1541
179 Ga0105248_10000083 3300009177 Bacteria 110619
180 Ga0105248_10000790 3300009177 Bacteria 35522
181 Ga0105248_10001634 3300009177 Bacteria 24926
182 Ga0105248_10003127 3300009177 Bacteria 18320
183 Ga0105248_10011959 3300009177 Bacteria 9570
184 Ga0105248_10023944 3300009177 Bacteria 6787
185 Ga0105248_10254978 3300009177 Bacteria 1975
186 Ga0105238_10024793 3300009551 Bacteria 6113
187 Ga0105239_10221754 3300010375 Bacteria 2120
188 Ga0105246_10006237 3300011119 Bacteria 7278
189 Ga0157373_10071086 3300013100 Bacteria 2458
190 Ga0157373_10087945 3300013100 Bacteria 2189
191 Ga0157373_10089370 3300013100 Bacteria 2169
192 Ga0157373_10100314 3300013100 Bacteria 2037
193 Ga0157373_10169372 3300013100 Bacteria 1537
194 Ga0157371_10000756 3300013102 Bacteria 37389
195 Ga0157371_10009514 3300013102 Bacteria 7642
196 Ga0157371_10024460 3300013102 Bacteria 4410
197 Ga0157371_10070421 3300013102 Bacteria 2476
198 Ga0157371_10347565 3300013102 Bacteria 1079
199 Ga0157370_10150712 3300013104 Bacteria 2164
200 Ga0157369_10000137 3300013105 Bacteria 103542
201 Ga0157369_10007204 3300013105 Bacteria 12816
202 Ga0157369_10019245 3300013105 Bacteria 7638
203 Ga0157369_10042284 3300013105 Bacteria 4972
204 Ga0157369_10049779 3300013105 Bacteria 4540
205 Ga0157369_10084813 3300013105 Bacteria 3385
206 Ga0157369_10224048 3300013105 Bacteria 1967
207 Ga0157374_10019076 3300013296 Bacteria 6068
208 Ga0157374_10090171 3300013296 Bacteria 2922
209 Ga0157374_10219149 3300013296 Bacteria 1867
210 Ga0157374_10505694 3300013296 Bacteria 1213
211 Ga0157378_10000154 3300013297 Bacteria 64986
212 Ga0157378_10191875 3300013297 Bacteria 1927
213 Ga0163162_10023881 3300013306 Bacteria 6034
214 Ga0157372_10379691 3300013307 Bacteria 1647
215 Ga0157372_10454013 3300013307 Bacteria 1493
216 Ga0157375_10020583 3300013308 Bacteria 6030
217 Ga0157375_10200197 3300013308 Bacteria 2153
218 Ga0157375_10403985 3300013308 Bacteria 1533
219 Ga0163163_10001064 3300014325 Bacteria 23319
220 Ga0182008_10222246 3300014497 Bacteria 966
221 Ga0157376_10090404 3300014969 Bacteria 2649
222 Ga0206353_11586731 3300020082 Bacteria 976
223 Ga0213875_10020399 3300021388 Bacteria 3179
224 Ga0207673_1007899 3300025290 Bacteria 1341
225 Ga0207697_10000187 3300025315 Bacteria 32396
226 Ga0207656_10001253 3300025321 Bacteria 8367
227 Ga0207656_10054507 3300025321 Bacteria 1738
228 Ga0207682_10059230 3300025893 Bacteria 1600
229 Ga0207688_10000595 3300025901 Bacteria 17763
230 Ga0207688_10022437 3300025901 Bacteria 3454
231 Ga0207680_10002585 3300025903 Bacteria 8443
232 Ga0207680_10068629 3300025903 Bacteria 2188
233 Ga0207680_10134016 3300025903 Bacteria 1635
234 Ga0207647_10000090 3300025904 Bacteria 69395
235 Ga0207647_10012986 3300025904 Bacteria 5785
236 Ga0207647_10028131 3300025904 Bacteria 3656
237 Ga0207647_10047898 3300025904 Bacteria 2656
238 Ga0207645_10012721 3300025907 Bacteria 5706
239 Ga0207645_10031056 3300025907 Bacteria 3439
240 Ga0207645_10096039 3300025907 Bacteria 1909
241 Ga0207705_10000030 3300025909 Bacteria 239341
242 Ga0207705_10000072 3300025909 Bacteria 126043
243 Ga0207705_10010411 3300025909 Bacteria 6760
244 Ga0207705_10011473 3300025909 Bacteria 6412
245 Ga0207705_10023019 3300025909 Bacteria 4443
246 Ga0207705_10031771 3300025909 Bacteria 3770
247 Ga0207705_10095609 3300025909 Bacteria 2180
248 Ga0207705_10175862 3300025909 Bacteria 1613
249 Ga0207705_10197535 3300025909 Bacteria 1523
250 Ga0207695_10014730 3300025913 Bacteria 9246
251 Ga0207695_10036058 3300025913 Bacteria 5351
252 Ga0207695_10157091 3300025913 Bacteria 2208
253 Ga0207657_10000176 3300025919 Bacteria 65856
254 Ga0207657_10002682 3300025919 Bacteria 19192
255 Ga0207657_10007866 3300025919 Bacteria 10882
256 Ga0207657_10014374 3300025919 Bacteria 7730
257 Ga0207657_10014766 3300025919 Bacteria 7605
258 Ga0207657_10018127 3300025919 Bacteria 6735
259 Ga0207657_10020297 3300025919 Bacteria 6284
260 Ga0207657_10140627 3300025919 Bacteria 1972
261 Ga0207649_10000810 3300025920 Bacteria 20093
262 Ga0207649_10004374 3300025920 Bacteria 7667
263 Ga0207649_10006147 3300025920 Bacteria 6518
264 Ga0207649_10016042 3300025920 Bacteria 4218
265 Ga0207649_10046477 3300025920 Bacteria 2667
266 Ga0207649_10068215 3300025920 Bacteria 2260
267 Ga0207649_10075884 3300025920 Bacteria 2161
268 Ga0207649_10083466 3300025920 Bacteria 2074
269 Ga0207652_10003111 3300025921 Bacteria 13832
270 Ga0207681_10005702 3300025923 Bacteria 7642
271 Ga0207681_10146085 3300025923 Bacteria 1767
272 Ga0207681_10167103 3300025923 Bacteria 1664
273 Ga0207694_10036262 3300025924 Bacteria 3784
274 Ga0207650_10005079 3300025925 Bacteria 8983
275 Ga0207650_10016751 3300025925 Bacteria 5125
276 Ga0207650_10034652 3300025925 Bacteria 3662
277 Ga0207650_10059964 3300025925 Bacteria 2838
278 Ga0207650_10251182 3300025925 Bacteria 1432
279 Ga0207659_10007264 3300025926 Bacteria 6805
280 Ga0207659_10012137 3300025926 Bacteria 5465
281 Ga0207659_10138795 3300025926 Bacteria 1885
282 Ga0207659_10174596 3300025926 Bacteria 1697
283 Ga0207687_10001063 3300025927 Bacteria 18628
284 Ga0207687_10012657 3300025927 Bacteria 5512
285 Ga0207664_10079535 3300025929 Bacteria 2662
286 Ga0207664_10184904 3300025929 Bacteria 1791
287 Ga0207644_10005196 3300025931 Bacteria 8507
288 Ga0207644_10015754 3300025931 Bacteria 5080
289 Ga0207644_10018835 3300025931 Bacteria 4677
290 Ga0207644_10105072 3300025931 Bacteria 2127
291 Ga0207644_10106168 3300025931 Bacteria 2117
292 Ga0207644_10125658 3300025931 Bacteria 1957
293 Ga0207644_10141283 3300025931 Bacteria 1854
294 Ga0207690_10000245 3300025932 Bacteria 39464
295 Ga0207690_10005573 3300025932 Bacteria 7437
296 Ga0207690_10014951 3300025932 Bacteria 4700
297 Ga0207690_10055336 3300025932 Bacteria 2672
298 Ga0207690_10109546 3300025932 Bacteria 1987
299 Ga0207690_10133771 3300025932 Bacteria 1818
300 Ga0207690_10189570 3300025932 Bacteria 1554
301 Ga0207690_10198959 3300025932 Bacteria 1520
302 Ga0207690_10439908 3300025932 Bacteria 1046
303 Ga0207706_10000041 3300025933 Bacteria 130090
304 Ga0207706_10001429 3300025933 Bacteria 23905
305 Ga0207706_10003596 3300025933 Bacteria 14803
306 Ga0207706_10011213 3300025933 Bacteria 8172
307 Ga0207706_10011368 3300025933 Bacteria 8112
308 Ga0207706_10059459 3300025933 Bacteria 3365
309 Ga0207706_10082581 3300025933 Bacteria 2824
310 Ga0207706_10180054 3300025933 Bacteria 1856
311 Ga0207706_10321123 3300025933 Bacteria 1348
312 Ga0207669_10022495 3300025937 Bacteria 3350
313 Ga0207669_10097778 3300025937 Bacteria 1931
314 Ga0207669_10179077 3300025937 Bacteria 1518
315 Ga0207691_10000045 3300025940 Bacteria 99798
316 Ga0207691_10005139 3300025940 Bacteria 12634
317 Ga0207691_10013011 3300025940 Bacteria 7967
318 Ga0207691_10128425 3300025940 Bacteria 2241
319 Ga0207711_10001311 3300025941 Bacteria 23539
320 Ga0207711_10001677 3300025941 Bacteria 20395
321 Ga0207711_10002858 3300025941 Bacteria 15138
322 Ga0207711_10003863 3300025941 Bacteria 12888
323 Ga0207711_10009533 3300025941 Bacteria 8098
324 Ga0207711_10189622 3300025941 Bacteria 1873
325 Ga0207689_10000226 3300025942 Bacteria 50110
326 Ga0207661_10000953 3300025944 Bacteria 19059
327 Ga0207661_10005783 3300025944 Bacteria 8719
328 Ga0207661_10043965 3300025944 Bacteria 3527
329 Ga0207661_10084033 3300025944 Bacteria 2636
330 Ga0207679_10000243 3300025945 Bacteria 41706
331 Ga0207679_10008060 3300025945 Bacteria 6698
332 Ga0207679_10112309 3300025945 Bacteria 2153
333 Ga0207667_10006092 3300025949 Bacteria 14659
334 Ga0207667_10063634 3300025949 Bacteria 3854
335 Ga0207667_10201249 3300025949 Bacteria 2043
336 Ga0207667_10228513 3300025949 Bacteria 1905
337 Ga0207651_10000494 3300025960 Bacteria 16521
338 Ga0207651_10012001 3300025960 Bacteria 4878
339 Ga0207651_10013969 3300025960 Bacteria 4619
340 Ga0207651_10034105 3300025960 Bacteria 3292
341 Ga0207651_10076825 3300025960 Bacteria 2388
342 Ga0207668_10027591 3300025972 Bacteria 3700
343 Ga0207668_10060121 3300025972 Bacteria 2666
344 Ga0207668_10315338 3300025972 Bacteria 1296
345 Ga0207640_10004637 3300025981 Bacteria 7459
346 Ga0207640_10124709 3300025981 Bacteria 1852
347 Ga0207658_10004807 3300025986 Bacteria 9347
348 Ga0207658_10008814 3300025986 Bacteria 6848
349 Ga0207658_10174315 3300025986 Bacteria 1775
350 Ga0207658_10353257 3300025986 Bacteria 1280
351 Ga0207658_10462448 3300025986 Bacteria 1125
352 Ga0207677_10003117 3300026023 Bacteria 8747
353 Ga0207677_10018354 3300026023 Bacteria 4196
354 Ga0207677_10030638 3300026023 Bacteria 3437
355 Ga0207677_10143483 3300026023 Bacteria 1832
356 Ga0207677_10190567 3300026023 Bacteria 1621
357 Ga0207703_10002105 3300026035 Bacteria 17519
358 Ga0207703_10002663 3300026035 Bacteria 15352
359 Ga0207703_10079372 3300026035 Bacteria 2730
360 Ga0207639_10000222 3300026041 Bacteria 42464
361 Ga0207639_10006140 3300026041 Bacteria 8157
362 Ga0207639_10033533 3300026041 Bacteria 3788
363 Ga0207678_10004584 3300026067 Bacteria 12425
364 Ga0207678_10004795 3300026067 Bacteria 12143
365 Ga0207678_10009690 3300026067 Bacteria 8475
366 Ga0207678_10021513 3300026067 Bacteria 5656
367 Ga0207678_10039637 3300026067 Bacteria 4088
368 Ga0207678_10056947 3300026067 Bacteria 3364
369 Ga0207678_10087759 3300026067 Bacteria 2658
370 Ga0207678_10100749 3300026067 Bacteria 2467
371 Ga0207678_10181336 3300026067 Bacteria 1798
372 Ga0207702_10000074 3300026078 Bacteria 113070
373 Ga0207702_10044382 3300026078 Bacteria 3736
374 Ga0207702_10245637 3300026078 Bacteria 1679
375 Ga0207702_10467518 3300026078 Bacteria 1226
376 Ga0207702_10543802 3300026078 Bacteria 1135
377 Ga0207641_10024907 3300026088 Bacteria 4933
378 Ga0207648_10002102 3300026089 Bacteria 21704
379 Ga0207648_10008748 3300026089 Bacteria 9757
380 Ga0207648_10222877 3300026089 Bacteria 1676
381 Ga0207676_10001193 3300026095 Bacteria 19504
382 Ga0207676_10005397 3300026095 Bacteria 9048
383 Ga0207676_10007462 3300026095 Bacteria 7760
384 Ga0207676_10030129 3300026095 Bacteria 4070
385 Ga0207674_10000531 3300026116 Bacteria 49979
386 Ga0207674_10030221 3300026116 Bacteria 5698
387 Ga0207674_10125058 3300026116 Bacteria 2537
388 Ga0207674_10127106 3300026116 Bacteria 2514
389 Ga0207675_100044742 3300026118 Bacteria 4137
390 Ga0207675_100075063 3300026118 Bacteria 3164
391 Ga0207698_10000892 3300026142 Bacteria 17333
392 Ga0207698_10031124 3300026142 Bacteria 3848
393 Ga0207698_10089400 3300026142 Bacteria 2515
394 Ga0207698_10412655 3300026142 Bacteria 1294
395 Ga0268266_10049829 3300028379 Bacteria 3592
396 Ga0268266_10055274 3300028379 Bacteria 3412
397 Ga0268266_10083549 3300028379 Bacteria 2787
398 Ga0268265_10501880 3300028380 Bacteria 1143
399 Ga0268264_10147803 3300028381 Bacteria 2103
400 Ga0307408_100047429 3300031548 Bacteria 3077
401 Ga0307408_100077095 3300031548 Bacteria 2481
402 Ga0307408_100365071 3300031548 Bacteria 1229
403 Ga0307405_10017948 3300031731 Bacteria 3894
404 Ga0307405_10026183 3300031731 Bacteria 3362
405 Ga0307405_10100468 3300031731 Bacteria 1939
406 Ga0307405_10103982 3300031731 Bacteria 1910
407 Ga0307405_10118105 3300031731 Bacteria 1809
408 Ga0307413_10003433 3300031824 Bacteria 6664
409 Ga0307413_10004014 3300031824 Bacteria 6325
410 Ga0307413_10099590 3300031824 Bacteria 1916
411 Ga0307410_10005046 3300031852 Bacteria 6936
412 Ga0307410_10067429 3300031852 Bacteria 2468
413 Ga0307410_10141388 3300031852 Bacteria 1781
414 Ga0307406_10028024 3300031901 Bacteria 3400
415 Ga0307406_10077785 3300031901 Bacteria 2196
416 Ga0307406_10079032 3300031901 Bacteria 2180
417 Ga0307406_10108653 3300031901 Bacteria 1905
418 Ga0307406_10170289 3300031901 Bacteria 1575
419 Ga0307407_10039617 3300031903 Bacteria 2621
420 Ga0307407_10060018 3300031903 Bacteria 2217
421 Ga0307407_10130786 3300031903 Bacteria 1605
422 Ga0307412_10011180 3300031911 Bacteria 5194
423 Ga0307412_10020171 3300031911 Bacteria 4052
424 Ga0307412_10120115 3300031911 Bacteria 1891
425 Ga0307412_10205605 3300031911 Bacteria 1498
426 Ga0307409_100071473 3300031995 Bacteria 2759
427 Ga0307409_100129968 3300031995 Bacteria 2150
428 Ga0307409_100181339 3300031995 Bacteria 1864
429 Ga0307409_100287227 3300031995 Bacteria 1523
430 Ga0307409_100289801 3300031995 Bacteria 1518
431 Ga0307409_100436012 3300031995 Bacteria 1261
432 Ga0307416_100014929 3300032002 Bacteria 5344
433 Ga0307416_100169776 3300032002 Bacteria 2029
434 Ga0307416_100546920 3300032002 Bacteria 1230
435 Ga0307414_10020483 3300032004 Bacteria 4123
436 Ga0307414_10037658 3300032004 Bacteria 3241
437 Ga0307414_10069861 3300032004 Bacteria 2526
438 Ga0307414_10099666 3300032004 Bacteria 2183
439 Ga0307414_10243286 3300032004 Bacteria 1491
440 Ga0307411_10016425 3300032005 Bacteria 4188
441 Ga0307411_10018606 3300032005 Bacteria 3990
442 Ga0307415_100039909 3300032126 Bacteria 3106
443 Ga0307415_100197213 3300032126 Bacteria 1594
444 Ga0373943_0029916 3300035170 Bacteria 2575
445 Ga0373955_0247488 3300035172 Bacteria 1068
446 Ga0373931_0052464 3300035691 Bacteria 2174
447 Ga0373935_0252100 3300035692 Bacteria 1235
448 Ga0373933_0031583 3300035724 Bacteria 3072
449 Ga0373925_0044348 3300037068 Bacteria 3302
450 Ga0395899_0000302 3300037312 Bacteria 63367
451 Ga0395899_0017613 3300037312 Bacteria 5440
452 Ga0395899_0019434 3300037312 Bacteria 5161
453 Ga0395899_0032366 3300037312 Bacteria 3927
454 Ga0395899_0044714 3300037312 Bacteria 3299
455 Ga0395899_0046829 3300037312 Bacteria 3220
456 Ga0395899_0053011 3300037312 Bacteria 3004
457 Ga0395899_0090094 3300037312 Bacteria 2224
458 Ga0395899_0122093 3300037312 Bacteria 1865
459 Ga0395899_0123975 3300037312 Bacteria 1848
460 Ga0395899_0193215 3300037312 Bacteria 1423
461 Ga0395899_0233293 3300037312 Bacteria 1269
462 Ga0395900_0000997 3300037418 Bacteria 36770
463 Ga0395900_0002684 3300037418 Bacteria 19451
464 Ga0395900_0007283 3300037418 Bacteria 11451
465 Ga0395900_0009267 3300037418 Bacteria 10092
466 Ga0395900_0017664 3300037418 Bacteria 7280
467 Ga0395900_0023580 3300037418 Bacteria 6295
468 Ga0395900_0027388 3300037418 Bacteria 5837
469 Ga0395900_0166059 3300037418 Bacteria 2249
470 Ga0395900_0237224 3300037418 Bacteria 1831
471 Ga0395900_0275376 3300037418 Bacteria 1676
472 Ga0395900_0383731 3300037418 Bacteria 1372
473 Ga0395900_0427317 3300037418 Bacteria 1284
474 Ga0395900_0594746 3300037418 Bacteria 1047
475 Ga0395898_0000054 3300037466 Bacteria 279561
476 Ga0395898_0014768 3300037466 Bacteria 8016
477 Ga0395898_0051732 3300037466 Bacteria 4016
478 Ga0395898_0053971 3300037466 Bacteria 3923
479 Ga0395898_0054496 3300037466 Bacteria 3902
480 Ga0395898_0085987 3300037466 Bacteria 3031
481 Ga0395898_0193645 3300037466 Bacteria 1942
482 Ga0395905_0000046 3300037471 Bacteria 240463
483 Ga0395905_0001164 3300037471 Bacteria 32823
484 Ga0395905_0043817 3300037471 Bacteria 4198
485 Ga0395905_0047368 3300037471 Bacteria 4029
486 Ga0395905_0084641 3300037471 Bacteria 2971
487 Ga0395905_0129196 3300037471 Bacteria 2376
488 Ga0395905_0259947 3300037471 Bacteria 1621
489 Ga0395905_0373048 3300037471 Bacteria 1320
490 Ga0436364_0089743 3300037853 Bacteria 14523
491 Ga0395901_0000086 3300038443 Bacteria 125359
492 Ga0395901_0000516 3300038443 Bacteria 44694
493 Ga0395901_0002142 3300038443 Bacteria 20180
494 Ga0395901_0004461 3300038443 Bacteria 14121
495 Ga0395901_0007579 3300038443 Bacteria 10963
496 Ga0395901_0027070 3300038443 Bacteria 5889
497 Ga0395901_0041174 3300038443 Bacteria 4786
498 Ga0395901_0061569 3300038443 Bacteria 3905
499 Ga0395901_0150594 3300038443 Bacteria 2444
500 Ga0395901_0183756 3300038443 Bacteria 2193
501 Ga0395901_0283645 3300038443 Bacteria 1720
502 Ga0395901_0337678 3300038443 Bacteria 1557
503 Ga0395901_0556751 3300038443 Bacteria 1161
504 Ga0395901_0677003 3300038443 Bacteria 1032
505 Ga0466966_0001152 3300044684 Bacteria 16994
506 Ga0466966_0003709 3300044684 Bacteria 10071
507 Ga0466966_0022621 3300044684 Bacteria 4124
508 Ga0466966_0029842 3300044684 Bacteria 3545
509 Ga0466961_0029514 3300044693 Bacteria 3524
510 Ga0466961_0041922 3300044693 Bacteria 2934
511 Ga0466963_0015928 3300044694 Bacteria 4667
512 Ga0466963_0029848 3300044694 Bacteria 3513
513 Ga0466963_0081294 3300044694 Bacteria 2194
514 Ga0466971_0014596 3300044719 Bacteria 3458
515 Ga0466970_0001142 3300044765 Bacteria 12860
516 Ga0466970_0002914 3300044765 Bacteria 8290
517 Ga0466957_0008413 3300044842 Bacteria 5867
518 Ga0466957_0043075 3300044842 Bacteria 2732
519 Ga0466959_0020592 3300045049 Bacteria 4859
520 Ga0466959_0021499 3300045049 Bacteria 4758
521 Ga0466959_0110958 3300045049 Bacteria 1957
522 Ga0466959_0164656 3300045049 Bacteria 1557
523 Ga0466958_0000291 3300045836 Bacteria 19576
524 Ga0466958_0027595 3300045836 Bacteria 3361
525 Ga0466958_0093701 3300045836 Bacteria 1860
526 Ga0466958_0204334 3300045836 Bacteria 1257
527 Ga0466958_0254738 3300045836 Bacteria 1123
528 Ga0466967_0126710 3300045976 Bacteria 2366
529 Ga0466967_0559283 3300045976 Bacteria 1126
530 Ga0495620_0099039 3300046515 Bacteria 1163
531 Ga0495663_0061392 3300046525 Bacteria 1182
532 Ga0495598_0006299 3300046537 Bacteria 2675
533 Ga0495633_0055753 3300046558 Bacteria 1857
534 Ga0495668_0190935 3300046616 Bacteria 1122
535 Ga0495623_0070991 3300046679 Bacteria 2168
536 Ga0495669_0001170 3300046684 Bacteria 10906
537 Ga0495669_0009423 3300046684 Bacteria 4116
538 Ga0495669_0012829 3300046684 Bacteria 3567
539 Ga0495669_0014347 3300046684 Bacteria 3387
540 Ga0495669_0096011 3300046684 Bacteria 1373
541 Ga0495670_0011219 3300046691 Bacteria 4404
542 Ga0495602_0046500 3300048088 Bacteria 3920
543 Ga0496100_0037411 3300048903 Bacteria 3068
544 Ga0496101_0003378 3300048904 Bacteria 9953
545 Ga0496101_0353140 3300048904 Bacteria 1156
546 Ga0496105_0099105 3300048908 Bacteria 2406
547 Ga0496106_0050361 3300048909 Bacteria 3139
548 Ga0496107_0144020 3300048910 Bacteria 1761
549 Ga0496108_0079528 3300048911 Bacteria 2776
550 Ga0496109_0000775 3300048912 Bacteria 26550
551 Ga0496109_0098706 3300048912 Bacteria 2708
552 Ga0496110_0005805 3300048913 Bacteria 9702
553 Ga0496110_0012933 3300048913 Bacteria 6882
554 Ga0496111_0004837 3300048914 Bacteria 8544
555 Ga0496111_0012279 3300048914 Bacteria 5795
556 Ga0496112_0041602 3300048915 Bacteria 4496
557 Ga0496112_0055685 3300048915 Bacteria 3890
558 Ga0496113_0265737 3300048916 Bacteria 1371
559 Ga0496114_0026396 3300048917 Bacteria 4755
560 Ga0501074_0044732 3300049590 Bacteria 3204
561 Ga0495612_0041992 3300053078 Bacteria 1866
562 Ga0466962_0002330 3300061719 Bacteria 9001
563 Ga0466962_0049527 3300061719 Bacteria 2008
564 Ga0466962_0068276 3300061719 Bacteria 1697
565 2524442918 2524023205 Bacteria 8918781
566 2745082621 2744054633 Bacteria 8678936
567 2876765283 2876761206 Bacteria 10111113
568 Ga0466969_0039451
569 MBSR1b_contig_8754477
570 JGI24736J21556_1004038
571 JGI24740J21852_10000089
572 JGI24739J22299_10000097
573 JGI24737J22298_10000037
574 JGI24737J22298_10000930
575 JGI24737J22298_10033425
576 JGI24743J22301_10002872
577 JGI24735J21928_10004142
578 JGI24735J21928_10037844
579 JGI24738J21930_10000023
580 Ga0065715_10095614
581 Ga0070658_10000377
582 Ga0070658_10020877
583 Ga0070658_10091831
584 Ga0070658_10109501
585 Ga0070658_10116380
586 Ga0070658_10119188
587 Ga0070658_10306175
588 Ga0070676_10104483
589 Ga0070683_100001819
590 Ga0070683_100039504
591 Ga0070683_100228118
592 Ga0070670_100003109
593 Ga0070670_100003400
594 Ga0070670_100042597
595 Ga0070670_100159246
596 Ga0070670_100177227
597 Ga0070670_100395907
598 Ga0070677_10008918
599 Ga0070677_10047425
600 Ga0070666_10000779
601 Ga0070666_10005953
602 Ga0070666_10024629
603 Ga0070666_10065966
604 Ga0070682_100006873
605 Ga0068868_100000259
606 Ga0068868_100015245
607 Ga0068868_100048166
608 Ga0068868_100061889
609 Ga0070660_100000986
610 Ga0070660_100058544
611 Ga0070660_100081729
612 Ga0070660_100171964
613 Ga0070689_100028985
614 Ga0070689_100158173
615 Ga0070661_100000187
616 Ga0070661_100004695
617 Ga0070661_100011962
618 Ga0070661_100072913
619 Ga0070661_100165569
620 Ga0070661_100209843
621 Ga0070661_100224334
622 Ga0070692_10034116
623 Ga0070692_10057624
624 Ga0070668_100035371
625 Ga0070669_100000174
626 Ga0070669_100033518
627 Ga0070669_100131253
628 Ga0070669_100164872
629 Ga0070675_100002370
630 Ga0070675_100010543
631 Ga0070675_100023558
632 Ga0070675_100102492
633 Ga0070671_100001282
634 Ga0070671_100029886
635 Ga0070671_100054381
636 Ga0070671_100128547
637 Ga0070674_100007200
638 Ga0070674_100161329
639 Ga0070674_100168299
640 Ga0070673_100000337
641 Ga0070673_100010120
642 Ga0070673_100011602
643 Ga0070673_100011732
644 Ga0070673_100031597
645 Ga0070659_100000191
646 Ga0070659_100000674
647 Ga0070659_100028122
648 Ga0070659_100039493
649 Ga0070659_100052281
650 Ga0070659_100141643
651 Ga0070659_100183630
652 Ga0070659_100209052
653 Ga0070659_100212634
654 Ga0070667_100001311
655 Ga0070667_100003559
656 Ga0070667_100011671
657 Ga0070667_100104177
658 Ga0070667_100263107
659 Ga0070667_100300977
660 Ga0070714_100055739
661 Ga0070714_100065718
662 Ga0070663_100000754
663 Ga0070663_100029193
664 Ga0070663_100077044
665 Ga0070663_100108487
666 Ga0070663_100110707
667 Ga0070663_100128264
668 Ga0070678_100034382
669 Ga0070662_100000012
670 Ga0070662_100001658
671 Ga0070662_100004211
672 Ga0070662_100005641
673 Ga0070662_100007787
674 Ga0070662_100122185
675 Ga0070662_100222646
676 Ga0068867_100006572
677 Ga0068867_100008577
678 Ga0068867_100214457
679 Ga0070685_10068101
680 Ga0070679_100162601
681 Ga0070679_100522698
682 Ga0070684_100003278
683 Ga0070684_100009174
684 Ga0070684_100107569
685 Ga0068853_100000032
686 Ga0068853_100000811
687 Ga0068853_100311023
688 Ga0070672_100000945
689 Ga0070672_100004830
690 Ga0070672_100015335
691 Ga0070686_100032521
692 Ga0070693_100000332
693 Ga0070665_100013547
694 Ga0070665_100021059
695 Ga0070665_100031747
696 Ga0070665_100104758
697 Ga0068855_100000591
698 Ga0068855_100003900
699 Ga0070664_100000187
700 Ga0070664_100001469
701 Ga0070664_100012642
702 Ga0070664_100039187
703 Ga0070664_100159072
704 Ga0070664_100229423
705 Ga0070664_100321093
706 Ga0068857_100004021
707 Ga0068857_100034073
708 Ga0068857_100078693
709 Ga0068854_100000664
710 Ga0068854_100025831
711 Ga0068854_100491376
712 Ga0068856_100000291
713 Ga0068856_100013426
714 Ga0068856_100100639
715 Ga0068856_100124219
716 Ga0068856_100156559
717 Ga0068852_100000906
718 Ga0068852_100102337
719 Ga0068852_100104429
720 Ga0068852_100141397
721 Ga0068852_100325452
722 Ga0068859_100002786
723 Ga0068864_100002633
724 Ga0068864_100224571
725 Ga0068866_10098458
726 Ga0068861_100027898
727 Ga0068861_100264410
728 Ga0068851_10022469
729 Ga0068851_10042459
730 Ga0068863_100002317
731 Ga0068858_100000620
732 Ga0068858_100009881
733 Ga0068860_100003524
734 Ga0097620_100002786
735 Ga0105240_10048201
736 Ga0105240_10152373
737 Ga0105240_10221098
738 Ga0105240_10481935
739 Ga0105245_10000229
740 Ga0105245_10023282
741 Ga0105245_10198795
742 Ga0105247_10237929
743 Ga0105243_10030827
744 Ga0105241_10109553
745 Ga0105241_10236893
746 Ga0105248_10000083
747 Ga0105248_10000790
748 Ga0105248_10001634
749 Ga0105248_10003127
750 Ga0105248_10011959
751 Ga0105248_10023944
752 Ga0105248_10254978
753 Ga0105238_10024793
754 Ga0105239_10221754
755 Ga0105246_10006237
756 Ga0157373_10071086
757 Ga0157373_10087945
758 Ga0157373_10089370
759 Ga0157373_10100314
760 Ga0157373_10169372
761 Ga0157371_10000756
762 Ga0157371_10009514
763 Ga0157371_10024460
764 Ga0157371_10070421
765 Ga0157371_10347565
766 Ga0157370_10150712
767 Ga0157369_10000137
768 Ga0157369_10007204
769 Ga0157369_10019245
770 Ga0157369_10042284
771 Ga0157369_10049779
772 Ga0157369_10084813
773 Ga0157369_10224048
774 Ga0157374_10019076
775 Ga0157374_10090171
776 Ga0157374_10219149
777 Ga0157374_10505694
778 Ga0157378_10000154
779 Ga0157378_10191875
780 Ga0163162_10023881
781 Ga0157372_10379691
782 Ga0157372_10454013
783 Ga0157375_10020583
784 Ga0157375_10200197
785 Ga0157375_10403985
786 Ga0163163_10001064
787 Ga0182008_10222246
788 Ga0157376_10090404
789 Ga0206353_11586731
790 Ga0213875_10020399
791 Ga0207673_1007899
792 Ga0207697_10000187
793 Ga0207656_10001253
794 Ga0207656_10054507
795 Ga0207682_10059230
796 Ga0207688_10000595
797 Ga0207688_10022437
798 Ga0207680_10002585
799 Ga0207680_10068629
800 Ga0207680_10134016
801 Ga0207647_10000090
802 Ga0207647_10012986
803 Ga0207647_10028131
804 Ga0207647_10047898
805 Ga0207645_10012721
806 Ga0207645_10031056
807 Ga0207645_10096039
808 Ga0207705_10000030
809 Ga0207705_10000072
810 Ga0207705_10010411
811 Ga0207705_10011473
812 Ga0207705_10023019
813 Ga0207705_10031771
814 Ga0207705_10095609
815 Ga0207705_10175862
816 Ga0207705_10197535
817 Ga0207695_10014730
818 Ga0207695_10036058
819 Ga0207695_10157091
820 Ga0207657_10000176
821 Ga0207657_10002682
822 Ga0207657_10007866
823 Ga0207657_10014374
824 Ga0207657_10014766
825 Ga0207657_10018127
826 Ga0207657_10020297
827 Ga0207657_10140627
828 Ga0207649_10000810
829 Ga0207649_10004374
830 Ga0207649_10006147
831 Ga0207649_10016042
832 Ga0207649_10046477
833 Ga0207649_10068215
834 Ga0207649_10075884
835 Ga0207649_10083466
836 Ga0207652_10003111
837 Ga0207681_10005702
838 Ga0207681_10146085
839 Ga0207681_10167103
840 Ga0207694_10036262
841 Ga0207650_10005079
842 Ga0207650_10016751
843 Ga0207650_10034652
844 Ga0207650_10059964
845 Ga0207650_10251182
846 Ga0207659_10007264
847 Ga0207659_10012137
848 Ga0207659_10138795
849 Ga0207659_10174596
850 Ga0207687_10001063
851 Ga0207687_10012657
852 Ga0207664_10079535
853 Ga0207664_10184904
854 Ga0207644_10005196
855 Ga0207644_10015754
856 Ga0207644_10018835
857 Ga0207644_10105072
858 Ga0207644_10106168
859 Ga0207644_10125658
860 Ga0207644_10141283
861 Ga0207690_10000245
862 Ga0207690_10005573
863 Ga0207690_10014951
864 Ga0207690_10055336
865 Ga0207690_10109546
866 Ga0207690_10133771
867 Ga0207690_10189570
868 Ga0207690_10198959
869 Ga0207690_10439908
870 Ga0207706_10000041
871 Ga0207706_10001429
872 Ga0207706_10003596
873 Ga0207706_10011213
874 Ga0207706_10011368
875 Ga0207706_10059459
876 Ga0207706_10082581
877 Ga0207706_10180054
878 Ga0207706_10321123
879 Ga0207669_10022495
880 Ga0207669_10097778
881 Ga0207669_10179077
882 Ga0207691_10000045
883 Ga0207691_10005139
884 Ga0207691_10013011
885 Ga0207691_10128425
886 Ga0207711_10001311
887 Ga0207711_10001677
888 Ga0207711_10002858
889 Ga0207711_10003863
890 Ga0207711_10009533
891 Ga0207711_10189622
892 Ga0207689_10000226
893 Ga0207661_10000953
894 Ga0207661_10005783
895 Ga0207661_10043965
896 Ga0207661_10084033
897 Ga0207679_10000243
898 Ga0207679_10008060
899 Ga0207679_10112309
900 Ga0207667_10006092
901 Ga0207667_10063634
902 Ga0207667_10201249
903 Ga0207667_10228513
904 Ga0207651_10000494
905 Ga0207651_10012001
906 Ga0207651_10013969
907 Ga0207651_10034105
908 Ga0207651_10076825
909 Ga0207668_10027591
910 Ga0207668_10060121
911 Ga0207668_10315338
912 Ga0207640_10004637
913 Ga0207640_10124709
914 Ga0207658_10004807
915 Ga0207658_10008814
916 Ga0207658_10174315
917 Ga0207658_10353257
918 Ga0207658_10462448
919 Ga0207677_10003117
920 Ga0207677_10018354
921 Ga0207677_10030638
922 Ga0207677_10143483
923 Ga0207677_10190567
924 Ga0207703_10002105
925 Ga0207703_10002663
926 Ga0207703_10079372
927 Ga0207639_10000222
928 Ga0207639_10006140
929 Ga0207639_10033533
930 Ga0207678_10004584
931 Ga0207678_10004795
932 Ga0207678_10009690
933 Ga0207678_10021513
934 Ga0207678_10039637
935 Ga0207678_10056947
936 Ga0207678_10087759
937 Ga0207678_10100749
938 Ga0207678_10181336
939 Ga0207702_10000074
940 Ga0207702_10044382
941 Ga0207702_10245637
942 Ga0207702_10467518
943 Ga0207702_10543802
944 Ga0207641_10024907
945 Ga0207648_10002102
946 Ga0207648_10008748
947 Ga0207648_10222877
948 Ga0207676_10001193
949 Ga0207676_10005397
950 Ga0207676_10007462
951 Ga0207676_10030129
952 Ga0207674_10000531
953 Ga0207674_10030221
954 Ga0207674_10125058
955 Ga0207674_10127106
956 Ga0207675_100044742
957 Ga0207675_100075063
958 Ga0207698_10000892
959 Ga0207698_10031124
960 Ga0207698_10089400
961 Ga0207698_10412655
962 Ga0268266_10049829
963 Ga0268266_10055274
964 Ga0268266_10083549
965 Ga0268265_10501880
966 Ga0268264_10147803
967 Ga0307408_100047429
968 Ga0307408_100077095
969 Ga0307408_100365071
970 Ga0307405_10017948
971 Ga0307405_10026183
972 Ga0307405_10100468
973 Ga0307405_10103982
974 Ga0307405_10118105
975 Ga0307413_10003433
976 Ga0307413_10004014
977 Ga0307413_10099590
978 Ga0307410_10005046
979 Ga0307410_10067429
980 Ga0307410_10141388
981 Ga0307406_10028024
982 Ga0307406_10077785
983 Ga0307406_10079032
984 Ga0307406_10108653
985 Ga0307406_10170289
986 Ga0307407_10039617
987 Ga0307407_10060018
988 Ga0307407_10130786
989 Ga0307412_10011180
990 Ga0307412_10020171
991 Ga0307412_10120115
992 Ga0307412_10205605
993 Ga0307409_100071473
994 Ga0307409_100129968
995 Ga0307409_100181339
996 Ga0307409_100287227
997 Ga0307409_100289801
998 Ga0307409_100436012
999 Ga0307416_100014929
1000 Ga0307416_100169776
1001 Ga0307416_100546920
1002 Ga0307414_10020483
1003 Ga0307414_10037658
1004 Ga0307414_10069861
1005 Ga0307414_10099666
1006 Ga0307414_10243286
1007 Ga0307411_10016425
1008 Ga0307411_10018606
1009 Ga0307415_100039909
1010 Ga0307415_100197213
1011 Ga0373943_0029916
1012 Ga0373955_0247488
1013 Ga0373931_0052464
1014 Ga0373935_0252100
1015 Ga0373933_0031583
1016 Ga0373925_0044348
1017 Ga0395899_0000302
1018 Ga0395899_0017613
1019 Ga0395899_0019434
1020 Ga0395899_0032366
1021 Ga0395899_0044714
1022 Ga0395899_0046829
1023 Ga0395899_0053011
1024 Ga0395899_0090094
1025 Ga0395899_0122093
1026 Ga0395899_0123975
1027 Ga0395899_0193215
1028 Ga0395899_0233293
1029 Ga0395900_0000997
1030 Ga0395900_0002684
1031 Ga0395900_0007283
1032 Ga0395900_0009267
1033 Ga0395900_0017664
1034 Ga0395900_0023580
1035 Ga0395900_0027388
1036 Ga0395900_0166059
1037 Ga0395900_0237224
1038 Ga0395900_0275376
1039 Ga0395900_0383731
1040 Ga0395900_0427317
1041 Ga0395900_0594746
1042 Ga0395898_0000054
1043 Ga0395898_0014768
1044 Ga0395898_0051732
1045 Ga0395898_0053971
1046 Ga0395898_0054496
1047 Ga0395898_0085987
1048 Ga0395898_0193645
1049 Ga0395905_0000046
1050 Ga0395905_0001164
1051 Ga0395905_0043817
1052 Ga0395905_0047368
1053 Ga0395905_0084641
1054 Ga0395905_0129196
1055 Ga0395905_0259947
1056 Ga0395905_0373048
1057 Ga0436364_0089743
1058 Ga0395901_0000086
1059 Ga0395901_0000516
1060 Ga0395901_0002142
1061 Ga0395901_0004461
1062 Ga0395901_0007579
1063 Ga0395901_0027070
1064 Ga0395901_0041174
1065 Ga0395901_0061569
1066 Ga0395901_0150594
1067 Ga0395901_0183756
1068 Ga0395901_0283645
1069 Ga0395901_0337678
1070 Ga0395901_0556751
1071 Ga0395901_0677003
1072 Ga0466966_0001152
1073 Ga0466966_0003709
1074 Ga0466966_0022621
1075 Ga0466966_0029842
1076 Ga0466961_0029514
1077 Ga0466961_0041922
1078 Ga0466963_0015928
1079 Ga0466963_0029848
1080 Ga0466963_0081294
1081 Ga0466971_0014596
1082 Ga0466970_0001142
1083 Ga0466970_0002914
1084 Ga0466957_0008413
1085 Ga0466957_0043075
1086 Ga0466959_0020592
1087 Ga0466959_0021499
1088 Ga0466959_0110958
1089 Ga0466959_0164656
1090 Ga0466958_0000291
1091 Ga0466958_0027595
1092 Ga0466958_0093701
1093 Ga0466958_0204334
1094 Ga0466958_0254738
1095 Ga0466967_0126710
1096 Ga0466967_0559283
1097 Ga0495620_0099039
1098 Ga0495663_0061392
1099 Ga0495598_0006299
1100 Ga0495633_0055753
1101 Ga0495668_0190935
1102 Ga0495623_0070991
1103 Ga0495669_0001170
1104 Ga0495669_0009423
1105 Ga0495669_0012829
1106 Ga0495669_0014347
1107 Ga0495669_0096011
1108 Ga0495670_0011219
1109 Ga0495602_0046500
1110 Ga0496100_0037411
1111 Ga0496101_0003378
1112 Ga0496101_0353140
1113 Ga0496105_0099105
1114 Ga0496106_0050361
1115 Ga0496107_0144020
1116 Ga0496108_0079528
1117 Ga0496109_0000775
1118 Ga0496109_0098706
1119 Ga0496110_0005805
1120 Ga0496110_0012933
1121 Ga0496111_0004837
1122 Ga0496111_0012279
1123 Ga0496112_0041602
1124 Ga0496112_0055685
1125 Ga0496113_0265737
1126 Ga0496114_0026396
1127 Ga0501074_0044732
1128 Ga0495612_0041992
1129 Ga0466962_0002330
1130 Ga0466962_0049527
1131 Ga0466962_0068276
1132 2524442918
1133 2745082621
1134 2876765283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

115

278

0.98

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

6

117

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9743 2 283
6s4f-assembly1.cif.gz_B structure of human mthfd2 in complex with th9619 0.9679 3 285
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9671 3 285
5tc4-assembly1.cif.gz_A-2 crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors 0.9671 3 285
6jid-assembly1.cif.gz_A human mthfd2 in complex with compound 1 0.9647 3 285
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9982 34 114 3.40.50.10860
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9965 32 115 3.40.50.10860
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9892 14 125 3.40.50.10860
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9877 32 115 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.986 34 114 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A3B8YXV1-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 1.001 50 179 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A2S8LSJ0-F1-model_v4 deleted 0.9996 40 122
AF-A0A3D1XNB9-F1-model_v4 deleted 0.9987 41 151
AF-A0A351V733-F1-model_v4 methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) 0.9985 48 153 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A3B9UJA7-F1-model_v4 deleted 0.9982 1 174

Map