F464540

General Info

Members Datasets Scaffolds Average Seq Length
567 170 1134 340

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0039424|Ga0495605_0039424_39_1166
Length 375
Sequence MMNGSPALPFFYYLRDYMIRFSLILFLTFQLILPALAGPAQSQSPNEFVSSPGLQPKQLAIVINDADPNSVAVGEYYRKRRGIPAANVVHVRIPGKPHALGVARFEALKEEIDARLKPEVQAVLMVWTAPYKVECNSITSAYSLGFDAAQCAKTCASGRPSPYFNAGSKRPYTDLNIRLSMLLPTESVAQAKELIDRGAGAGFRLLPATAYYLVTSEKPRNTRAPFFPPPGRIEARKLATRTLQADVLEGARDIIIYQTGMAEVGKLGTLGFLPGALADHLTSFGGDLLESAEKNGQMSSLRWLEAGATASYGTVSEPCNHWQKFPNPAVLLRHYVQGDSAIEAYWKSVAWPAQGLFIGEPLAAPYSRRADAGMR

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
21 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
23 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
25 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
43 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
53 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
60 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
61 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
62 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
63 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
64 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
77 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
80 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
81 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
84 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
85 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
160 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
161 2643221556 Massilia sp. Root1485 Isolate Unclassified
162 2643221638 Duganella sp. Root336D2 Isolate Unclassified
163 2643221684 Massilia sp. Root133 Isolate Unclassified
164 2738541297 Duganella sp. GV083 Isolate Unclassified
165 2738541357 Duganella sp. GV053 Isolate Unclassified
166 2738543003 Duganella sp. GV066 Isolate Unclassified
167 2738543026 Duganella sp. GV089 Isolate Unclassified
168 2738543029 Duganella sp. GV039 Isolate Unclassified
169 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
170 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 0
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 0
Rhizoplane 3.7
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0039424 3300046474 Bacteria 2366
2 JGI25159J45721_1000590 3300002987 Bacteria 16268
3 rootL2_10060435 3300003322 Bacteria 7181
4 rootL2_10199534 3300003322 Bacteria 2274
5 JGI25160J50197_1000596 3300003354 Bacteria 20222
6 JGI25161J50226_1000339 3300003374 Bacteria 25107
7 JGI25161J50226_1000559 3300003374 Bacteria 15816
8 Ga0055526_1001570 3300003771 Bacteria 16074
9 Ga0055526_1004375 3300003771 Bacteria 8520
10 Ga0055526_1007350 3300003771 Bacteria 5750
11 Ga0055537_1000219 3300003773 Bacteria 42137
12 Ga0055537_1003856 3300003773 Bacteria 4480
13 Ga0055524_1001443 3300003775 Bacteria 13639
14 Ga0055524_1003970 3300003775 Bacteria 6998
15 Ga0055534_1000116 3300003784 Bacteria 58663
16 Ga0055534_1000482 3300003784 Bacteria 22140
17 Ga0055534_1014292 3300003784 Bacteria 1492
18 Ga0055528_1002946 3300003790 Bacteria 8827
19 Ga0055528_1004980 3300003790 Bacteria 6274
20 Ga0055530_10005245 3300003791 Bacteria 6259
21 Ga0055530_10008195 3300003791 Bacteria 4231
22 Ga0055530_10009950 3300003791 Bacteria 3581
23 Ga0055531_10000956 3300003794 Bacteria 23205
24 Ga0055531_10044619 3300003794 Bacteria 1239
25 Ga0055543_1000178 3300004625 Bacteria 53073
26 Ga0065165_1000595 3300005262 Bacteria 53073
27 Ga0065165_1004024 3300005262 Bacteria 9586
28 Ga0070661_100192485 3300005344 Bacteria 1556
29 Ga0070664_100026554 3300005564 Bacteria 4804
30 Ga0075366_10048002 3300006195 Bacteria 2531
31 Ga0157373_10115079 3300013100 Bacteria 1891
32 Ga0157372_10187842 3300013307 Bacteria 2393
33 Ga0163161_10004229 3300017792 Bacteria 10018
34 Ga0209436_100057 3300025208 Bacteria 61110
35 Ga0209436_100990 3300025208 Bacteria 10951
36 Ga0207425_1000182 3300025245 Bacteria 51647
37 Ga0209148_1000203 3300025254 Bacteria 105950
38 Ga0209129_1006064 3300025258 Bacteria 4042
39 Ga0209565_1000068 3300025263 Bacteria 171201
40 Ga0209565_1000454 3300025263 Bacteria 31575
41 Ga0209565_1000455 3300025263 Bacteria 31575
42 Ga0209565_1001672 3300025263 Bacteria 9249
43 Ga0209565_1003956 3300025263 Bacteria 4636
44 Ga0209673_1000119 3300025273 Bacteria 171203
45 Ga0209673_1006594 3300025273 Bacteria 5560
46 Ga0209130_1000262 3300025284 Bacteria 65921
47 Ga0209130_1003436 3300025284 Bacteria 6727
48 Ga0209675_1000068 3300025291 Bacteria 171202
49 Ga0209675_1002697 3300025291 Bacteria 8932
50 Ga0209675_1004892 3300025291 Bacteria 5788
51 Ga0209564_1000149 3300025295 Bacteria 170958
52 Ga0209564_1000235 3300025295 Bacteria 121295
53 Ga0209564_1001151 3300025295 Bacteria 30963
54 Ga0209564_1005077 3300025295 Bacteria 7676
55 Ga0209050_1000168 3300025298 Bacteria 151278
56 Ga0209050_1000409 3300025298 Bacteria 79900
57 Ga0209050_1000931 3300025298 Bacteria 38295
58 Ga0209256_1000173 3300025299 Bacteria 129001
59 Ga0209256_1000993 3300025299 Bacteria 33790
60 Ga0209256_1001316 3300025299 Bacteria 26576
61 Ga0207426_1003615 3300025302 Bacteria 8199
62 Ga0209257_1002503 3300025304 Bacteria 18142
63 Ga0209257_1013539 3300025304 Bacteria 3612
64 Ga0207679_10049187 3300025945 Bacteria 3075
65 Ga0307408_100000189 3300031548 Bacteria 67586
66 Ga0307408_100022168 3300031548 Bacteria 4311
67 Ga0307408_100032031 3300031548 Bacteria 3664
68 Ga0265314_10026110 3300031711 Bacteria 4395
69 Ga0395899_0000240 3300037312 Bacteria 73097
70 Ga0395899_0022451 3300037312 Bacteria 4785
71 Ga0395899_0092062 3300037312 Bacteria 2196
72 Ga0395899_0110561 3300037312 Bacteria 1976
73 Ga0395900_0000230 3300037418 Bacteria 87954
74 Ga0395900_0034694 3300037418 Bacteria 5196
75 Ga0395900_0064122 3300037418 Bacteria 3776
76 Ga0395900_0137588 3300037418 Bacteria 2502
77 Ga0395900_0151912 3300037418 Bacteria 2365
78 Ga0395900_0215389 3300037418 Bacteria 1938
79 Ga0395900_0263695 3300037418 Bacteria 1719
80 Ga0395898_0077909 3300037466 Bacteria 3199
81 Ga0395905_0020493 3300037471 Bacteria 6265
82 Ga0395905_0053343 3300037471 Bacteria 3784
83 Ga0395905_0268889 3300037471 Bacteria 1590
84 Ga0395901_0000074 3300038443 Bacteria 138735
85 Ga0395901_0073643 3300038443 Bacteria 3562
86 Ga0395901_0274530 3300038443 Bacteria 1753
87 Ga0439450_003481 3300042008 Bacteria 2606
88 Ga0450904_000158 3300042139 Bacteria 14912
89 Ga0466972_0015417 3300044658 Bacteria 3819
90 Ga0466965_0007057 3300044683 Bacteria 5140
91 Ga0466965_0025204 3300044683 Bacteria 2879
92 Ga0466966_0017634 3300044684 Bacteria 4716
93 Ga0466966_0035241 3300044684 Bacteria 3234
94 Ga0466964_0000025 3300044706 Bacteria 33268
95 Ga0466964_0013391 3300044706 Bacteria 3112
96 Ga0466957_0000820 3300044842 Bacteria 15865
97 Ga0466957_0006113 3300044842 Bacteria 6796
98 Ga0466957_0027331 3300044842 Bacteria 3391
99 Ga0466959_0022865 3300045049 Bacteria 4621
100 Ga0466959_0056932 3300045049 Bacteria 2851
101 Ga0466958_0094091 3300045836 Bacteria 1856
102 Ga0466967_0014214 3300045976 Bacteria 6191
103 Ga0466967_0173181 3300045976 Bacteria 2032
104 Ga0495617_000005 3300046452 Bacteria 404687
105 Ga0495617_000026 3300046452 Bacteria 157675
106 Ga0495617_000249 3300046452 Bacteria 31699
107 Ga0495617_011618 3300046452 Bacteria 3002
108 Ga0495627_000043 3300046453 Bacteria 185855
109 Ga0495627_017651 3300046453 Bacteria 2420
110 Ga0495603_0018378 3300046455 Bacteria 4230
111 Ga0495603_0025902 3300046455 Bacteria 3545
112 Ga0495603_0043153 3300046455 Bacteria 2694
113 Ga0495590_0000041 3300046457 Bacteria 121084
114 Ga0495590_0001709 3300046457 Bacteria 9328
115 Ga0495590_0019402 3300046457 Bacteria 2423
116 Ga0495591_000216 3300046458 Bacteria 58075
117 Ga0495629_0009824 3300046459 Bacteria 6981
118 Ga0495629_0072051 3300046459 Bacteria 2411
119 Ga0495629_0173435 3300046459 Bacteria 1496
120 Ga0495638_0003140 3300046460 Bacteria 13078
121 Ga0495638_0079193 3300046460 Bacteria 1999
122 Ga0495638_0098822 3300046460 Bacteria 1748
123 Ga0495653_0000031 3300046463 Bacteria 137159
124 Ga0495653_0004204 3300046463 Bacteria 11656
125 Ga0495653_0035084 3300046463 Bacteria 3960
126 Ga0495653_0036701 3300046463 Bacteria 3858
127 Ga0495653_0067307 3300046463 Bacteria 2690
128 Ga0495650_0000270 3300046471 Bacteria 99587
129 Ga0495650_0000304 3300046471 Bacteria 88929
130 Ga0495650_0018494 3300046471 Bacteria 3459
131 Ga0495580_0007254 3300046472 Bacteria 8915
132 Ga0495582_0001171 3300046473 Bacteria 14771
133 Ga0495582_0009709 3300046473 Bacteria 5301
134 Ga0495582_0034667 3300046473 Bacteria 2774
135 Ga0495605_0000186 3300046474 Bacteria 77457
136 Ga0495605_0000454 3300046474 Bacteria 36758
137 Ga0495605_0005685 3300046474 Bacteria 7247
138 Ga0495605_0007298 3300046474 Bacteria 6279
139 Ga0495605_0062050 3300046474 Bacteria 1786
140 Ga0495639_0102313 3300046475 Bacteria 1354
141 Ga0495584_0000007 3300046491 Bacteria 294820
142 Ga0495584_0000810 3300046491 Bacteria 20559
143 Ga0495584_0001002 3300046491 Bacteria 17689
144 Ga0495584_0002751 3300046491 Bacteria 9841
145 Ga0495584_0002995 3300046491 Bacteria 9372
146 Ga0495584_0004832 3300046491 Bacteria 7198
147 Ga0495584_0009379 3300046491 Bacteria 5041
148 Ga0495584_0012752 3300046491 Bacteria 4289
149 Ga0495584_0020980 3300046491 Bacteria 3317
150 Ga0495584_0024221 3300046491 Bacteria 3078
151 Ga0495584_0039680 3300046491 Bacteria 2378
152 Ga0495584_0041694 3300046491 Bacteria 2316
153 Ga0495584_0042078 3300046491 Bacteria 2305
154 Ga0495584_0111288 3300046491 Bacteria 1385
155 Ga0495585_0000195 3300046492 Bacteria 62757
156 Ga0495585_0000209 3300046492 Bacteria 61076
157 Ga0495585_0001459 3300046492 Bacteria 18531
158 Ga0495585_0001995 3300046492 Bacteria 15139
159 Ga0495585_0002145 3300046492 Bacteria 14399
160 Ga0495585_0006416 3300046492 Bacteria 7305
161 Ga0495585_0008587 3300046492 Bacteria 6185
162 Ga0495585_0009455 3300046492 Bacteria 5846
163 Ga0495585_0023544 3300046492 Bacteria 3533
164 Ga0495585_0023931 3300046492 Bacteria 3503
165 Ga0495585_0056486 3300046492 Bacteria 2167
166 Ga0495585_0077623 3300046492 Bacteria 1803
167 Ga0495585_0090468 3300046492 Bacteria 1648
168 Ga0495585_0094313 3300046492 Bacteria 1608
169 Ga0495585_0112101 3300046492 Bacteria 1449
170 Ga0495594_0001035 3300046499 Bacteria 14475
171 Ga0495594_0001372 3300046499 Bacteria 12629
172 Ga0495594_0015959 3300046499 Bacteria 3951
173 Ga0495594_0016376 3300046499 Bacteria 3905
174 Ga0495594_0022529 3300046499 Bacteria 3369
175 Ga0495596_0000076 3300046500 Bacteria 68712
176 Ga0495596_0000643 3300046500 Bacteria 21902
177 Ga0495596_0001013 3300046500 Bacteria 16716
178 Ga0495596_0003463 3300046500 Bacteria 7977
179 Ga0495596_0004390 3300046500 Bacteria 6885
180 Ga0495596_0006664 3300046500 Bacteria 5287
181 Ga0495596_0010991 3300046500 Bacteria 3921
182 Ga0495596_0012754 3300046500 Bacteria 3584
183 Ga0495596_0019057 3300046500 Bacteria 2823
184 Ga0495596_0021696 3300046500 Bacteria 2619
185 Ga0495596_0032038 3300046500 Bacteria 2097
186 Ga0495596_0060415 3300046500 Bacteria 1476
187 Ga0495607_0001303 3300046501 Bacteria 22223
188 Ga0495607_0005415 3300046501 Bacteria 9139
189 Ga0495607_0006680 3300046501 Bacteria 8081
190 Ga0495607_0007718 3300046501 Bacteria 7407
191 Ga0495607_0009349 3300046501 Bacteria 6638
192 Ga0495607_0018213 3300046501 Bacteria 4482
193 Ga0495607_0018379 3300046501 Bacteria 4457
194 Ga0495607_0063262 3300046501 Bacteria 2094
195 Ga0495583_0000398 3300046506 Bacteria 66103
196 Ga0495583_0001422 3300046506 Bacteria 24381
197 Ga0495583_0001425 3300046506 Bacteria 24349
198 Ga0495583_0006916 3300046506 Bacteria 7292
199 Ga0495583_0008389 3300046506 Bacteria 6323
200 Ga0495583_0009356 3300046506 Bacteria 5864
201 Ga0495583_0011538 3300046506 Bacteria 5066
202 Ga0495583_0020344 3300046506 Bacteria 3441
203 Ga0495583_0025980 3300046506 Bacteria 2913
204 Ga0495583_0031362 3300046506 Bacteria 2577
205 Ga0495583_0061674 3300046506 Bacteria 1672
206 Ga0495606_0000133 3300046507 Bacteria 126345
207 Ga0495606_0001511 3300046507 Bacteria 30892
208 Ga0495606_0002193 3300046507 Bacteria 23412
209 Ga0495606_0009715 3300046507 Bacteria 8096
210 Ga0495606_0010872 3300046507 Bacteria 7494
211 Ga0495606_0019052 3300046507 Bacteria 5122
212 Ga0495606_0041556 3300046507 Bacteria 3083
213 Ga0495606_0067072 3300046507 Bacteria 2273
214 Ga0495606_0149640 3300046507 Bacteria 1371
215 Ga0495606_0176500 3300046507 Bacteria 1235
216 Ga0495610_0000038 3300046512 Bacteria 181669
217 Ga0495610_0012043 3300046512 Bacteria 5235
218 Ga0495616_0001320 3300046513 Bacteria 17309
219 Ga0495616_0001592 3300046513 Bacteria 15570
220 Ga0495616_0006657 3300046513 Bacteria 6975
221 Ga0495616_0019088 3300046513 Bacteria 3747
222 Ga0495616_0033963 3300046513 Bacteria 2652
223 Ga0495616_0054062 3300046513 Bacteria 1993
224 Ga0495616_0104774 3300046513 Bacteria 1321
225 Ga0495620_0025671 3300046515 Bacteria 2783
226 Ga0495630_0148936 3300046517 Bacteria 1780
227 Ga0495631_0000111 3300046518 Bacteria 54693
228 Ga0495631_0001889 3300046518 Bacteria 12341
229 Ga0495631_0002452 3300046518 Bacteria 10460
230 Ga0495631_0003034 3300046518 Bacteria 9282
231 Ga0495631_0006677 3300046518 Bacteria 5932
232 Ga0495631_0008715 3300046518 Bacteria 5099
233 Ga0495631_0008956 3300046518 Bacteria 5020
234 Ga0495631_0017938 3300046518 Bacteria 3339
235 Ga0495631_0019964 3300046518 Bacteria 3135
236 Ga0495631_0041798 3300046518 Bacteria 2027
237 Ga0495631_0072002 3300046518 Bacteria 1493
238 Ga0495632_0000282 3300046519 Bacteria 49929
239 Ga0495632_0000381 3300046519 Bacteria 42303
240 Ga0495632_0001383 3300046519 Bacteria 20342
241 Ga0495632_0001880 3300046519 Bacteria 16833
242 Ga0495632_0014154 3300046519 Bacteria 4526
243 Ga0495632_0017290 3300046519 Bacteria 3985
244 Ga0495632_0024958 3300046519 Bacteria 3167
245 Ga0495632_0026142 3300046519 Bacteria 3076
246 Ga0495637_0000013 3300046520 Bacteria 244837
247 Ga0495637_0029925 3300046520 Bacteria 2419
248 Ga0495643_0002036 3300046522 Bacteria 16801
249 Ga0495643_0004196 3300046522 Bacteria 10207
250 Ga0495643_0007999 3300046522 Bacteria 6743
251 Ga0495643_0008332 3300046522 Bacteria 6575
252 Ga0495643_0023092 3300046522 Bacteria 3539
253 Ga0495643_0023207 3300046522 Bacteria 3529
254 Ga0495643_0039387 3300046522 Bacteria 2585
255 Ga0495643_0047128 3300046522 Bacteria 2335
256 Ga0495643_0086116 3300046522 Bacteria 1628
257 Ga0495644_0004248 3300046523 Bacteria 5625
258 Ga0495644_0005170 3300046523 Bacteria 5107
259 Ga0495644_0008628 3300046523 Bacteria 3923
260 Ga0495644_0010473 3300046523 Bacteria 3574
261 Ga0495644_0016563 3300046523 Bacteria 2821
262 Ga0495644_0038927 3300046523 Bacteria 1792
263 Ga0495648_0000517 3300046524 Bacteria 41654
264 Ga0495648_0000929 3300046524 Bacteria 30478
265 Ga0495648_0003341 3300046524 Bacteria 14154
266 Ga0495648_0006166 3300046524 Bacteria 9828
267 Ga0495648_0008383 3300046524 Bacteria 8140
268 Ga0495648_0011681 3300046524 Bacteria 6593
269 Ga0495648_0014013 3300046524 Bacteria 5897
270 Ga0495648_0026130 3300046524 Bacteria 3935
271 Ga0495648_0032952 3300046524 Bacteria 3391
272 Ga0495648_0038271 3300046524 Bacteria 3070
273 Ga0495663_0002236 3300046525 Bacteria 5883
274 Ga0495666_0000845 3300046526 Bacteria 14184
275 Ga0495666_0006671 3300046526 Bacteria 5804
276 Ga0495666_0009496 3300046526 Bacteria 4861
277 Ga0495642_0000712 3300046528 Bacteria 16567
278 Ga0495642_0001596 3300046528 Bacteria 9912
279 Ga0495642_0001707 3300046528 Bacteria 9473
280 Ga0495642_0002896 3300046528 Bacteria 6845
281 Ga0495642_0003163 3300046528 Bacteria 6530
282 Ga0495642_0009025 3300046528 Bacteria 3815
283 Ga0495642_0036799 3300046528 Bacteria 1978
284 Ga0495642_0037516 3300046528 Bacteria 1961
285 Ga0495642_0040193 3300046528 Bacteria 1899
286 Ga0495654_0010669 3300046530 Bacteria 4990
287 Ga0495654_0021698 3300046530 Bacteria 3339
288 Ga0495654_0024313 3300046530 Bacteria 3131
289 Ga0495654_0067724 3300046530 Bacteria 1699
290 Ga0495665_0001935 3300046531 Bacteria 11178
291 Ga0495665_0019307 3300046531 Bacteria 3665
292 Ga0495640_0075266 3300046533 Bacteria 2255
293 Ga0495586_0002512 3300046535 Bacteria 9939
294 Ga0495586_0008244 3300046535 Bacteria 5552
295 Ga0495586_0012020 3300046535 Bacteria 4598
296 Ga0495586_0046590 3300046535 Bacteria 2338
297 Ga0495587_0015366 3300046536 Bacteria 4783
298 Ga0495609_0000094 3300046538 Bacteria 105073
299 Ga0495609_0001857 3300046538 Bacteria 13496
300 Ga0495609_0001869 3300046538 Bacteria 13461
301 Ga0495609_0002522 3300046538 Bacteria 11226
302 Ga0495609_0008628 3300046538 Bacteria 4976
303 Ga0495609_0014003 3300046538 Bacteria 3778
304 Ga0495609_0031161 3300046538 Bacteria 2425
305 Ga0495609_0045384 3300046538 Bacteria 1969
306 Ga0495597_0000104 3300046542 Bacteria 75532
307 Ga0495597_0000491 3300046542 Bacteria 33048
308 Ga0495597_0000689 3300046542 Bacteria 27262
309 Ga0495597_0007197 3300046542 Bacteria 5674
310 Ga0495597_0013029 3300046542 Bacteria 3992
311 Ga0495597_0016305 3300046542 Bacteria 3509
312 Ga0495597_0016676 3300046542 Bacteria 3467
313 Ga0495645_0151128 3300046543 Bacteria 1613
314 Ga0495622_0000015 3300046557 Bacteria 179054
315 Ga0495622_0015850 3300046557 Bacteria 3504
316 Ga0495622_0036436 3300046557 Bacteria 2293
317 Ga0495622_0039650 3300046557 Bacteria 2193
318 Ga0495622_0068769 3300046557 Bacteria 1635
319 Ga0495633_0000927 3300046558 Bacteria 24800
320 Ga0495633_0001697 3300046558 Bacteria 16564
321 Ga0495633_0003101 3300046558 Bacteria 11281
322 Ga0495633_0007435 3300046558 Bacteria 6302
323 Ga0495633_0011423 3300046558 Bacteria 4789
324 Ga0495633_0033521 3300046558 Bacteria 2476
325 Ga0495633_0039721 3300046558 Bacteria 2244
326 Ga0495633_0122477 3300046558 Bacteria 1205
327 Ga0495656_0025510 3300046615 Bacteria 2344
328 Ga0495668_0000131 3300046616 Bacteria 112755
329 Ga0495668_0001300 3300046616 Bacteria 24617
330 Ga0495668_0003544 3300046616 Bacteria 11604
331 Ga0495668_0004352 3300046616 Bacteria 10118
332 Ga0495668_0004383 3300046616 Bacteria 10057
333 Ga0495668_0009974 3300046616 Bacteria 5785
334 Ga0495668_0016759 3300046616 Bacteria 4258
335 Ga0495668_0029199 3300046616 Bacteria 3116
336 Ga0495668_0033201 3300046616 Bacteria 2900
337 Ga0495668_0039496 3300046616 Bacteria 2634
338 Ga0495668_0109154 3300046616 Bacteria 1513
339 Ga0495668_0138975 3300046616 Bacteria 1329
340 Ga0495668_0225775 3300046616 Bacteria 1025
341 Ga0495634_0008688 3300046642 Bacteria 7536
342 Ga0495634_0074593 3300046642 Bacteria 2229
343 Ga0495611_0002074 3300046648 Bacteria 9420
344 Ga0495611_0003208 3300046648 Bacteria 7244
345 Ga0495611_0006227 3300046648 Bacteria 5093
346 Ga0495611_0009636 3300046648 Bacteria 4080
347 Ga0495611_0046003 3300046648 Bacteria 1955
348 Ga0495625_0010549 3300046660 Bacteria 7631
349 Ga0495625_0013527 3300046660 Bacteria 6550
350 Ga0495625_0028097 3300046660 Bacteria 4222
351 Ga0495625_0034096 3300046660 Bacteria 3758
352 Ga0495625_0044714 3300046660 Bacteria 3204
353 Ga0495625_0046029 3300046660 Bacteria 3150
354 Ga0495625_0082898 3300046660 Bacteria 2229
355 Ga0495625_0102746 3300046660 Bacteria 1961
356 Ga0495635_0002559 3300046663 Bacteria 12448
357 Ga0495659_0064312 3300046664 Bacteria 1362
358 Ga0495661_0000350 3300046665 Bacteria 50303
359 Ga0495661_0001132 3300046665 Bacteria 23324
360 Ga0495661_0001670 3300046665 Bacteria 18077
361 Ga0495661_0002963 3300046665 Bacteria 12812
362 Ga0495661_0005364 3300046665 Bacteria 9116
363 Ga0495661_0008068 3300046665 Bacteria 7309
364 Ga0495661_0014389 3300046665 Bacteria 5301
365 Ga0495661_0021112 3300046665 Bacteria 4248
366 Ga0495661_0039963 3300046665 Bacteria 2912
367 Ga0495661_0058814 3300046665 Bacteria 2289
368 Ga0495661_0060989 3300046665 Bacteria 2239
369 Ga0495661_0069212 3300046665 Bacteria 2068
370 Ga0495661_0070172 3300046665 Bacteria 2051
371 Ga0495661_0079258 3300046665 Bacteria 1897
372 Ga0495661_0090394 3300046665 Bacteria 1743
373 Ga0495661_0130573 3300046665 Bacteria 1377
374 Ga0495588_0000086 3300046674 Bacteria 193241
375 Ga0495588_0001378 3300046674 Bacteria 10370
376 Ga0495588_0038394 3300046674 Bacteria 2435
377 Ga0495588_0045380 3300046674 Bacteria 2252
378 Ga0495588_0055351 3300046674 Bacteria 2047
379 Ga0495588_0058016 3300046674 Bacteria 2000
380 Ga0495588_0107976 3300046674 Bacteria 1465
381 Ga0495623_0034518 3300046679 Bacteria 3243
382 Ga0495623_0037178 3300046679 Bacteria 3117
383 Ga0495623_0053480 3300046679 Bacteria 2549
384 Ga0495623_0066024 3300046679 Bacteria 2261
385 Ga0495669_0000060 3300046684 Bacteria 73237
386 Ga0495669_0000794 3300046684 Bacteria 13506
387 Ga0495669_0001842 3300046684 Bacteria 8685
388 Ga0495669_0004403 3300046684 Bacteria 5814
389 Ga0495669_0004584 3300046684 Bacteria 5721
390 Ga0495669_0017787 3300046684 Bacteria 3052
391 Ga0495624_0099794 3300046690 Bacteria 1788
392 Ga0495670_0000603 3300046691 Bacteria 17150
393 Ga0495670_0002733 3300046691 Bacteria 8710
394 Ga0495670_0006484 3300046691 Bacteria 5752
395 Ga0495670_0006822 3300046691 Bacteria 5622
396 Ga0495670_0010743 3300046691 Bacteria 4499
397 Ga0495670_0031512 3300046691 Bacteria 2635
398 Ga0495670_0183633 3300046691 Bacteria 1105
399 Ga0495671_0000454 3300046692 Bacteria 32199
400 Ga0495671_0006263 3300046692 Bacteria 6893
401 Ga0495671_0006390 3300046692 Bacteria 6810
402 Ga0495671_0006394 3300046692 Bacteria 6808
403 Ga0495671_0014624 3300046692 Bacteria 4218
404 Ga0495671_0040045 3300046692 Bacteria 2364
405 Ga0495671_0058905 3300046692 Bacteria 1899
406 Ga0495649_0000072 3300046694 Bacteria 86748
407 Ga0495649_0009196 3300046694 Bacteria 5888
408 Ga0495649_0023270 3300046694 Bacteria 3462
409 Ga0495649_0044395 3300046694 Bacteria 2426
410 Ga0495649_0079894 3300046694 Bacteria 1749
411 Ga0495589_0000125 3300046794 Bacteria 71429
412 Ga0495589_0000166 3300046794 Bacteria 60018
413 Ga0495589_0006319 3300046794 Bacteria 6256
414 Ga0495589_0006764 3300046794 Bacteria 6038
415 Ga0495589_0009283 3300046794 Bacteria 5115
416 Ga0495589_0013334 3300046794 Bacteria 4241
417 Ga0495589_0017990 3300046794 Bacteria 3626
418 Ga0495589_0029689 3300046794 Bacteria 2757
419 Ga0495589_0047801 3300046794 Bacteria 2119
420 Ga0495589_0084407 3300046794 Bacteria 1543
421 Ga0495589_0117814 3300046794 Bacteria 1279
422 Ga0495600_0060397 3300046809 Bacteria 2475
423 Ga0495600_0074057 3300046809 Bacteria 2223
424 Ga0495660_0000162 3300046810 Bacteria 71874
425 Ga0495660_0002574 3300046810 Bacteria 11528
426 Ga0495660_0003320 3300046810 Bacteria 9980
427 Ga0495660_0006341 3300046810 Bacteria 7010
428 Ga0495660_0006932 3300046810 Bacteria 6675
429 Ga0495660_0008735 3300046810 Bacteria 5922
430 Ga0495660_0051950 3300046810 Bacteria 2228
431 Ga0495660_0100933 3300046810 Bacteria 1485
432 Ga0495581_0012918 3300047315 Bacteria 4840
433 Ga0495581_0014117 3300047315 Bacteria 4628
434 Ga0495581_0201850 3300047315 Bacteria 1163
435 Ga0495604_0004681 3300047317 Bacteria 10851
436 Ga0495604_0044011 3300047317 Bacteria 3491
437 Ga0495604_0045009 3300047317 Bacteria 3445
438 Ga0495636_0010282 3300047318 Bacteria 3693
439 Ga0495636_0019115 3300047318 Bacteria 2751
440 Ga0495674_0005491 3300047319 Bacteria 12181
441 Ga0495672_0000067 3300047320 Bacteria 190335
442 Ga0495672_0000152 3300047320 Bacteria 100381
443 Ga0495672_0000167 3300047320 Bacteria 95937
444 Ga0495672_0021342 3300047320 Bacteria 4225
445 Ga0495672_0024031 3300047320 Bacteria 3933
446 Ga0495672_0030347 3300047320 Bacteria 3393
447 Ga0495672_0076899 3300047320 Bacteria 1872
448 Ga0495676_0000123 3300047321 Bacteria 59710
449 Ga0495676_0025283 3300047321 Bacteria 5130
450 Ga0495676_0101775 3300047321 Bacteria 2124
451 Ga0495680_0005668 3300047322 Bacteria 11694
452 Ga0495680_0121922 3300047322 Bacteria 1924
453 Ga0495683_0000351 3300047323 Bacteria 38083
454 Ga0495683_0002067 3300047323 Bacteria 12436
455 Ga0495683_0002866 3300047323 Bacteria 10203
456 Ga0495683_0013731 3300047323 Bacteria 4230
457 Ga0495683_0023714 3300047323 Bacteria 3153
458 Ga0495683_0055281 3300047323 Bacteria 1976
459 Ga0495683_0133850 3300047323 Bacteria 1167
460 Ga0495687_000113 3300047443 Bacteria 123712
461 Ga0495687_000236 3300047443 Bacteria 76970
462 Ga0495687_000507 3300047443 Bacteria 46874
463 Ga0495687_001117 3300047443 Bacteria 26087
464 Ga0495687_022235 3300047443 Bacteria 3048
465 Ga0495675_0011805 3300047444 Bacteria 5487
466 Ga0495675_0040558 3300047444 Bacteria 2966
467 Ga0495677_0000368 3300047445 Bacteria 19415
468 Ga0495677_0000577 3300047445 Bacteria 15064
469 Ga0495677_0001231 3300047445 Bacteria 10268
470 Ga0495677_0002510 3300047445 Bacteria 7179
471 Ga0495677_0003108 3300047445 Bacteria 6462
472 Ga0495677_0005016 3300047445 Bacteria 5049
473 Ga0495677_0005077 3300047445 Bacteria 5011
474 Ga0495677_0007861 3300047445 Bacteria 3968
475 Ga0495677_0019034 3300047445 Bacteria 2490
476 Ga0495677_0037779 3300047445 Bacteria 1764
477 Ga0495677_0046688 3300047445 Bacteria 1589
478 Ga0495679_000307 3300047446 Bacteria 39202
479 Ga0495679_005121 3300047446 Bacteria 5879
480 Ga0495679_042153 3300047446 Bacteria 1409
481 Ga0495679_049138 3300047446 Bacteria 1273
482 Ga0495685_005331 3300047447 Bacteria 4194
483 Ga0495685_024017 3300047447 Bacteria 2098
484 Ga0495673_0000149 3300047469 Bacteria 122863
485 Ga0495681_0000496 3300047470 Bacteria 30154
486 Ga0495681_0001760 3300047470 Bacteria 15958
487 Ga0495681_0001933 3300047470 Bacteria 15184
488 Ga0495681_0009654 3300047470 Bacteria 5925
489 Ga0495681_0010836 3300047470 Bacteria 5486
490 Ga0495681_0043499 3300047470 Bacteria 2165
491 Ga0495686_0000169 3300047472 Bacteria 123511
492 Ga0495686_0000720 3300047472 Bacteria 44320
493 Ga0495686_0004616 3300047472 Bacteria 11209
494 Ga0495686_0029388 3300047472 Bacteria 3576
495 Ga0495593_0001113 3300047673 Bacteria 15701
496 Ga0495593_0012733 3300047673 Bacteria 4801
497 Ga0495593_0025483 3300047673 Bacteria 3273
498 Ga0495593_0056068 3300047673 Bacteria 2072
499 Ga0495602_0019136 3300048088 Bacteria 6810
500 Ga0495602_0047738 3300048088 Bacteria 3855
501 Ga0495614_0005333 3300048089 Bacteria 5799
502 Ga0495626_0000076 3300048091 Bacteria 131125
503 Ga0495626_0000170 3300048091 Bacteria 80445
504 Ga0495626_0001941 3300048091 Bacteria 15356
505 Ga0495626_0002385 3300048091 Bacteria 13119
506 Ga0495626_0002460 3300048091 Bacteria 12829
507 Ga0495626_0003810 3300048091 Bacteria 9466
508 Ga0495626_0008757 3300048091 Bacteria 5509
509 Ga0495626_0014347 3300048091 Bacteria 4091
510 Ga0495626_0015315 3300048091 Bacteria 3929
511 Ga0495626_0020025 3300048091 Bacteria 3339
512 Ga0495626_0020227 3300048091 Bacteria 3319
513 Ga0495626_0029609 3300048091 Bacteria 2648
514 Ga0495626_0036866 3300048091 Bacteria 2327
515 Ga0496100_0002399 3300048903 Bacteria 9490
516 Ga0496101_0004276 3300048904 Bacteria 8957
517 Ga0496102_0000156 3300048905 Bacteria 92538
518 Ga0496103_0010043 3300048906 Bacteria 5596
519 Ga0496104_0386991 3300048907 Bacteria 1311
520 Ga0496105_0135629 3300048908 Bacteria 2028
521 Ga0496106_0008982 3300048909 Bacteria 7383
522 Ga0496109_0027417 3300048912 Bacteria 5085
523 Ga0496109_0137563 3300048912 Bacteria 2283
524 Ga0496110_0000022 3300048913 Bacteria 76181
525 Ga0496110_0017617 3300048913 Bacteria 5972
526 Ga0496110_0153322 3300048913 Bacteria 2087
527 Ga0496111_0027739 3300048914 Bacteria 4009
528 Ga0496111_0150546 3300048914 Bacteria 1726
529 Ga0496112_0036079 3300048915 Bacteria 4821
530 Ga0496113_0019786 3300048916 Bacteria 4718
531 Ga0496115_0005860 3300048918 Bacteria 8952
532 Ga0496115_0057370 3300048918 Bacteria 3132
533 Ga0496115_0063348 3300048918 Bacteria 2983
534 Ga0496115_0158857 3300048918 Bacteria 1868
535 Ga0496121_0065007 3300048924 Bacteria 2971
536 Ga0496122_0000256 3300048925 Bacteria 120178
537 Ga0496123_0000196 3300048926 Bacteria 122955
538 Ga0496123_0002629 3300048926 Bacteria 21763
539 Ga0496124_0051614 3300048927 Bacteria 3498
540 Ga0496125_0001115 3300048928 Bacteria 41081
541 Ga0496126_0161873 3300048929 Bacteria 1912
542 Ga0495678_000145 3300049459 Bacteria 86070
543 Ga0495678_000509 3300049459 Bacteria 37971
544 Ga0495678_000933 3300049459 Bacteria 25490
545 Ga0495678_002426 3300049459 Bacteria 12670
546 Ga0495678_039688 3300049459 Bacteria 1897
547 Ga0495682_0000305 3300049460 Bacteria 37379
548 Ga0495682_0002053 3300049460 Bacteria 9863
549 Ga0495682_0020782 3300049460 Bacteria 2462
550 Ga0501222_002583 3300049662 Bacteria 2505
551 Ga0501227_006486 3300049665 Bacteria 2513
552 Ga0501279_003286 3300049775 Bacteria 2105
553 Ga0501035_0000692 3300049822 Bacteria 36807
554 Ga0500586_000655 3300053145 Bacteria 7067
555 Ga0466962_0191284 3300061719 Bacteria 999
556 2601669645 2600255292 Bacteria 6300551
557 2643788053 2643221554 Bacteria 6603920
558 2643800294 2643221556 Bacteria 7251154
559 2644216342 2643221638 Bacteria 6579467
560 2644471927 2643221684 Bacteria 7145183
561 2738827124 2738541297 Bacteria 6549566
562 2739150921 2738541357 Bacteria 6549408
563 2739192840 2738543003 Bacteria 6549560
564 2739319317 2738543026 Bacteria 6549408
565 2739337558 2738543029 Bacteria 6549249
566 2809142367 2808606418 Bacteria 6724496
567 8047676471 8047673197 Bacteria 7395230
568 Ga0495605_0039424
569 JGI25159J45721_1000590
570 rootL2_10060435
571 rootL2_10199534
572 JGI25160J50197_1000596
573 JGI25161J50226_1000339
574 JGI25161J50226_1000559
575 Ga0055526_1001570
576 Ga0055526_1004375
577 Ga0055526_1007350
578 Ga0055537_1000219
579 Ga0055537_1003856
580 Ga0055524_1001443
581 Ga0055524_1003970
582 Ga0055534_1000116
583 Ga0055534_1000482
584 Ga0055534_1014292
585 Ga0055528_1002946
586 Ga0055528_1004980
587 Ga0055530_10005245
588 Ga0055530_10008195
589 Ga0055530_10009950
590 Ga0055531_10000956
591 Ga0055531_10044619
592 Ga0055543_1000178
593 Ga0065165_1000595
594 Ga0065165_1004024
595 Ga0070661_100192485
596 Ga0070664_100026554
597 Ga0075366_10048002
598 Ga0157373_10115079
599 Ga0157372_10187842
600 Ga0163161_10004229
601 Ga0209436_100057
602 Ga0209436_100990
603 Ga0207425_1000182
604 Ga0209148_1000203
605 Ga0209129_1006064
606 Ga0209565_1000068
607 Ga0209565_1000454
608 Ga0209565_1000455
609 Ga0209565_1001672
610 Ga0209565_1003956
611 Ga0209673_1000119
612 Ga0209673_1006594
613 Ga0209130_1000262
614 Ga0209130_1003436
615 Ga0209675_1000068
616 Ga0209675_1002697
617 Ga0209675_1004892
618 Ga0209564_1000149
619 Ga0209564_1000235
620 Ga0209564_1001151
621 Ga0209564_1005077
622 Ga0209050_1000168
623 Ga0209050_1000409
624 Ga0209050_1000931
625 Ga0209256_1000173
626 Ga0209256_1000993
627 Ga0209256_1001316
628 Ga0207426_1003615
629 Ga0209257_1002503
630 Ga0209257_1013539
631 Ga0207679_10049187
632 Ga0307408_100000189
633 Ga0307408_100022168
634 Ga0307408_100032031
635 Ga0265314_10026110
636 Ga0395899_0000240
637 Ga0395899_0022451
638 Ga0395899_0092062
639 Ga0395899_0110561
640 Ga0395900_0000230
641 Ga0395900_0034694
642 Ga0395900_0064122
643 Ga0395900_0137588
644 Ga0395900_0151912
645 Ga0395900_0215389
646 Ga0395900_0263695
647 Ga0395898_0077909
648 Ga0395905_0020493
649 Ga0395905_0053343
650 Ga0395905_0268889
651 Ga0395901_0000074
652 Ga0395901_0073643
653 Ga0395901_0274530
654 Ga0439450_003481
655 Ga0450904_000158
656 Ga0466972_0015417
657 Ga0466965_0007057
658 Ga0466965_0025204
659 Ga0466966_0017634
660 Ga0466966_0035241
661 Ga0466964_0000025
662 Ga0466964_0013391
663 Ga0466957_0000820
664 Ga0466957_0006113
665 Ga0466957_0027331
666 Ga0466959_0022865
667 Ga0466959_0056932
668 Ga0466958_0094091
669 Ga0466967_0014214
670 Ga0466967_0173181
671 Ga0495617_000005
672 Ga0495617_000026
673 Ga0495617_000249
674 Ga0495617_011618
675 Ga0495627_000043
676 Ga0495627_017651
677 Ga0495603_0018378
678 Ga0495603_0025902
679 Ga0495603_0043153
680 Ga0495590_0000041
681 Ga0495590_0001709
682 Ga0495590_0019402
683 Ga0495591_000216
684 Ga0495629_0009824
685 Ga0495629_0072051
686 Ga0495629_0173435
687 Ga0495638_0003140
688 Ga0495638_0079193
689 Ga0495638_0098822
690 Ga0495653_0000031
691 Ga0495653_0004204
692 Ga0495653_0035084
693 Ga0495653_0036701
694 Ga0495653_0067307
695 Ga0495650_0000270
696 Ga0495650_0000304
697 Ga0495650_0018494
698 Ga0495580_0007254
699 Ga0495582_0001171
700 Ga0495582_0009709
701 Ga0495582_0034667
702 Ga0495605_0000186
703 Ga0495605_0000454
704 Ga0495605_0005685
705 Ga0495605_0007298
706 Ga0495605_0062050
707 Ga0495639_0102313
708 Ga0495584_0000007
709 Ga0495584_0000810
710 Ga0495584_0001002
711 Ga0495584_0002751
712 Ga0495584_0002995
713 Ga0495584_0004832
714 Ga0495584_0009379
715 Ga0495584_0012752
716 Ga0495584_0020980
717 Ga0495584_0024221
718 Ga0495584_0039680
719 Ga0495584_0041694
720 Ga0495584_0042078
721 Ga0495584_0111288
722 Ga0495585_0000195
723 Ga0495585_0000209
724 Ga0495585_0001459
725 Ga0495585_0001995
726 Ga0495585_0002145
727 Ga0495585_0006416
728 Ga0495585_0008587
729 Ga0495585_0009455
730 Ga0495585_0023544
731 Ga0495585_0023931
732 Ga0495585_0056486
733 Ga0495585_0077623
734 Ga0495585_0090468
735 Ga0495585_0094313
736 Ga0495585_0112101
737 Ga0495594_0001035
738 Ga0495594_0001372
739 Ga0495594_0015959
740 Ga0495594_0016376
741 Ga0495594_0022529
742 Ga0495596_0000076
743 Ga0495596_0000643
744 Ga0495596_0001013
745 Ga0495596_0003463
746 Ga0495596_0004390
747 Ga0495596_0006664
748 Ga0495596_0010991
749 Ga0495596_0012754
750 Ga0495596_0019057
751 Ga0495596_0021696
752 Ga0495596_0032038
753 Ga0495596_0060415
754 Ga0495607_0001303
755 Ga0495607_0005415
756 Ga0495607_0006680
757 Ga0495607_0007718
758 Ga0495607_0009349
759 Ga0495607_0018213
760 Ga0495607_0018379
761 Ga0495607_0063262
762 Ga0495583_0000398
763 Ga0495583_0001422
764 Ga0495583_0001425
765 Ga0495583_0006916
766 Ga0495583_0008389
767 Ga0495583_0009356
768 Ga0495583_0011538
769 Ga0495583_0020344
770 Ga0495583_0025980
771 Ga0495583_0031362
772 Ga0495583_0061674
773 Ga0495606_0000133
774 Ga0495606_0001511
775 Ga0495606_0002193
776 Ga0495606_0009715
777 Ga0495606_0010872
778 Ga0495606_0019052
779 Ga0495606_0041556
780 Ga0495606_0067072
781 Ga0495606_0149640
782 Ga0495606_0176500
783 Ga0495610_0000038
784 Ga0495610_0012043
785 Ga0495616_0001320
786 Ga0495616_0001592
787 Ga0495616_0006657
788 Ga0495616_0019088
789 Ga0495616_0033963
790 Ga0495616_0054062
791 Ga0495616_0104774
792 Ga0495620_0025671
793 Ga0495630_0148936
794 Ga0495631_0000111
795 Ga0495631_0001889
796 Ga0495631_0002452
797 Ga0495631_0003034
798 Ga0495631_0006677
799 Ga0495631_0008715
800 Ga0495631_0008956
801 Ga0495631_0017938
802 Ga0495631_0019964
803 Ga0495631_0041798
804 Ga0495631_0072002
805 Ga0495632_0000282
806 Ga0495632_0000381
807 Ga0495632_0001383
808 Ga0495632_0001880
809 Ga0495632_0014154
810 Ga0495632_0017290
811 Ga0495632_0024958
812 Ga0495632_0026142
813 Ga0495637_0000013
814 Ga0495637_0029925
815 Ga0495643_0002036
816 Ga0495643_0004196
817 Ga0495643_0007999
818 Ga0495643_0008332
819 Ga0495643_0023092
820 Ga0495643_0023207
821 Ga0495643_0039387
822 Ga0495643_0047128
823 Ga0495643_0086116
824 Ga0495644_0004248
825 Ga0495644_0005170
826 Ga0495644_0008628
827 Ga0495644_0010473
828 Ga0495644_0016563
829 Ga0495644_0038927
830 Ga0495648_0000517
831 Ga0495648_0000929
832 Ga0495648_0003341
833 Ga0495648_0006166
834 Ga0495648_0008383
835 Ga0495648_0011681
836 Ga0495648_0014013
837 Ga0495648_0026130
838 Ga0495648_0032952
839 Ga0495648_0038271
840 Ga0495663_0002236
841 Ga0495666_0000845
842 Ga0495666_0006671
843 Ga0495666_0009496
844 Ga0495642_0000712
845 Ga0495642_0001596
846 Ga0495642_0001707
847 Ga0495642_0002896
848 Ga0495642_0003163
849 Ga0495642_0009025
850 Ga0495642_0036799
851 Ga0495642_0037516
852 Ga0495642_0040193
853 Ga0495654_0010669
854 Ga0495654_0021698
855 Ga0495654_0024313
856 Ga0495654_0067724
857 Ga0495665_0001935
858 Ga0495665_0019307
859 Ga0495640_0075266
860 Ga0495586_0002512
861 Ga0495586_0008244
862 Ga0495586_0012020
863 Ga0495586_0046590
864 Ga0495587_0015366
865 Ga0495609_0000094
866 Ga0495609_0001857
867 Ga0495609_0001869
868 Ga0495609_0002522
869 Ga0495609_0008628
870 Ga0495609_0014003
871 Ga0495609_0031161
872 Ga0495609_0045384
873 Ga0495597_0000104
874 Ga0495597_0000491
875 Ga0495597_0000689
876 Ga0495597_0007197
877 Ga0495597_0013029
878 Ga0495597_0016305
879 Ga0495597_0016676
880 Ga0495645_0151128
881 Ga0495622_0000015
882 Ga0495622_0015850
883 Ga0495622_0036436
884 Ga0495622_0039650
885 Ga0495622_0068769
886 Ga0495633_0000927
887 Ga0495633_0001697
888 Ga0495633_0003101
889 Ga0495633_0007435
890 Ga0495633_0011423
891 Ga0495633_0033521
892 Ga0495633_0039721
893 Ga0495633_0122477
894 Ga0495656_0025510
895 Ga0495668_0000131
896 Ga0495668_0001300
897 Ga0495668_0003544
898 Ga0495668_0004352
899 Ga0495668_0004383
900 Ga0495668_0009974
901 Ga0495668_0016759
902 Ga0495668_0029199
903 Ga0495668_0033201
904 Ga0495668_0039496
905 Ga0495668_0109154
906 Ga0495668_0138975
907 Ga0495668_0225775
908 Ga0495634_0008688
909 Ga0495634_0074593
910 Ga0495611_0002074
911 Ga0495611_0003208
912 Ga0495611_0006227
913 Ga0495611_0009636
914 Ga0495611_0046003
915 Ga0495625_0010549
916 Ga0495625_0013527
917 Ga0495625_0028097
918 Ga0495625_0034096
919 Ga0495625_0044714
920 Ga0495625_0046029
921 Ga0495625_0082898
922 Ga0495625_0102746
923 Ga0495635_0002559
924 Ga0495659_0064312
925 Ga0495661_0000350
926 Ga0495661_0001132
927 Ga0495661_0001670
928 Ga0495661_0002963
929 Ga0495661_0005364
930 Ga0495661_0008068
931 Ga0495661_0014389
932 Ga0495661_0021112
933 Ga0495661_0039963
934 Ga0495661_0058814
935 Ga0495661_0060989
936 Ga0495661_0069212
937 Ga0495661_0070172
938 Ga0495661_0079258
939 Ga0495661_0090394
940 Ga0495661_0130573
941 Ga0495588_0000086
942 Ga0495588_0001378
943 Ga0495588_0038394
944 Ga0495588_0045380
945 Ga0495588_0055351
946 Ga0495588_0058016
947 Ga0495588_0107976
948 Ga0495623_0034518
949 Ga0495623_0037178
950 Ga0495623_0053480
951 Ga0495623_0066024
952 Ga0495669_0000060
953 Ga0495669_0000794
954 Ga0495669_0001842
955 Ga0495669_0004403
956 Ga0495669_0004584
957 Ga0495669_0017787
958 Ga0495624_0099794
959 Ga0495670_0000603
960 Ga0495670_0002733
961 Ga0495670_0006484
962 Ga0495670_0006822
963 Ga0495670_0010743
964 Ga0495670_0031512
965 Ga0495670_0183633
966 Ga0495671_0000454
967 Ga0495671_0006263
968 Ga0495671_0006390
969 Ga0495671_0006394
970 Ga0495671_0014624
971 Ga0495671_0040045
972 Ga0495671_0058905
973 Ga0495649_0000072
974 Ga0495649_0009196
975 Ga0495649_0023270
976 Ga0495649_0044395
977 Ga0495649_0079894
978 Ga0495589_0000125
979 Ga0495589_0000166
980 Ga0495589_0006319
981 Ga0495589_0006764
982 Ga0495589_0009283
983 Ga0495589_0013334
984 Ga0495589_0017990
985 Ga0495589_0029689
986 Ga0495589_0047801
987 Ga0495589_0084407
988 Ga0495589_0117814
989 Ga0495600_0060397
990 Ga0495600_0074057
991 Ga0495660_0000162
992 Ga0495660_0002574
993 Ga0495660_0003320
994 Ga0495660_0006341
995 Ga0495660_0006932
996 Ga0495660_0008735
997 Ga0495660_0051950
998 Ga0495660_0100933
999 Ga0495581_0012918
1000 Ga0495581_0014117
1001 Ga0495581_0201850
1002 Ga0495604_0004681
1003 Ga0495604_0044011
1004 Ga0495604_0045009
1005 Ga0495636_0010282
1006 Ga0495636_0019115
1007 Ga0495674_0005491
1008 Ga0495672_0000067
1009 Ga0495672_0000152
1010 Ga0495672_0000167
1011 Ga0495672_0021342
1012 Ga0495672_0024031
1013 Ga0495672_0030347
1014 Ga0495672_0076899
1015 Ga0495676_0000123
1016 Ga0495676_0025283
1017 Ga0495676_0101775
1018 Ga0495680_0005668
1019 Ga0495680_0121922
1020 Ga0495683_0000351
1021 Ga0495683_0002067
1022 Ga0495683_0002866
1023 Ga0495683_0013731
1024 Ga0495683_0023714
1025 Ga0495683_0055281
1026 Ga0495683_0133850
1027 Ga0495687_000113
1028 Ga0495687_000236
1029 Ga0495687_000507
1030 Ga0495687_001117
1031 Ga0495687_022235
1032 Ga0495675_0011805
1033 Ga0495675_0040558
1034 Ga0495677_0000368
1035 Ga0495677_0000577
1036 Ga0495677_0001231
1037 Ga0495677_0002510
1038 Ga0495677_0003108
1039 Ga0495677_0005016
1040 Ga0495677_0005077
1041 Ga0495677_0007861
1042 Ga0495677_0019034
1043 Ga0495677_0037779
1044 Ga0495677_0046688
1045 Ga0495679_000307
1046 Ga0495679_005121
1047 Ga0495679_042153
1048 Ga0495679_049138
1049 Ga0495685_005331
1050 Ga0495685_024017
1051 Ga0495673_0000149
1052 Ga0495681_0000496
1053 Ga0495681_0001760
1054 Ga0495681_0001933
1055 Ga0495681_0009654
1056 Ga0495681_0010836
1057 Ga0495681_0043499
1058 Ga0495686_0000169
1059 Ga0495686_0000720
1060 Ga0495686_0004616
1061 Ga0495686_0029388
1062 Ga0495593_0001113
1063 Ga0495593_0012733
1064 Ga0495593_0025483
1065 Ga0495593_0056068
1066 Ga0495602_0019136
1067 Ga0495602_0047738
1068 Ga0495614_0005333
1069 Ga0495626_0000076
1070 Ga0495626_0000170
1071 Ga0495626_0001941
1072 Ga0495626_0002385
1073 Ga0495626_0002460
1074 Ga0495626_0003810
1075 Ga0495626_0008757
1076 Ga0495626_0014347
1077 Ga0495626_0015315
1078 Ga0495626_0020025
1079 Ga0495626_0020227
1080 Ga0495626_0029609
1081 Ga0495626_0036866
1082 Ga0496100_0002399
1083 Ga0496101_0004276
1084 Ga0496102_0000156
1085 Ga0496103_0010043
1086 Ga0496104_0386991
1087 Ga0496105_0135629
1088 Ga0496106_0008982
1089 Ga0496109_0027417
1090 Ga0496109_0137563
1091 Ga0496110_0000022
1092 Ga0496110_0017617
1093 Ga0496110_0153322
1094 Ga0496111_0027739
1095 Ga0496111_0150546
1096 Ga0496112_0036079
1097 Ga0496113_0019786
1098 Ga0496115_0005860
1099 Ga0496115_0057370
1100 Ga0496115_0063348
1101 Ga0496115_0158857
1102 Ga0496121_0065007
1103 Ga0496122_0000256
1104 Ga0496123_0000196
1105 Ga0496123_0002629
1106 Ga0496124_0051614
1107 Ga0496125_0001115
1108 Ga0496126_0161873
1109 Ga0495678_000145
1110 Ga0495678_000509
1111 Ga0495678_000933
1112 Ga0495678_002426
1113 Ga0495678_039688
1114 Ga0495682_0000305
1115 Ga0495682_0002053
1116 Ga0495682_0020782
1117 Ga0501222_002583
1118 Ga0501227_006486
1119 Ga0501279_003286
1120 Ga0501035_0000692
1121 Ga0500586_000655
1122 Ga0466962_0191284
1123 2601669645
1124 2643788053
1125 2643800294
1126 2644216342
1127 2644471927
1128 2738827124
1129 2739150921
1130 2739192840
1131 2739319317
1132 2739337558
1133 2809142367
1134 8047676471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ejb-assembly1.cif.gz_E lumazine synthase from saccharomyces cerevisiae 0.5337 22 91
6liu-assembly3.cif.gz_F crystal structure of apo tyrosine decarboxylase 0.5125 25 91
6vfj-assembly1.cif.gz_A de novo designed icosahedral nanoparticle i53_dn5 0.5116 28 91
5im4-assembly1.cif.gz_h crystal structure of designed two-component self-assembling icosahedral cage i52-32 0.5094 22 91
5im4-assembly1.cif.gz_f crystal structure of designed two-component self-assembling icosahedral cage i52-32 0.5092 22 91
ID Description Score Start End Superfamily
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5635 30 91 3.40.50.880
af_P9WF31_128_342_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.5192 25 91 3.40.50.261
af_I1JU43_52_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.514 26 91 3.40.50.720
5im4g00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.4984 29 91 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.493 22 91 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A350CR22-F1-model_v4 TIGR03790 family protein 0.9745 24 325
AF-A0A1I1PB06-F1-model_v4 TIGR03790 family protein 0.9738 22 323
AF-A0A1W9J7Y2-F1-model_v4 TIGR03790 family protein 0.9727 23 325
AF-A0A0J1DFF7-F1-model_v4 TIGR03790 family protein 0.9694 22 325
AF-C6XA83-F1-model_v4 TIGR03790 family protein 0.9661 16 323

Map