F464545

General Info

Members Datasets Scaffolds Average Seq Length
567 224 1134 137

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0001003|Ga0495654_0001003_11608_12039
Length 143
Sequence MIERILMANLPDKDKLVRNFSRCLNWEDKYLYVIELGAKLPALDDTERQAGNLISGCQSQVWIVMQLDEQGRVEFHGDSDAAIVKGLLAVVFILYHQMTPQQIVDLDVRPFFAELALSQHLTPSRSQGLEAMIRAIRSQAAKF

Samples

Sample ID Description Type Environment
1 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
36 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
37 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
38 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
39 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
57 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
60 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
63 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
64 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
65 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
66 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
69 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
72 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
73 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
74 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
100 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
101 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
126 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
127 2506520008 Serratia plymuthica AS12 Isolate Unclassified
128 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
129 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
130 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
131 2547132181 Kosakonia sacchari SP1 Isolate Stem
132 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
133 2561511199 Enterobacter sp. R4-368 Isolate Nodule
134 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
135 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
136 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
137 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
138 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
139 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
140 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
141 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
142 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
143 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
144 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
145 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
146 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
147 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
148 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
149 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
150 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
151 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
152 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
153 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
154 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
155 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
156 2751185917 Enterobacter sp. HK169 Isolate Unclassified
157 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
158 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
159 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
160 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
161 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
162 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
163 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
164 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
165 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
166 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
167 2821118458 Enterobacter asburiae 609 Isolate Unclassified
168 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
169 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
170 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
171 2847085930 Erwinia persicina B64 Isolate Bulb
172 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
173 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
174 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
175 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
176 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
177 2865014394 Pantoea sp. R-71966 Isolate Unclassified
178 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
179 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
180 2876601092 Pantoea endophytica 596 Isolate Unclassified
181 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
182 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
183 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
184 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
185 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
186 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
187 2904504865 Serratia marcescens 1822 Isolate Unclassified
188 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
189 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
190 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
191 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
192 2932406140 Serratia sp. 2723 Isolate Rhizosphere
193 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
194 2937539931 Pantoea sp. LS15 Isolate Unclassified
195 2937967321 Serratia sp. YC16 Isolate Unclassified
196 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
197 2939577877 Serratia sp. 509 Isolate Rhizosphere
198 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
199 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
200 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
201 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
202 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
203 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
204 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
205 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
206 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
207 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
208 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
209 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
210 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
211 640753048 Serratia proteamaculans 568 Isolate Endosphere
212 8004592986 Serratia sp. S119 Isolate Unclassified
213 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
214 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
215 8018221730 Enterobacter sp. CM29 Isolate Unclassified
216 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
217 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
218 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
219 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
220 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
221 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
222 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
223 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
224 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.54
Metatranscriptomes 0
Isolates 17.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0.18
Endosphere 3
Nodule 4.76
Rhizoplane 4.94
Rhizosphere 55.2
Stem 0.18
Stem Tuber 0.88
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495654_0001003 3300046530 Bacteria 20737
2 RicEn_C1036 2010549000 Bacteria 2052
3 SwRhRL2b_contig_1408841 2162886007 Bacteria 3181
4 SwRhRL2b_contig_3004390 2162886007 Bacteria 1031
5 SwRhRL2b_contig_3802247 2162886007 Bacteria 1429
6 SwRhRL2b_contig_523597 2162886007 Bacteria 821
7 JGI24739J22299_10022450 3300001989 Bacteria 2239
8 JGI24739J22299_10044604 3300001989 Bacteria 1459
9 JGI25162J39368_1001236 3300002737 Bacteria 14718
10 Ga0058692_1001974 3300003856 Bacteria 7144
11 Ga0058692_1002212 3300003856 Bacteria 6631
12 Ga0058692_1002227 3300003856 Bacteria 6592
13 Ga0058692_1003743 3300003856 Bacteria 4641
14 Ga0058692_1014570 3300003856 Bacteria 1796
15 Ga0058692_1027387 3300003856 Bacteria 1111
16 Ga0058692_1031757 3300003856 Bacteria 991
17 Ga0058692_1073055 3300003856 Bacteria 515
18 Ga0065703_1020579 3300005272 Bacteria 1700
19 Ga0065704_10028406 3300005289 Bacteria 1343
20 Ga0065704_10076080 3300005289 Bacteria 5271
21 Ga0065704_10090194 3300005289 Bacteria 2795
22 Ga0065704_10128963 3300005289 Bacteria 1655
23 Ga0070660_100439592 3300005339 Bacteria 1081
24 Ga0070668_100025488 3300005347 Bacteria 4483
25 Ga0070659_100013636 3300005366 Bacteria 6055
26 Ga0070665_100000595 3300005548 Bacteria 50263
27 Ga0070665_100603003 3300005548 Bacteria 1111
28 Ga0068857_100010323 3300005577 Bacteria 8113
29 Ga0075364_10004121 3300006051 Bacteria 8344
30 Ga0075364_10042276 3300006051 Bacteria 2960
31 Ga0075364_10115181 3300006051 Bacteria 1797
32 Ga0075364_10222281 3300006051 Bacteria 1282
33 Ga0079104_1000611 3300006946 Bacteria 35208
34 Ga0079104_1000775 3300006946 Bacteria 27286
35 Ga0079104_1001375 3300006946 Bacteria 16606
36 Ga0079104_1001480 3300006946 Bacteria 15648
37 Ga0079104_1002634 3300006946 Bacteria 9364
38 Ga0079104_1005813 3300006946 Bacteria 4828
39 Ga0079104_1006832 3300006946 Bacteria 4229
40 Ga0079104_1013223 3300006946 Bacteria 2555
41 Ga0079104_1023680 3300006946 Bacteria 1629
42 Ga0079104_1024753 3300006946 Bacteria 1577
43 Ga0079104_1093671 3300006946 Bacteria 606
44 Ga0079104_1093691 3300006946 Bacteria 606
45 Ga0099826_10170406 3300006948 Bacteria 1222
46 Ga0105251_10000752 3300009011 Bacteria 29611
47 Ga0105251_10001038 3300009011 Bacteria 24371
48 Ga0105251_10002124 3300009011 Bacteria 15933
49 Ga0105251_10002144 3300009011 Bacteria 15866
50 Ga0105251_10008328 3300009011 Bacteria 6259
51 Ga0105251_10010747 3300009011 Bacteria 5281
52 Ga0105251_10017695 3300009011 Bacteria 3810
53 Ga0105251_10019020 3300009011 Bacteria 3637
54 Ga0105251_10026494 3300009011 Bacteria 2953
55 Ga0105251_10027672 3300009011 Bacteria 2871
56 Ga0105251_10049649 3300009011 Bacteria 2007
57 Ga0105251_10084902 3300009011 Bacteria 1460
58 Ga0105251_10341772 3300009011 Bacteria 682
59 Ga0105251_10497452 3300009011 Bacteria 569
60 Ga0105251_10548660 3300009011 Bacteria 544
61 Ga0105244_10000104 3300009036 Bacteria 86815
62 Ga0105244_10000330 3300009036 Bacteria 44986
63 Ga0105244_10000586 3300009036 Bacteria 32689
64 Ga0105244_10000865 3300009036 Bacteria 25591
65 Ga0105244_10001499 3300009036 Bacteria 18722
66 Ga0105244_10018889 3300009036 Bacteria 3860
67 Ga0105244_10021770 3300009036 Bacteria 3538
68 Ga0105244_10030233 3300009036 Bacteria 2883
69 Ga0105244_10034307 3300009036 Bacteria 2672
70 Ga0105244_10038819 3300009036 Bacteria 2481
71 Ga0105244_10040876 3300009036 Bacteria 2405
72 Ga0105244_10131581 3300009036 Bacteria 1207
73 Ga0105244_10142802 3300009036 Bacteria 1150
74 Ga0105244_10280822 3300009036 Bacteria 772
75 Ga0105244_10359498 3300009036 Bacteria 671
76 Ga0105250_10000001 3300009092 Bacteria 617357
77 Ga0105250_10000448 3300009092 Bacteria 29733
78 Ga0105250_10003065 3300009092 Bacteria 8061
79 Ga0105250_10007391 3300009092 Bacteria 4724
80 Ga0105250_10029116 3300009092 Bacteria 2222
81 Ga0105250_10035900 3300009092 Bacteria 1989
82 Ga0105250_10077457 3300009092 Bacteria 1346
83 Ga0105250_10133173 3300009092 Bacteria 1027
84 Ga0105250_10140422 3300009092 Bacteria 1001
85 Ga0105250_10266759 3300009092 Bacteria 734
86 Ga0105250_10366303 3300009092 Bacteria 634
87 Ga0105240_10664239 3300009093 Bacteria 1141
88 Ga0105247_10000138 3300009101 Bacteria 70791
89 Ga0105243_10515809 3300009148 Bacteria 1136
90 Ga0105241_10000002 3300009174 Bacteria 869480
91 Ga0105237_10904960 3300009545 Bacteria 889
92 Ga0105246_10129560 3300011119 Bacteria 1882
93 Ga0105246_10145899 3300011119 Bacteria 1785
94 Ga0157373_10000500 3300013100 Bacteria 30895
95 Ga0157373_10000783 3300013100 Bacteria 24475
96 Ga0157373_10027932 3300013100 Bacteria 4070
97 Ga0157373_10054659 3300013100 Bacteria 2837
98 Ga0157373_10786395 3300013100 Bacteria 701
99 Ga0157373_11564832 3300013100 Bacteria 504
100 Ga0157371_10000099 3300013102 Bacteria 133829
101 Ga0157371_10001578 3300013102 Bacteria 23400
102 Ga0157371_10016739 3300013102 Bacteria 5462
103 Ga0157371_10053195 3300013102 Bacteria 2875
104 Ga0157371_10066171 3300013102 Bacteria 2559
105 Ga0157370_10000234 3300013104 Bacteria 70723
106 Ga0157370_10006551 3300013104 Bacteria 12824
107 Ga0157370_10015259 3300013104 Bacteria 7818
108 Ga0157369_10030301 3300013105 Bacteria 5967
109 Ga0157369_10032764 3300013105 Bacteria 5711
110 Ga0163162_10035335 3300013306 Bacteria 4977
111 Ga0157372_10014588 3300013307 Bacteria 8406
112 Ga0157372_10091538 3300013307 Bacteria 3459
113 Ga0157372_10135941 3300013307 Bacteria 2831
114 Ga0157372_10136473 3300013307 Bacteria 2825
115 Ga0157372_10136495 3300013307 Bacteria 2825
116 Ga0157372_10151131 3300013307 Bacteria 2680
117 Ga0157372_10153534 3300013307 Bacteria 2659
118 Ga0157372_11239441 3300013307 Bacteria 861
119 Ga0182008_10012569 3300014497 Bacteria 4468
120 Ga0182008_10061865 3300014497 Bacteria 1845
121 Ga0182006_1000047 3300015261 Bacteria 187006
122 Ga0182006_1063777 3300015261 Bacteria 1383
123 Ga0182006_1103890 3300015261 Bacteria 1005
124 Ga0182007_10004870 3300015262 Bacteria 5999
125 Ga0183366_1001 3300015679 Bacteria 2743932
126 Ga0183370_1001 3300015680 Bacteria 2743932
127 Ga0183369_1001 3300015685 Bacteria 2743932
128 Ga0183368_1001 3300015687 Bacteria 2743932
129 Ga0183360_12263 3300015689 Bacteria 720
130 Ga0163161_10000001 3300017792 Bacteria 2041488
131 Ga0163161_10043717 3300017792 Bacteria 3226
132 Ga0163161_10154198 3300017792 Bacteria 1748
133 Ga0213876_10000055 3300021384 Bacteria 136037
134 Ga0209437_100109 3300025233 Bacteria 217031
135 Ga0209437_100111 3300025233 Bacteria 214944
136 Ga0207425_1056135 3300025245 Bacteria 706
137 Ga0209129_1000004 3300025258 Bacteria 884499
138 Ga0207696_1000001 3300025711 Bacteria 2579611
139 Ga0207696_1000028 3300025711 Bacteria 400424
140 Ga0207696_1000086 3300025711 Bacteria 194626
141 Ga0207696_1000116 3300025711 Bacteria 148125
142 Ga0207696_1000439 3300025711 Bacteria 37274
143 Ga0207696_1001155 3300025711 Bacteria 15182
144 Ga0207696_1011301 3300025711 Bacteria 3225
145 Ga0207696_1015761 3300025711 Bacteria 2550
146 Ga0207696_1087656 3300025711 Bacteria 855
147 Ga0207696_1140860 3300025711 Bacteria 646
148 Ga0207655_1000001 3300025728 Bacteria 1866413
149 Ga0207655_1000004 3300025728 Bacteria 1021221
150 Ga0207655_1000009 3300025728 Bacteria 664676
151 Ga0207655_1000037 3300025728 Bacteria 354473
152 Ga0207655_1000089 3300025728 Bacteria 204720
153 Ga0207655_1000426 3300025728 Bacteria 56714
154 Ga0207655_1000741 3300025728 Bacteria 36714
155 Ga0207655_1003187 3300025728 Bacteria 12363
156 Ga0207655_1005530 3300025728 Bacteria 8571
157 Ga0207655_1023618 3300025728 Bacteria 3043
158 Ga0207655_1031532 3300025728 Bacteria 2441
159 Ga0207655_1033803 3300025728 Bacteria 2311
160 Ga0207655_1065702 3300025728 Bacteria 1375
161 Ga0207655_1103167 3300025728 Bacteria 978
162 Ga0207713_1000001 3300025735 Bacteria 2295391
163 Ga0207713_1000002 3300025735 Bacteria 1061749
164 Ga0207713_1000003 3300025735 Bacteria 860698
165 Ga0207713_1000012 3300025735 Bacteria 501860
166 Ga0207713_1001881 3300025735 Bacteria 15941
167 Ga0207713_1001893 3300025735 Bacteria 15874
168 Ga0207713_1022141 3300025735 Bacteria 3025
169 Ga0207713_1024919 3300025735 Bacteria 2775
170 Ga0207713_1025638 3300025735 Bacteria 2717
171 Ga0207713_1027575 3300025735 Bacteria 2578
172 Ga0207713_1031649 3300025735 Bacteria 2335
173 Ga0207713_1044384 3300025735 Bacteria 1826
174 Ga0207713_1052019 3300025735 Bacteria 1625
175 Ga0207710_10000688 3300025900 Bacteria 18942
176 Ga0207654_10000005 3300025911 Bacteria 869492
177 Ga0207695_10547966 3300025913 Bacteria 1038
178 Ga0207657_10885832 3300025919 Bacteria 688
179 Ga0207690_10110345 3300025932 Bacteria 1980
180 Ga0207709_10329772 3300025935 Bacteria 1145
181 Ga0207668_10005192 3300025972 Bacteria 7662
182 Ga0207674_10008762 3300026116 Bacteria 11647
183 Ga0209281_1000001 3300027111 Bacteria 1933496
184 Ga0209281_1000003 3300027111 Bacteria 1260089
185 Ga0209281_1000130 3300027111 Bacteria 191756
186 Ga0209281_1000394 3300027111 Bacteria 68048
187 Ga0209281_1000428 3300027111 Bacteria 62540
188 Ga0209281_1000598 3300027111 Bacteria 41043
189 Ga0209281_1000713 3300027111 Bacteria 33360
190 Ga0209281_1001045 3300027111 Bacteria 20990
191 Ga0209281_1001234 3300027111 Bacteria 16952
192 Ga0209281_1002684 3300027111 Bacteria 6726
193 Ga0209281_1002778 3300027111 Bacteria 6484
194 Ga0209281_1009891 3300027111 Bacteria 2213
195 Ga0209281_1023124 3300027111 Bacteria 1182
196 Ga0209371_1000001 3300027312 Bacteria 2771503
197 Ga0209371_1000002 3300027312 Bacteria 1551985
198 Ga0209371_1000041 3300027312 Bacteria 340377
199 Ga0209371_1000122 3300027312 Bacteria 132545
200 Ga0209371_1000188 3300027312 Bacteria 90102
201 Ga0209371_1000492 3300027312 Bacteria 38527
202 Ga0209371_1000862 3300027312 Bacteria 24564
203 Ga0209371_1001378 3300027312 Bacteria 16753
204 Ga0209371_1001914 3300027312 Bacteria 12710
205 Ga0209371_1002701 3300027312 Bacteria 9581
206 Ga0209371_1004166 3300027312 Bacteria 6457
207 Ga0209371_1006169 3300027312 Bacteria 4523
208 Ga0209371_1008701 3300027312 Bacteria 3327
209 Ga0209371_1015747 3300027312 Bacteria 2019
210 Ga0209371_1025704 3300027312 Bacteria 1350
211 Ga0268266_10001643 3300028379 Bacteria 25908
212 Ga0268266_10176100 3300028379 Bacteria 1945
213 Ga0268266_10458847 3300028379 Bacteria 1212
214 Ga0268256_1000001 3300030500 Bacteria 2771065
215 Ga0268256_1000002 3300030500 Bacteria 1535763
216 Ga0268256_1000003 3300030500 Bacteria 1289401
217 Ga0268256_1000048 3300030500 Bacteria 312298
218 Ga0268256_1000051 3300030500 Bacteria 283626
219 Ga0268256_1000718 3300030500 Bacteria 24564
220 Ga0268256_1000844 3300030500 Bacteria 21767
221 Ga0268256_1001182 3300030500 Bacteria 16753
222 Ga0268256_1003795 3300030500 Bacteria 6609
223 Ga0268256_1003845 3300030500 Bacteria 6547
224 Ga0268256_1005092 3300030500 Bacteria 5247
225 Ga0268256_1014957 3300030500 Bacteria 2282
226 Ga0268256_1017465 3300030500 Bacteria 2019
227 Ga0268256_1020568 3300030500 Bacteria 1776
228 Ga0268256_1021290 3300030500 Bacteria 1727
229 Ga0268256_1029248 3300030500 Bacteria 1350
230 Ga0316183_1036227 3300030742 Bacteria 1084
231 Ga0436365_0971002 3300039437 Bacteria 167792
232 Ga0439438_000001 3300041405 Bacteria 1263568
233 Ga0439438_000780 3300041405 Bacteria 14167
234 Ga0439438_003644 3300041405 Bacteria 6161
235 Ga0439438_064234 3300041405 Bacteria 915
236 Ga0439447_001075 3300041407 Bacteria 9908
237 Ga0439447_012292 3300041407 Bacteria 2465
238 Ga0439447_037244 3300041407 Bacteria 1199
239 Ga0439466_0000047 3300041411 Bacteria 48861
240 Ga0451795_0281698 3300041456 Bacteria 802
241 Ga0451851_0463627 3300041507 Bacteria 861
242 Ga0451853_2415421 3300041512 Bacteria 2005
243 Ga0439432_007155 3300042006 Bacteria 3965
244 Ga0439452_000001 3300042010 Bacteria 1725439
245 Ga0439452_000002 3300042010 Bacteria 1377577
246 Ga0439452_000008 3300042010 Bacteria 569877
247 Ga0439452_000142 3300042010 Bacteria 54077
248 Ga0439452_000298 3300042010 Bacteria 31875
249 Ga0439452_004971 3300042010 Bacteria 4353
250 Ga0439452_008982 3300042010 Bacteria 2974
251 Ga0439463_013057 3300042016 Bacteria 2043
252 Ga0450902_004993 3300042137 Bacteria 1992
253 Ga0450907_000190 3300042146 Bacteria 22431
254 Ga0439464_0004724 3300042439 Bacteria 3489
255 Ga0466981_0000002 3300044669 Bacteria 313036
256 Ga0495617_144940 3300046452 Bacteria 757
257 Ga0495627_000116 3300046453 Bacteria 99916
258 Ga0495591_000013 3300046458 Bacteria 268106
259 Ga0495591_000100 3300046458 Bacteria 99473
260 Ga0495591_001263 3300046458 Bacteria 16217
261 Ga0495591_008046 3300046458 Bacteria 4374
262 Ga0495591_024495 3300046458 Bacteria 1912
263 Ga0495638_0013681 3300046460 Bacteria 5513
264 Ga0495650_0000005 3300046471 Bacteria 766553
265 Ga0495650_0000187 3300046471 Bacteria 136554
266 Ga0495650_0018297 3300046471 Bacteria 3485
267 Ga0495605_0175271 3300046474 Bacteria 945
268 Ga0495585_0011587 3300046492 Bacteria 5213
269 Ga0495596_0068312 3300046500 Bacteria 1381
270 Ga0495607_0017775 3300046501 Bacteria 4553
271 Ga0495606_0003762 3300046507 Bacteria 15779
272 Ga0495616_0019995 3300046513 Bacteria 3649
273 Ga0495616_0074199 3300046513 Bacteria 1640
274 Ga0495620_0008470 3300046515 Bacteria 5518
275 Ga0495631_0146953 3300046518 Bacteria 1012
276 Ga0495643_0013064 3300046522 Bacteria 4989
277 Ga0495643_0118752 3300046522 Bacteria 1338
278 Ga0495643_0198065 3300046522 Bacteria 966
279 Ga0495644_0000573 3300046523 Bacteria 15420
280 Ga0495648_0002343 3300046524 Bacteria 17587
281 Ga0495654_0000041 3300046530 Bacteria 174733
282 Ga0495654_0000173 3300046530 Bacteria 63665
283 Ga0495654_0024026 3300046530 Bacteria 3152
284 Ga0495654_0056615 3300046530 Bacteria 1894
285 Ga0495597_0001631 3300046542 Bacteria 15710
286 Ga0495597_0426443 3300046542 Bacteria 502
287 Ga0495668_0014499 3300046616 Bacteria 4620
288 Ga0495625_0016408 3300046660 Bacteria 5831
289 Ga0495588_0003244 3300046674 Bacteria 7055
290 Ga0495649_0001886 3300046694 Bacteria 15339
291 Ga0495649_0009622 3300046694 Bacteria 5729
292 Ga0495649_0062128 3300046694 Bacteria 2008
293 Ga0495649_0134116 3300046694 Bacteria 1306
294 Ga0495589_0000004 3300046794 Bacteria 439891
295 Ga0495589_0005519 3300046794 Bacteria 6671
296 Ga0495660_0000171 3300046810 Bacteria 70062
297 Ga0495660_0018425 3300046810 Bacteria 4014
298 Ga0495672_0000002 3300047320 Bacteria 740116
299 Ga0495672_0000020 3300047320 Bacteria 432845
300 Ga0495672_0000043 3300047320 Bacteria 266893
301 Ga0495683_0177111 3300047323 Bacteria 976
302 Ga0495679_000282 3300047446 Bacteria 42194
303 Ga0495679_030015 3300047446 Bacteria 1768
304 Ga0495679_042382 3300047446 Bacteria 1404
305 Ga0495673_0000070 3300047469 Bacteria 217453
306 Ga0495673_0000167 3300047469 Bacteria 111793
307 Ga0495681_0034218 3300047470 Bacteria 2534
308 Ga0495681_0266829 3300047470 Bacteria 671
309 Ga0496100_0004919 3300048903 Bacteria 7138
310 Ga0496100_0024451 3300048903 Bacteria 3685
311 Ga0496101_0000055 3300048904 Bacteria 136176
312 Ga0496101_1211246 3300048904 Bacteria 591
313 Ga0496102_0039301 3300048905 Bacteria 4275
314 Ga0496103_0064563 3300048906 Bacteria 2282
315 Ga0496104_0000555 3300048907 Bacteria 31796
316 Ga0496104_0080007 3300048907 Bacteria 3115
317 Ga0496105_0210119 3300048908 Bacteria 1586
318 Ga0496106_0166613 3300048909 Bacteria 1744
319 Ga0496110_0113885 3300048913 Bacteria 2433
320 Ga0496116_0000001 3300048919 Bacteria 1501681
321 Ga0496116_0000122 3300048919 Bacteria 162802
322 Ga0496116_0001125 3300048919 Bacteria 31904
323 Ga0496116_0008548 3300048919 Bacteria 8868
324 Ga0496116_0012630 3300048919 Bacteria 6879
325 Ga0496116_0026100 3300048919 Bacteria 4279
326 Ga0496116_0029850 3300048919 Bacteria 3924
327 Ga0496116_0059965 3300048919 Bacteria 2470
328 Ga0496116_0066090 3300048919 Bacteria 2315
329 Ga0496116_0071694 3300048919 Bacteria 2192
330 Ga0496116_0284418 3300048919 Bacteria 798
331 Ga0496116_0343166 3300048919 Bacteria 687
332 Ga0496117_0000004 3300048920 Bacteria 877131
333 Ga0496117_0000165 3300048920 Bacteria 139029
334 Ga0496117_0000399 3300048920 Bacteria 74064
335 Ga0496117_0002525 3300048920 Bacteria 22922
336 Ga0496117_0003424 3300048920 Bacteria 18450
337 Ga0496117_0004066 3300048920 Bacteria 16424
338 Ga0496117_0020640 3300048920 Bacteria 5364
339 Ga0496117_0070195 3300048920 Bacteria 2354
340 Ga0496117_0078705 3300048920 Bacteria 2175
341 Ga0496117_0098713 3300048920 Bacteria 1855
342 Ga0496117_0133652 3300048920 Bacteria 1498
343 Ga0496117_0330587 3300048920 Bacteria 794
344 Ga0496118_0000007 3300048921 Bacteria 650986
345 Ga0496118_0000015 3300048921 Bacteria 551359
346 Ga0496118_0001126 3300048921 Bacteria 41304
347 Ga0496118_0002525 3300048921 Bacteria 24537
348 Ga0496118_0002850 3300048921 Bacteria 22564
349 Ga0496118_0012799 3300048921 Bacteria 8007
350 Ga0496118_0021142 3300048921 Bacteria 5738
351 Ga0496118_0026635 3300048921 Bacteria 4917
352 Ga0496118_0058479 3300048921 Bacteria 2880
353 Ga0496118_0074961 3300048921 Bacteria 2415
354 Ga0496118_0078771 3300048921 Bacteria 2329
355 Ga0496118_0124555 3300048921 Bacteria 1671
356 Ga0496118_0243824 3300048921 Bacteria 1026
357 Ga0496119_0000066 3300048922 Bacteria 162680
358 Ga0496119_0000095 3300048922 Bacteria 129683
359 Ga0496119_0000911 3300048922 Bacteria 38310
360 Ga0496119_0001967 3300048922 Bacteria 23367
361 Ga0496119_0002594 3300048922 Bacteria 19628
362 Ga0496119_0004815 3300048922 Bacteria 13237
363 Ga0496119_0012013 3300048922 Bacteria 7086
364 Ga0496119_0019406 3300048922 Bacteria 5009
365 Ga0496119_0019524 3300048922 Bacteria 4986
366 Ga0496119_0024425 3300048922 Bacteria 4252
367 Ga0496119_0028114 3300048922 Bacteria 3846
368 Ga0496119_0041327 3300048922 Bacteria 2937
369 Ga0496119_0047845 3300048922 Bacteria 2657
370 Ga0496119_0052124 3300048922 Bacteria 2508
371 Ga0496119_0057505 3300048922 Bacteria 2349
372 Ga0496119_0404606 3300048922 Bacteria 650
373 Ga0496119_0404610 3300048922 Bacteria 650
374 Ga0496120_0000380 3300048923 Bacteria 71773
375 Ga0496120_0000928 3300048923 Bacteria 40566
376 Ga0496120_0001267 3300048923 Bacteria 31661
377 Ga0496120_0001332 3300048923 Bacteria 30475
378 Ga0496120_0002342 3300048923 Bacteria 19477
379 Ga0496120_0003408 3300048923 Bacteria 14539
380 Ga0496120_0003965 3300048923 Bacteria 12868
381 Ga0496120_0015425 3300048923 Bacteria 5041
382 Ga0496120_0033071 3300048923 Bacteria 3110
383 Ga0496120_0034345 3300048923 Bacteria 3038
384 Ga0496120_0036212 3300048923 Bacteria 2939
385 Ga0496120_0051548 3300048923 Bacteria 2349
386 Ga0496120_0051738 3300048923 Bacteria 2343
387 Ga0496120_0098899 3300048923 Bacteria 1545
388 Ga0496120_0203036 3300048923 Bacteria 958
389 Ga0496121_0002250 3300048924 Bacteria 30081
390 Ga0496121_0003016 3300048924 Bacteria 24450
391 Ga0496121_0009694 3300048924 Bacteria 11027
392 Ga0496121_0025872 3300048924 Bacteria 5552
393 Ga0496121_0035157 3300048924 Bacteria 4495
394 Ga0496121_0041269 3300048924 Bacteria 4036
395 Ga0496121_0042151 3300048924 Bacteria 3976
396 Ga0496121_0132821 3300048924 Bacteria 1859
397 Ga0496122_0000005 3300048925 Bacteria 630659
398 Ga0496122_0000738 3300048925 Bacteria 63772
399 Ga0496122_0001357 3300048925 Bacteria 39885
400 Ga0496122_0004143 3300048925 Bacteria 18310
401 Ga0496122_0004902 3300048925 Bacteria 16231
402 Ga0496122_0025084 3300048925 Bacteria 5194
403 Ga0496122_0035140 3300048925 Bacteria 4085
404 Ga0496122_0048348 3300048925 Bacteria 3272
405 Ga0496122_0076418 3300048925 Bacteria 2356
406 Ga0496122_0129525 3300048925 Bacteria 1607
407 Ga0496122_0242251 3300048925 Bacteria 1015
408 Ga0496122_0621717 3300048925 Bacteria 501
409 Ga0496123_0000008 3300048926 Bacteria 630628
410 Ga0496123_0001127 3300048926 Bacteria 39885
411 Ga0496123_0001322 3300048926 Bacteria 35015
412 Ga0496123_0002433 3300048926 Bacteria 23152
413 Ga0496123_0016228 3300048926 Bacteria 6059
414 Ga0496123_0020012 3300048926 Bacteria 5253
415 Ga0496123_0022150 3300048926 Bacteria 4907
416 Ga0496123_0022151 3300048926 Bacteria 4907
417 Ga0496123_0032182 3300048926 Bacteria 3802
418 Ga0496123_0037225 3300048926 Bacteria 3438
419 Ga0496123_0072449 3300048926 Bacteria 2143
420 Ga0496124_0000107 3300048927 Bacteria 168020
421 Ga0496124_0000196 3300048927 Bacteria 119375
422 Ga0496124_0000564 3300048927 Bacteria 62677
423 Ga0496124_0001459 3300048927 Bacteria 34893
424 Ga0496124_0012635 3300048927 Bacteria 8309
425 Ga0496124_0023875 3300048927 Bacteria 5570
426 Ga0496124_0037522 3300048927 Bacteria 4213
427 Ga0496124_0039404 3300048927 Bacteria 4096
428 Ga0496124_0052365 3300048927 Bacteria 3467
429 Ga0496124_0055208 3300048927 Bacteria 3358
430 Ga0496124_0061227 3300048927 Bacteria 3155
431 Ga0496124_0078754 3300048927 Bacteria 2715
432 Ga0496124_0087826 3300048927 Bacteria 2542
433 Ga0496124_0115344 3300048927 Bacteria 2155
434 Ga0496124_0181601 3300048927 Bacteria 1618
435 Ga0496124_0185745 3300048927 Bacteria 1595
436 Ga0496124_0201820 3300048927 Bacteria 1511
437 Ga0496124_0369924 3300048927 Bacteria 1006
438 Ga0496124_0430311 3300048927 Bacteria 906
439 Ga0496124_0826659 3300048927 Bacteria 570
440 Ga0496125_0001712 3300048928 Bacteria 30528
441 Ga0496125_0005660 3300048928 Bacteria 13790
442 Ga0496125_0007075 3300048928 Bacteria 11984
443 Ga0496125_0017105 3300048928 Bacteria 6928
444 Ga0496125_0020297 3300048928 Bacteria 6237
445 Ga0496125_0024785 3300048928 Bacteria 5507
446 Ga0496125_0035149 3300048928 Bacteria 4402
447 Ga0496125_0040085 3300048928 Bacteria 4022
448 Ga0496125_0068488 3300048928 Bacteria 2791
449 Ga0496125_0164721 3300048928 Bacteria 1500
450 Ga0496126_0000779 3300048929 Bacteria 57561
451 Ga0496126_0002347 3300048929 Bacteria 25872
452 Ga0496126_0005096 3300048929 Bacteria 15231
453 Ga0496126_0020256 3300048929 Bacteria 6528
454 Ga0496126_0065137 3300048929 Bacteria 3261
455 Ga0496126_0081541 3300048929 Bacteria 2859
456 Ga0496126_0087399 3300048929 Bacteria 2746
457 Ga0496126_0196318 3300048929 Bacteria 1706
458 Ga0496126_0232083 3300048929 Bacteria 1546
459 Ga0496126_0253195 3300048929 Bacteria 1466
460 Ga0495678_000591 3300049459 Bacteria 34139
461 Ga0495678_150401 3300049459 Bacteria 752
462 Ga0495682_0000001 3300049460 Bacteria 1559116
463 nmdc:mga00v17_103731_c1 3300050491 Bacteria 1797
464 nmdc:mga00v17_10398_c1 3300050491 Bacteria 5078
465 nmdc:mga00v17_193113_c1 3300050491 Bacteria 1315
466 nmdc:mga00v17_19985_c1 3300050491 Bacteria 3831
467 nmdc:mga00v17_619798_c1 3300050491 Bacteria 697
468 Ga0500621_000003 3300053126 Bacteria 596975
469 2506578193 2506520007 Bacteria 5442880
470 2506583331 2506520008 Bacteria 5443009
471 2508852210 2508501071 Bacteria 5454741
472 2511378924 2511231025 Bacteria 5324661
473 2511437157 2511231035 Bacteria 5341610
474 2547695175 2547132181 Bacteria 4945084
475 2555257429 2554235234 Bacteria 5762085
476 2562462963 2561511199 Bacteria 5155034
477 2585825450 2585427591 Bacteria 5482980
478 2585832068 2585427592 Bacteria 5370892
479 2599925468 2599185299 Bacteria 4854625
480 2601535283 2600255256 Bacteria 5597742
481 2601540846 2600255257 Bacteria 5597196
482 2601758465 2600255310 Bacteria 5600903
483 2601764575 2600255311 Bacteria 5598766
484 2603638182 2602042046 Bacteria 5483348
485 2603642690 2602042047 Bacteria 4697674
486 2603698266 2602042066 Bacteria 4423871
487 2603703280 2602042067 Bacteria 4863713
488 2608669283 2608642108 Bacteria 4104624
489 2609913474 2609459761 Bacteria 5513740
490 2650898803 2648501693 Bacteria 5069560
491 2656275239 2654587920 Bacteria 5475511
492 2671103217 2667528172 Bacteria 5170840
493 2671588316 2671180115 Bacteria 5353919
494 2681997636 2681812866 Bacteria 4552357
495 2682006842 2681812869 Bacteria 5014465
496 2686353187 2684622997 Bacteria 4624240
497 2689444743 2687453601 Bacteria 5546041
498 2712469815 2711768156 Bacteria 4471618
499 2753855714 2751185917 Bacteria 4551186
500 2765588707 2765235842 Bacteria 4799256
501 2772438797 2772190666 Bacteria 5117644
502 2775538714 2775506706 Bacteria 4873073
503 2791922469 2791354903 Bacteria 4937680
504 2792314815 2791355010 Bacteria 4864581
505 2793405750 2791355275 Bacteria 4429597
506 2807179449 2806310673 Bacteria 4801221
507 2809123762 2808606414 Bacteria 4917181
508 2813729158 2811995292 Bacteria 5303342
509 2814696724 2814123068 Bacteria 5687681
510 2821119520 2821118458 Bacteria 4714306
511 2823374496 2823373977 Bacteria 4779415
512 2844427266 2844425489 Bacteria 4854065
513 2844530820 2844528606 Bacteria 4733806
514 2847087809 2847085930 Bacteria 5070450
515 2847800034 2847797336 Bacteria 5176640
516 2852107778 2852103415 Bacteria 5193810
517 2854604470 2854601825 Bacteria 4797592
518 2855195972 2855195626 Bacteria 4927512
519 2858468942 2858466076 Bacteria 4722413
520 2865015109 2865014394 Bacteria 4764573
521 2869554143 2869551831 Bacteria 5474685
522 2871286323 2871282230 Bacteria 4917173
523 2876604392 2876601092 Bacteria 5114497
524 2881610074 2881609920 Bacteria 4405319
525 2884089081 2884086401 Bacteria 5005459
526 2888368818 2888366609 Bacteria 5155009
527 2888378480 2888373701 Bacteria 5098052
528 2891672936 2891670763 Bacteria 4967099
529 2900052694 2900051742 Bacteria 4985156
530 2904504982 2904504865 Bacteria 5152820
531 2908670033 2908669403 Bacteria 5740494
532 2919108625 2919108558 Bacteria 5897419
533 2923634587 2923634449 Bacteria 4753480
534 2927834364 2927833300 Bacteria 4923934
535 2932408195 2932406140 Bacteria 5134491
536 2935626897 2935625433 Bacteria 5042964
537 2937540293 2937539931 Bacteria 4639830
538 2937967411 2937967321 Bacteria 5094075
539 2939568911 2939568625 Bacteria 4542555
540 2939578652 2939577877 Bacteria 5132791
541 2939603463 2939602548 Bacteria 4950493
542 2939607713 2939607340 Bacteria 4719256
543 2939619360 2939617950 Bacteria 4820956
544 2939644042 2939642701 Bacteria 4475280
545 2945877467 2945874760 Bacteria 5527237
546 2945953147 2945951305 Bacteria 4918162
547 2971823193 2971820967 Bacteria 5823634
548 2974312374 2974310843 Bacteria 4947816
549 2974438237 2974435778 Bacteria 4876478
550 2978975671 2978975091 Bacteria 4704313
551 2984496472 2984494565 Bacteria 5000175
552 2990261893 2990261002 Bacteria 4919493
553 3000378725 3000376612 Bacteria 4705565
554 640937720 640753048 Bacteria 5495657
555 8004595705 8004592986 Bacteria 5122074
556 8015396365 8015394850 Bacteria 5064660
557 8016736076 8016733728 Bacteria 5274317
558 8018224901 8018221730 Bacteria 4616064
559 8018408403 8018405270 Bacteria 4978981
560 8019502821 8019499862 Bacteria 5169538
561 8019506244 8019504834 Bacteria 4819156
562 8054845643 8054844752 Bacteria 4450330
563 8054853021 8054849141 Bacteria 5232694
564 8055091034 8055087960 Bacteria 4784273
565 8055094461 8055092621 Bacteria 4873875
566 8055099874 8055097453 Bacteria 4865496
567 8057309461 8057304971 Bacteria 4649742
568 Ga0495654_0001003
569 RicEn_C1036
570 SwRhRL2b_contig_1408841
571 SwRhRL2b_contig_3004390
572 SwRhRL2b_contig_3802247
573 SwRhRL2b_contig_523597
574 JGI24739J22299_10022450
575 JGI24739J22299_10044604
576 JGI25162J39368_1001236
577 Ga0058692_1001974
578 Ga0058692_1002212
579 Ga0058692_1002227
580 Ga0058692_1003743
581 Ga0058692_1014570
582 Ga0058692_1027387
583 Ga0058692_1031757
584 Ga0058692_1073055
585 Ga0065703_1020579
586 Ga0065704_10028406
587 Ga0065704_10076080
588 Ga0065704_10090194
589 Ga0065704_10128963
590 Ga0070660_100439592
591 Ga0070668_100025488
592 Ga0070659_100013636
593 Ga0070665_100000595
594 Ga0070665_100603003
595 Ga0068857_100010323
596 Ga0075364_10004121
597 Ga0075364_10042276
598 Ga0075364_10115181
599 Ga0075364_10222281
600 Ga0079104_1000611
601 Ga0079104_1000775
602 Ga0079104_1001375
603 Ga0079104_1001480
604 Ga0079104_1002634
605 Ga0079104_1005813
606 Ga0079104_1006832
607 Ga0079104_1013223
608 Ga0079104_1023680
609 Ga0079104_1024753
610 Ga0079104_1093671
611 Ga0079104_1093691
612 Ga0099826_10170406
613 Ga0105251_10000752
614 Ga0105251_10001038
615 Ga0105251_10002124
616 Ga0105251_10002144
617 Ga0105251_10008328
618 Ga0105251_10010747
619 Ga0105251_10017695
620 Ga0105251_10019020
621 Ga0105251_10026494
622 Ga0105251_10027672
623 Ga0105251_10049649
624 Ga0105251_10084902
625 Ga0105251_10341772
626 Ga0105251_10497452
627 Ga0105251_10548660
628 Ga0105244_10000104
629 Ga0105244_10000330
630 Ga0105244_10000586
631 Ga0105244_10000865
632 Ga0105244_10001499
633 Ga0105244_10018889
634 Ga0105244_10021770
635 Ga0105244_10030233
636 Ga0105244_10034307
637 Ga0105244_10038819
638 Ga0105244_10040876
639 Ga0105244_10131581
640 Ga0105244_10142802
641 Ga0105244_10280822
642 Ga0105244_10359498
643 Ga0105250_10000001
644 Ga0105250_10000448
645 Ga0105250_10003065
646 Ga0105250_10007391
647 Ga0105250_10029116
648 Ga0105250_10035900
649 Ga0105250_10077457
650 Ga0105250_10133173
651 Ga0105250_10140422
652 Ga0105250_10266759
653 Ga0105250_10366303
654 Ga0105240_10664239
655 Ga0105247_10000138
656 Ga0105243_10515809
657 Ga0105241_10000002
658 Ga0105237_10904960
659 Ga0105246_10129560
660 Ga0105246_10145899
661 Ga0157373_10000500
662 Ga0157373_10000783
663 Ga0157373_10027932
664 Ga0157373_10054659
665 Ga0157373_10786395
666 Ga0157373_11564832
667 Ga0157371_10000099
668 Ga0157371_10001578
669 Ga0157371_10016739
670 Ga0157371_10053195
671 Ga0157371_10066171
672 Ga0157370_10000234
673 Ga0157370_10006551
674 Ga0157370_10015259
675 Ga0157369_10030301
676 Ga0157369_10032764
677 Ga0163162_10035335
678 Ga0157372_10014588
679 Ga0157372_10091538
680 Ga0157372_10135941
681 Ga0157372_10136473
682 Ga0157372_10136495
683 Ga0157372_10151131
684 Ga0157372_10153534
685 Ga0157372_11239441
686 Ga0182008_10012569
687 Ga0182008_10061865
688 Ga0182006_1000047
689 Ga0182006_1063777
690 Ga0182006_1103890
691 Ga0182007_10004870
692 Ga0183366_1001
693 Ga0183370_1001
694 Ga0183369_1001
695 Ga0183368_1001
696 Ga0183360_12263
697 Ga0163161_10000001
698 Ga0163161_10043717
699 Ga0163161_10154198
700 Ga0213876_10000055
701 Ga0209437_100109
702 Ga0209437_100111
703 Ga0207425_1056135
704 Ga0209129_1000004
705 Ga0207696_1000001
706 Ga0207696_1000028
707 Ga0207696_1000086
708 Ga0207696_1000116
709 Ga0207696_1000439
710 Ga0207696_1001155
711 Ga0207696_1011301
712 Ga0207696_1015761
713 Ga0207696_1087656
714 Ga0207696_1140860
715 Ga0207655_1000001
716 Ga0207655_1000004
717 Ga0207655_1000009
718 Ga0207655_1000037
719 Ga0207655_1000089
720 Ga0207655_1000426
721 Ga0207655_1000741
722 Ga0207655_1003187
723 Ga0207655_1005530
724 Ga0207655_1023618
725 Ga0207655_1031532
726 Ga0207655_1033803
727 Ga0207655_1065702
728 Ga0207655_1103167
729 Ga0207713_1000001
730 Ga0207713_1000002
731 Ga0207713_1000003
732 Ga0207713_1000012
733 Ga0207713_1001881
734 Ga0207713_1001893
735 Ga0207713_1022141
736 Ga0207713_1024919
737 Ga0207713_1025638
738 Ga0207713_1027575
739 Ga0207713_1031649
740 Ga0207713_1044384
741 Ga0207713_1052019
742 Ga0207710_10000688
743 Ga0207654_10000005
744 Ga0207695_10547966
745 Ga0207657_10885832
746 Ga0207690_10110345
747 Ga0207709_10329772
748 Ga0207668_10005192
749 Ga0207674_10008762
750 Ga0209281_1000001
751 Ga0209281_1000003
752 Ga0209281_1000130
753 Ga0209281_1000394
754 Ga0209281_1000428
755 Ga0209281_1000598
756 Ga0209281_1000713
757 Ga0209281_1001045
758 Ga0209281_1001234
759 Ga0209281_1002684
760 Ga0209281_1002778
761 Ga0209281_1009891
762 Ga0209281_1023124
763 Ga0209371_1000001
764 Ga0209371_1000002
765 Ga0209371_1000041
766 Ga0209371_1000122
767 Ga0209371_1000188
768 Ga0209371_1000492
769 Ga0209371_1000862
770 Ga0209371_1001378
771 Ga0209371_1001914
772 Ga0209371_1002701
773 Ga0209371_1004166
774 Ga0209371_1006169
775 Ga0209371_1008701
776 Ga0209371_1015747
777 Ga0209371_1025704
778 Ga0268266_10001643
779 Ga0268266_10176100
780 Ga0268266_10458847
781 Ga0268256_1000001
782 Ga0268256_1000002
783 Ga0268256_1000003
784 Ga0268256_1000048
785 Ga0268256_1000051
786 Ga0268256_1000718
787 Ga0268256_1000844
788 Ga0268256_1001182
789 Ga0268256_1003795
790 Ga0268256_1003845
791 Ga0268256_1005092
792 Ga0268256_1014957
793 Ga0268256_1017465
794 Ga0268256_1020568
795 Ga0268256_1021290
796 Ga0268256_1029248
797 Ga0316183_1036227
798 Ga0436365_0971002
799 Ga0439438_000001
800 Ga0439438_000780
801 Ga0439438_003644
802 Ga0439438_064234
803 Ga0439447_001075
804 Ga0439447_012292
805 Ga0439447_037244
806 Ga0439466_0000047
807 Ga0451795_0281698
808 Ga0451851_0463627
809 Ga0451853_2415421
810 Ga0439432_007155
811 Ga0439452_000001
812 Ga0439452_000002
813 Ga0439452_000008
814 Ga0439452_000142
815 Ga0439452_000298
816 Ga0439452_004971
817 Ga0439452_008982
818 Ga0439463_013057
819 Ga0450902_004993
820 Ga0450907_000190
821 Ga0439464_0004724
822 Ga0466981_0000002
823 Ga0495617_144940
824 Ga0495627_000116
825 Ga0495591_000013
826 Ga0495591_000100
827 Ga0495591_001263
828 Ga0495591_008046
829 Ga0495591_024495
830 Ga0495638_0013681
831 Ga0495650_0000005
832 Ga0495650_0000187
833 Ga0495650_0018297
834 Ga0495605_0175271
835 Ga0495585_0011587
836 Ga0495596_0068312
837 Ga0495607_0017775
838 Ga0495606_0003762
839 Ga0495616_0019995
840 Ga0495616_0074199
841 Ga0495620_0008470
842 Ga0495631_0146953
843 Ga0495643_0013064
844 Ga0495643_0118752
845 Ga0495643_0198065
846 Ga0495644_0000573
847 Ga0495648_0002343
848 Ga0495654_0000041
849 Ga0495654_0000173
850 Ga0495654_0024026
851 Ga0495654_0056615
852 Ga0495597_0001631
853 Ga0495597_0426443
854 Ga0495668_0014499
855 Ga0495625_0016408
856 Ga0495588_0003244
857 Ga0495649_0001886
858 Ga0495649_0009622
859 Ga0495649_0062128
860 Ga0495649_0134116
861 Ga0495589_0000004
862 Ga0495589_0005519
863 Ga0495660_0000171
864 Ga0495660_0018425
865 Ga0495672_0000002
866 Ga0495672_0000020
867 Ga0495672_0000043
868 Ga0495683_0177111
869 Ga0495679_000282
870 Ga0495679_030015
871 Ga0495679_042382
872 Ga0495673_0000070
873 Ga0495673_0000167
874 Ga0495681_0034218
875 Ga0495681_0266829
876 Ga0496100_0004919
877 Ga0496100_0024451
878 Ga0496101_0000055
879 Ga0496101_1211246
880 Ga0496102_0039301
881 Ga0496103_0064563
882 Ga0496104_0000555
883 Ga0496104_0080007
884 Ga0496105_0210119
885 Ga0496106_0166613
886 Ga0496110_0113885
887 Ga0496116_0000001
888 Ga0496116_0000122
889 Ga0496116_0001125
890 Ga0496116_0008548
891 Ga0496116_0012630
892 Ga0496116_0026100
893 Ga0496116_0029850
894 Ga0496116_0059965
895 Ga0496116_0066090
896 Ga0496116_0071694
897 Ga0496116_0284418
898 Ga0496116_0343166
899 Ga0496117_0000004
900 Ga0496117_0000165
901 Ga0496117_0000399
902 Ga0496117_0002525
903 Ga0496117_0003424
904 Ga0496117_0004066
905 Ga0496117_0020640
906 Ga0496117_0070195
907 Ga0496117_0078705
908 Ga0496117_0098713
909 Ga0496117_0133652
910 Ga0496117_0330587
911 Ga0496118_0000007
912 Ga0496118_0000015
913 Ga0496118_0001126
914 Ga0496118_0002525
915 Ga0496118_0002850
916 Ga0496118_0012799
917 Ga0496118_0021142
918 Ga0496118_0026635
919 Ga0496118_0058479
920 Ga0496118_0074961
921 Ga0496118_0078771
922 Ga0496118_0124555
923 Ga0496118_0243824
924 Ga0496119_0000066
925 Ga0496119_0000095
926 Ga0496119_0000911
927 Ga0496119_0001967
928 Ga0496119_0002594
929 Ga0496119_0004815
930 Ga0496119_0012013
931 Ga0496119_0019406
932 Ga0496119_0019524
933 Ga0496119_0024425
934 Ga0496119_0028114
935 Ga0496119_0041327
936 Ga0496119_0047845
937 Ga0496119_0052124
938 Ga0496119_0057505
939 Ga0496119_0404606
940 Ga0496119_0404610
941 Ga0496120_0000380
942 Ga0496120_0000928
943 Ga0496120_0001267
944 Ga0496120_0001332
945 Ga0496120_0002342
946 Ga0496120_0003408
947 Ga0496120_0003965
948 Ga0496120_0015425
949 Ga0496120_0033071
950 Ga0496120_0034345
951 Ga0496120_0036212
952 Ga0496120_0051548
953 Ga0496120_0051738
954 Ga0496120_0098899
955 Ga0496120_0203036
956 Ga0496121_0002250
957 Ga0496121_0003016
958 Ga0496121_0009694
959 Ga0496121_0025872
960 Ga0496121_0035157
961 Ga0496121_0041269
962 Ga0496121_0042151
963 Ga0496121_0132821
964 Ga0496122_0000005
965 Ga0496122_0000738
966 Ga0496122_0001357
967 Ga0496122_0004143
968 Ga0496122_0004902
969 Ga0496122_0025084
970 Ga0496122_0035140
971 Ga0496122_0048348
972 Ga0496122_0076418
973 Ga0496122_0129525
974 Ga0496122_0242251
975 Ga0496122_0621717
976 Ga0496123_0000008
977 Ga0496123_0001127
978 Ga0496123_0001322
979 Ga0496123_0002433
980 Ga0496123_0016228
981 Ga0496123_0020012
982 Ga0496123_0022150
983 Ga0496123_0022151
984 Ga0496123_0032182
985 Ga0496123_0037225
986 Ga0496123_0072449
987 Ga0496124_0000107
988 Ga0496124_0000196
989 Ga0496124_0000564
990 Ga0496124_0001459
991 Ga0496124_0012635
992 Ga0496124_0023875
993 Ga0496124_0037522
994 Ga0496124_0039404
995 Ga0496124_0052365
996 Ga0496124_0055208
997 Ga0496124_0061227
998 Ga0496124_0078754
999 Ga0496124_0087826
1000 Ga0496124_0115344
1001 Ga0496124_0181601
1002 Ga0496124_0185745
1003 Ga0496124_0201820
1004 Ga0496124_0369924
1005 Ga0496124_0430311
1006 Ga0496124_0826659
1007 Ga0496125_0001712
1008 Ga0496125_0005660
1009 Ga0496125_0007075
1010 Ga0496125_0017105
1011 Ga0496125_0020297
1012 Ga0496125_0024785
1013 Ga0496125_0035149
1014 Ga0496125_0040085
1015 Ga0496125_0068488
1016 Ga0496125_0164721
1017 Ga0496126_0000779
1018 Ga0496126_0002347
1019 Ga0496126_0005096
1020 Ga0496126_0020256
1021 Ga0496126_0065137
1022 Ga0496126_0081541
1023 Ga0496126_0087399
1024 Ga0496126_0196318
1025 Ga0496126_0232083
1026 Ga0496126_0253195
1027 Ga0495678_000591
1028 Ga0495678_150401
1029 Ga0495682_0000001
1030 nmdc:mga00v17_103731_c1
1031 nmdc:mga00v17_10398_c1
1032 nmdc:mga00v17_193113_c1
1033 nmdc:mga00v17_19985_c1
1034 nmdc:mga00v17_619798_c1
1035 Ga0500621_000003
1036 2506578193
1037 2506583331
1038 2508852210
1039 2511378924
1040 2511437157
1041 2547695175
1042 2555257429
1043 2562462963
1044 2585825450
1045 2585832068
1046 2599925468
1047 2601535283
1048 2601540846
1049 2601758465
1050 2601764575
1051 2603638182
1052 2603642690
1053 2603698266
1054 2603703280
1055 2608669283
1056 2609913474
1057 2650898803
1058 2656275239
1059 2671103217
1060 2671588316
1061 2681997636
1062 2682006842
1063 2686353187
1064 2689444743
1065 2712469815
1066 2753855714
1067 2765588707
1068 2772438797
1069 2775538714
1070 2791922469
1071 2792314815
1072 2793405750
1073 2807179449
1074 2809123762
1075 2813729158
1076 2814696724
1077 2821119520
1078 2823374496
1079 2844427266
1080 2844530820
1081 2847087809
1082 2847800034
1083 2852107778
1084 2854604470
1085 2855195972
1086 2858468942
1087 2865015109
1088 2869554143
1089 2871286323
1090 2876604392
1091 2881610074
1092 2884089081
1093 2888368818
1094 2888378480
1095 2891672936
1096 2900052694
1097 2904504982
1098 2908670033
1099 2919108625
1100 2923634587
1101 2927834364
1102 2932408195
1103 2935626897
1104 2937540293
1105 2937967411
1106 2939568911
1107 2939578652
1108 2939603463
1109 2939607713
1110 2939619360
1111 2939644042
1112 2945877467
1113 2945953147
1114 2971823193
1115 2974312374
1116 2974438237
1117 2978975671
1118 2984496472
1119 2990261893
1120 3000378725
1121 640937720
1122 8004595705
1123 8015396365
1124 8016736076
1125 8018224901
1126 8018408403
1127 8019502821
1128 8019506244
1129 8054845643
1130 8054853021
1131 8055091034
1132 8055094461
1133 8055099874
1134 8057309461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02657

SufE

Fe-S metabolism associated domain

17

139

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.9797 2 137
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.9764 1 138
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.9588 2 137
5eep-assembly1.cif.gz_A crystal structure of e. coli csde 0.9104 5 136
5nq6-assembly1.cif.gz_A crystal structure of the inhibited form of the redox-sensitive sufe-like sulfur acceptor csde from escherichia coli at 2.40 angstrom resolution 0.8854 2 136
ID Description Score Start End Superfamily
3g0mA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9764 1 138 3.90.1010.10
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9479 17 135 3.90.1010.10
af_Q10RM2_1_106_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9168 37 137 3.90.1010.10
af_Q6K258_62_207_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8986 4 135 3.90.1010.10
af_O96155_92_241_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8828 4 134 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A6A5KZ85-F1-model_v4 deleted 1.001 1 138
AF-A0A5V0SAT9-F1-model_v4 Cysteine desulfuration protein SufE 1.001 41 138
AF-A0A1W9F531-F1-model_v4 deleted 1 11 104
AF-A0A2J4VP97-F1-model_v4 deleted 0.9978 1 123
AF-A0A2V4PX86-F1-model_v4 deleted 0.9951 29 138

Map