F464575

General Info

Members Datasets Scaffolds Average Seq Length
567 320 1134 313

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2600255067|2600814897
Length 328
Sequence ATRPSGPGGPAGPGVARVVILGIYVTDLTFRASRMPLLGETIAGTAFKMGPGGKGSNQAVAAARAGADVVFCTRIGNDAFGAIARSTWAAEGITARVPAVADSVSTGAAHIFVDDATGQNAIIVAAGAAEQLCAADVDAIEADIAAARVFVTQLEQPVAAARRGLELARRHGVTTVFNPAPAMPFDDDLYALCDYITPNETEAAALTGMTVETADDARRAADVLLAKGVGTVIITLGEKGALQHSATQSVLIPAFQCGRVVETAGAGDGFTGGFAAALARGEDPLSAVRFGCALAGISVTRPGTAPSMPTLDEVNRVLAQTGEASHVH

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
251 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
261 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
262 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
263 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
264 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
265 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
266 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
267 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
268 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
269 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
270 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
271 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
272 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
273 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
274 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
275 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
276 2643221629 Devosia sp. Root105 Isolate Unclassified
277 2643221662 Devosia sp. Root413D1 Isolate Unclassified
278 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
279 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
280 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
281 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
282 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
283 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
284 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
285 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
286 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
287 2818991446 Variovorax sp. 1180 Isolate Unclassified
288 2818991450 Burkholderia sp. 604 Isolate Unclassified
289 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
290 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
291 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
292 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
293 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
294 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
295 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
296 2885198086 Variovorax sp. 679 Isolate Unclassified
297 2885211737 Variovorax sp. 553 Isolate Unclassified
298 2899924645 Variovorax sp. 369 Isolate Unclassified
299 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
300 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
301 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
302 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
303 2928037797 Variovorax sp. 1126 Isolate Unclassified
304 2928044640 Variovorax sp. 1128 Isolate Unclassified
305 2928051484 Variovorax sp. 1133 Isolate Unclassified
306 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
307 2928070936 Variovorax gossypii 1167 Isolate Unclassified
308 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
309 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
310 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
311 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
312 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
313 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
314 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
315 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
316 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
317 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
318 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
319 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
320 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.18
Metatranscriptomes 1.06
Isolates 10.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.46
Nodule 1.94
Rhizoplane 6.53
Rhizosphere 53.97
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000095 3300002067 Bacteria 33276
2 JGI24735J21928_10000567 3300002067 Bacteria 12968
3 JGI24735J21928_10000850 3300002067 Bacteria 10885
4 JGI25156J39149_1000072 3300002705 Bacteria 79210
5 JGI25156J39149_1000682 3300002705 Bacteria 18268
6 JGI25156J39149_1003143 3300002705 Bacteria 5557
7 JGI25152J39213_1011261 3300002773 Bacteria 1988
8 JGI25150J39212_1002359 3300002774 Bacteria 4739
9 JGI25159J45721_1011623 3300002987 Bacteria 2145
10 JGI25159J45721_1012728 3300002987 Bacteria 1988
11 JGI25151J46595_10000406 3300003187 Bacteria 44525
12 JGI25151J46595_10033255 3300003187 Bacteria 1988
13 JGI25165J46597_1002126 3300003214 Bacteria 7160
14 JGI25153J46596_10001375 3300003215 Bacteria 14553
15 JGI25153J46596_10027553 3300003215 Bacteria 1988
16 rootH1_10100539 3300003316 Bacteria 3057
17 rootL2_10067516 3300003322 Bacteria 1448
18 rootL2_10122369 3300003322 Bacteria 1679
19 JGI25160J50197_1000534 3300003354 Bacteria 21867
20 JGI25160J50197_1015392 3300003354 Bacteria 2511
21 JGI25160J50197_1020567 3300003354 Bacteria 1988
22 JGI25161J50226_1006911 3300003374 Bacteria 1983
23 Ga0006562J51391_1124565 3300003578 Bacteria 2460
24 Ga0006562J51391_1124567 3300003578 Bacteria 4070
25 Ga0055533_1000123 3300003756 Bacteria 87995
26 Ga0055532_1000076 3300003758 Bacteria 123328
27 Ga0055527_1000038 3300003760 Bacteria 123328
28 Ga0055535_1000060 3300003761 Bacteria 123328
29 Ga0055535_1000472 3300003761 Bacteria 36632
30 Ga0055542_1000089 3300003762 Bacteria 123328
31 Ga0055542_1000103 3300003762 Bacteria 114989
32 Ga0055542_1000396 3300003762 Bacteria 43407
33 Ga0055529_1000106 3300003763 Bacteria 123328
34 Ga0055526_1018877 3300003771 Bacteria 2544
35 Ga0055526_1018911 3300003771 Bacteria 2538
36 Ga0055537_1003586 3300003773 Bacteria 4733
37 Ga0055524_1017335 3300003775 Bacteria 2544
38 Ga0055524_1017395 3300003775 Bacteria 2538
39 Ga0055536_1010899 3300003781 Bacteria 3547
40 Ga0055534_1010192 3300003784 Bacteria 1988
41 Ga0055534_1012069 3300003784 Bacteria 1726
42 Ga0055528_1016979 3300003790 Bacteria 2544
43 Ga0055530_10000237 3300003791 Bacteria 49495
44 Ga0055540_1007368 3300003792 Bacteria 4169
45 Ga0055531_10011793 3300003794 Bacteria 4173
46 Ga0055531_10011817 3300003794 Bacteria 4168
47 Ga0055543_1003354 3300004625 Bacteria 4771
48 Ga0055543_1009200 3300004625 Bacteria 2138
49 Ga0065165_1001724 3300005262 Bacteria 21905
50 Ga0065165_1008049 3300005262 Bacteria 5034
51 Ga0065165_1032743 3300005262 Bacteria 1626
52 Ga0070658_10066263 3300005327 Bacteria 2950
53 Ga0070683_100187478 3300005329 Bacteria 1964
54 Ga0070666_10066466 3300005335 Bacteria 2447
55 Ga0070682_100235653 3300005337 Bacteria 1311
56 Ga0070660_100001525 3300005339 Bacteria 15894
57 Ga0070671_100249830 3300005355 Bacteria 1506
58 Ga0070663_100137428 3300005455 Bacteria 1862
59 Ga0070663_100152729 3300005455 Bacteria 1772
60 Ga0068855_100088173 3300005563 Bacteria 3584
61 Ga0068857_100216154 3300005577 Bacteria 1750
62 Ga0068851_10024638 3300005834 Bacteria 2946
63 Ga0068862_100004007 3300005844 Bacteria 12490
64 Ga0068862_100036231 3300005844 Bacteria 4181
65 Ga0081540_1003971 3300005983 Bacteria 11491
66 Ga0075363_100185112 3300006048 Bacteria 1186
67 Ga0075367_10298410 3300006178 Bacteria 1014
68 Ga0075366_10039267 3300006195 Bacteria 2798
69 Ga0075370_10006253 3300006353 Bacteria 5978
70 Ga0099826_10098191 3300006948 Bacteria 1773
71 Ga0105251_10000153 3300009011 Bacteria 70284
72 Ga0105251_10001352 3300009011 Bacteria 21186
73 Ga0105240_10002746 3300009093 Bacteria 27840
74 Ga0105240_10376512 3300009093 Bacteria 1604
75 Ga0111539_10558978 3300009094 Bacteria 1332
76 Ga0105248_10179994 3300009177 Bacteria 2382
77 Ga0105239_10002039 3300010375 Bacteria 26201
78 Ga0157370_10003077 3300013104 Bacteria 19768
79 Ga0157370_10017529 3300013104 Bacteria 7225
80 Ga0157370_10082125 3300013104 Bacteria 3032
81 Ga0157369_10000280 3300013105 Bacteria 68583
82 Ga0157369_10015851 3300013105 Bacteria 8488
83 Ga0157369_10016809 3300013105 Bacteria 8223
84 Ga0157369_10104818 3300013105 Bacteria 3011
85 Ga0157369_10256953 3300013105 Bacteria 1822
86 Ga0157369_10516638 3300013105 Bacteria 1235
87 Ga0157374_10002550 3300013296 Bacteria 15362
88 Ga0163162_10011222 3300013306 Bacteria 8735
89 Ga0157372_10066010 3300013307 Bacteria 4065
90 Ga0157372_10636654 3300013307 Bacteria 1242
91 Ga0157375_10007805 3300013308 Bacteria 9362
92 Ga0182008_10035619 3300014497 Bacteria 2492
93 Ga0157376_10097444 3300014969 Bacteria 2562
94 Ga0182007_10002084 3300015262 Bacteria 10266
95 Ga0183361_10003 3300016635 Bacteria 577277
96 Ga0163161_10000072 3300017792 Bacteria 102352
97 Ga0206356_10649567 3300020070 Bacteria 3899
98 Ga0206354_10978505 3300020081 Bacteria 1571
99 Ga0206353_10180007 3300020082 Bacteria 3712
100 Ga0224712_10000525 3300022467 Bacteria 7760
101 Ga0209436_104647 3300025208 Bacteria 3343
102 Ga0209566_105841 3300025225 Bacteria 1501
103 Ga0209674_100005 3300025226 Bacteria 1708125
104 Ga0209674_100185 3300025226 Bacteria 68504
105 Ga0209672_100001 3300025228 Bacteria 2828210
106 Ga0209672_101222 3300025228 Bacteria 10370
107 Ga0209147_100001 3300025229 Bacteria 2384371
108 Ga0209147_100352 3300025229 Bacteria 33384
109 Ga0209563_100558 3300025230 Bacteria 12419
110 Ga0207427_100608 3300025231 Bacteria 17797
111 Ga0209258_100001 3300025242 Bacteria 2384269
112 Ga0209258_100133 3300025242 Bacteria 174846
113 Ga0207425_1000352 3300025245 Bacteria 31908
114 Ga0207425_1012932 3300025245 Bacteria 1942
115 Ga0209026_1000002 3300025250 Bacteria 1136158
116 Ga0209148_1000003 3300025254 Bacteria 2384288
117 Ga0209148_1000188 3300025254 Bacteria 117310
118 Ga0209759_1000002 3300025256 Bacteria 1027596
119 Ga0209759_1000062 3300025256 Bacteria 197996
120 Ga0209759_1000093 3300025256 Bacteria 159472
121 Ga0209759_1000122 3300025256 Bacteria 138353
122 Ga0209759_1006802 3300025256 Bacteria 3789
123 Ga0209129_1000245 3300025258 Bacteria 56975
124 Ga0209129_1004337 3300025258 Bacteria 5595
125 Ga0209129_1005779 3300025258 Bacteria 4236
126 Ga0209233_1000198 3300025261 Bacteria 123847
127 Ga0209565_1000165 3300025263 Bacteria 86871
128 Ga0209565_1006089 3300025263 Bacteria 3425
129 Ga0209455_1000001 3300025272 Bacteria 2384278
130 Ga0209673_1000454 3300025273 Bacteria 69331
131 Ga0209673_1001222 3300025273 Bacteria 27158
132 Ga0209673_1002781 3300025273 Bacteria 11385
133 Ga0209130_1001097 3300025284 Bacteria 20097
134 Ga0209130_1003703 3300025284 Bacteria 6295
135 Ga0209675_1000823 3300025291 Bacteria 20435
136 Ga0209675_1011933 3300025291 Bacteria 2838
137 Ga0209676_1000111 3300025292 Bacteria 213411
138 Ga0209025_1000157 3300025294 Bacteria 168790
139 Ga0209025_1000615 3300025294 Bacteria 64022
140 Ga0209025_1013697 3300025294 Bacteria 5068
141 Ga0209564_1000070 3300025295 Bacteria 303126
142 Ga0209564_1000352 3300025295 Bacteria 85941
143 Ga0209564_1003143 3300025295 Bacteria 11634
144 Ga0209758_1000005 3300025297 Bacteria 1368918
145 Ga0209758_1000297 3300025297 Bacteria 97664
146 Ga0209758_1017089 3300025297 Bacteria 3639
147 Ga0209758_1048666 3300025297 Bacteria 1504
148 Ga0209050_1000111 3300025298 Bacteria 213411
149 Ga0209256_1000047 3300025299 Bacteria 314709
150 Ga0209256_1000238 3300025299 Bacteria 97664
151 Ga0207426_1000056 3300025302 Bacteria 373596
152 Ga0207426_1000194 3300025302 Bacteria 150009
153 Ga0207426_1000294 3300025302 Bacteria 98700
154 Ga0207426_1001208 3300025302 Bacteria 22907
155 Ga0209051_1000046 3300025303 Bacteria 296424
156 Ga0209051_1036611 3300025303 Bacteria 1810
157 Ga0209257_1000344 3300025304 Bacteria 96578
158 Ga0209257_1004797 3300025304 Bacteria 10075
159 Ga0209257_1027317 3300025304 Bacteria 1902
160 Ga0207656_10009713 3300025321 Bacteria 3577
161 Ga0207713_1000189 3300025735 Bacteria 86382
162 Ga0207713_1009383 3300025735 Bacteria 5516
163 Ga0207680_10059334 3300025903 Bacteria 2323
164 Ga0207647_10000406 3300025904 Bacteria 35299
165 Ga0207647_10017358 3300025904 Bacteria 4892
166 Ga0207647_10033398 3300025904 Bacteria 3294
167 Ga0207705_10144193 3300025909 Bacteria 1780
168 Ga0207695_10050701 3300025913 Bacteria 4364
169 Ga0207695_10406123 3300025913 Bacteria 1246
170 Ga0207657_10002402 3300025919 Bacteria 20250
171 Ga0207644_10219013 3300025931 Bacteria 1508
172 Ga0207711_10064890 3300025941 Bacteria 3155
173 Ga0207711_10131007 3300025941 Bacteria 2249
174 Ga0207667_10003983 3300025949 Bacteria 18156
175 Ga0207658_10533154 3300025986 Bacteria 1049
176 Ga0207639_10020183 3300026041 Bacteria 4767
177 Ga0207678_10157044 3300026067 Bacteria 1942
178 Ga0207678_10178411 3300026067 Bacteria 1814
179 Ga0207702_10693958 3300026078 Bacteria 1003
180 Ga0209371_1002502 3300027312 Bacteria 10183
181 Ga0209813_10065749 3300027866 Bacteria 1168
182 Ga0307515_10002180 3300028794 Bacteria 42989
183 Ga0268256_1022320 3300030500 Bacteria 1662
184 Ga0307513_10270482 3300031456 Bacteria 1483
185 Ga0307513_10300771 3300031456 Bacteria 1371
186 Ga0307509_10396341 3300031507 Bacteria 1089
187 Ga0307514_10006880 3300031649 Bacteria 9846
188 Ga0265314_10012669 3300031711 Bacteria 6861
189 Ga0265342_10089293 3300031712 Unclassified 1769
190 Ga0307412_10000003 3300031911 Bacteria 659081
191 Ga0307411_10126749 3300032005 Bacteria 1858
192 Ga0395899_0000031 3300037312 Bacteria 322356
193 Ga0395899_0006258 3300037312 Bacteria 9216
194 Ga0395899_0029309 3300037312 Bacteria 4140
195 Ga0395900_0000776 3300037418 Bacteria 42484
196 Ga0395900_0000980 3300037418 Bacteria 37119
197 Ga0395900_0088046 3300037418 Bacteria 3192
198 Ga0395900_0091955 3300037418 Bacteria 3117
199 Ga0395900_0140226 3300037418 Bacteria 2476
200 Ga0395898_0000040 3300037466 Bacteria 317329
201 Ga0395898_0001377 3300037466 Bacteria 34890
202 Ga0395898_0033260 3300037466 Bacteria 5147
203 Ga0395905_0000331 3300037471 Bacteria 67755
204 Ga0395905_0012724 3300037471 Bacteria 8092
205 Ga0395905_0225483 3300037471 Bacteria 1753
206 Ga0395905_0343939 3300037471 Bacteria 1383
207 Ga0395901_0000002 3300038443 Bacteria 761045
208 Ga0395901_0000059 3300038443 Bacteria 152667
209 Ga0395901_0001288 3300038443 Bacteria 26499
210 Ga0395901_0048474 3300038443 Bacteria 4411
211 Ga0395901_0237617 3300038443 Bacteria 1901
212 Ga0400483_024592 3300039062 Bacteria 3961
213 Ga0400483_276040 3300039062 Bacteria 3623
214 Ga0439465_0011528 3300041413 Bacteria 2775
215 Ga0439448_0000023 3300042005 Bacteria 24812
216 Ga0466969_0027479 3300044656 Bacteria 2913
217 Ga0466973_0010198 3300044659 Bacteria 8664
218 Ga0466965_0009456 3300044683 Bacteria 4529
219 Ga0466966_0000296 3300044684 Bacteria 32722
220 Ga0466966_0001064 3300044684 Bacteria 17544
221 Ga0466966_0004266 3300044684 Bacteria 9430
222 Ga0466961_0001043 3300044693 Bacteria 17070
223 Ga0466961_0142208 3300044693 Bacteria 1501
224 Ga0466963_0000764 3300044694 Bacteria 15926
225 Ga0466963_0025561 3300044694 Bacteria 3767
226 Ga0466971_0001128 3300044719 Bacteria 11110
227 Ga0466971_0012181 3300044719 Bacteria 3768
228 Ga0466971_0066415 3300044719 Bacteria 1634
229 Ga0466968_0048202 3300044735 Bacteria 1813
230 Ga0466957_0002214 3300044842 Bacteria 10425
231 Ga0466957_0025936 3300044842 Bacteria 3475
232 Ga0466960_0042049 3300044901 Bacteria 2168
233 Ga0466959_0046076 3300045049 Bacteria 3209
234 Ga0466959_0242135 3300045049 Bacteria 1245
235 Ga0466958_0003404 3300045836 Bacteria 8251
236 Ga0466958_0008148 3300045836 Bacteria 5801
237 Ga0466958_0014237 3300045836 Bacteria 4541
238 Ga0466967_0102460 3300045976 Bacteria 2619
239 Ga0466967_0226957 3300045976 Bacteria 1777
240 Ga0495592_0004960 3300046454 Bacteria 9795
241 Ga0495603_0001632 3300046455 Bacteria 13172
242 Ga0495603_0012371 3300046455 Bacteria 5167
243 Ga0495603_0214818 3300046455 Bacteria 1110
244 Ga0495603_0247828 3300046455 Bacteria 1026
245 Ga0495590_0015966 3300046457 Bacteria 2716
246 Ga0495590_0017035 3300046457 Bacteria 2620
247 Ga0495591_002036 3300046458 Bacteria 11738
248 Ga0495629_0000036 3300046459 Bacteria 117795
249 Ga0495629_0000111 3300046459 Bacteria 73381
250 Ga0495629_0003448 3300046459 Bacteria 11954
251 Ga0495629_0004776 3300046459 Bacteria 10161
252 Ga0495629_0023637 3300046459 Bacteria 4377
253 Ga0495638_0006956 3300046460 Bacteria 8165
254 Ga0495638_0164295 3300046460 Bacteria 1278
255 Ga0495638_0237035 3300046460 Bacteria 1012
256 Ga0495641_0052234 3300046461 Bacteria 1864
257 Ga0495651_0054399 3300046462 Bacteria 3078
258 Ga0495653_0000903 3300046463 Bacteria 22971
259 Ga0495653_0016706 3300046463 Bacteria 5973
260 Ga0495653_0029199 3300046463 Bacteria 4406
261 Ga0495653_0065153 3300046463 Bacteria 2743
262 Ga0495650_0000569 3300046471 Bacteria 51802
263 Ga0495650_0010765 3300046471 Bacteria 5080
264 Ga0495650_0015179 3300046471 Bacteria 3963
265 Ga0495580_0000364 3300046472 Bacteria 36962
266 Ga0495580_0001941 3300046472 Bacteria 18154
267 Ga0495582_0004954 3300046473 Bacteria 7460
268 Ga0495605_0011800 3300046474 Bacteria 4863
269 Ga0495605_0017027 3300046474 Bacteria 3925
270 Ga0495662_0017287 3300046476 Bacteria 3491
271 Ga0495662_0063289 3300046476 Bacteria 1787
272 Ga0495664_0009533 3300046477 Bacteria 5435
273 Ga0495664_0025079 3300046477 Bacteria 3470
274 Ga0495664_0075817 3300046477 Bacteria 2012
275 Ga0495584_0027937 3300046491 Bacteria 2858
276 Ga0495596_0013784 3300046500 Bacteria 3419
277 Ga0495596_0048840 3300046500 Bacteria 1659
278 Ga0495583_0008969 3300046506 Bacteria 6031
279 Ga0495583_0022960 3300046506 Bacteria 3168
280 Ga0495583_0039657 3300046506 Bacteria 2217
281 Ga0495606_0017327 3300046507 Bacteria 5452
282 Ga0495606_0027108 3300046507 Bacteria 4068
283 Ga0495606_0143111 3300046507 Bacteria 1410
284 Ga0495608_0019222 3300046511 Bacteria 4704
285 Ga0495608_0030652 3300046511 Bacteria 3640
286 Ga0495618_0006246 3300046514 Bacteria 7230
287 Ga0495620_0009714 3300046515 Bacteria 5108
288 Ga0495628_0001651 3300046516 Bacteria 20404
289 Ga0495628_0008812 3300046516 Bacteria 8633
290 Ga0495628_0023228 3300046516 Bacteria 5092
291 Ga0495628_0114204 3300046516 Bacteria 2075
292 Ga0495628_0185795 3300046516 Bacteria 1570
293 Ga0495630_0001875 3300046517 Bacteria 14636
294 Ga0495630_0010481 3300046517 Bacteria 6695
295 Ga0495630_0025993 3300046517 Bacteria 4332
296 Ga0495630_0040330 3300046517 Bacteria 3489
297 Ga0495630_0129068 3300046517 Bacteria 1919
298 Ga0495648_0034292 3300046524 Bacteria 3304
299 Ga0495648_0066575 3300046524 Bacteria 2111
300 Ga0495666_0001148 3300046526 Bacteria 12712
301 Ga0495666_0013551 3300046526 Bacteria 4063
302 Ga0495642_0006266 3300046528 Bacteria 4565
303 Ga0495642_0018489 3300046528 Bacteria 2728
304 Ga0495652_0005895 3300046529 Bacteria 11461
305 Ga0495652_0026938 3300046529 Bacteria 5070
306 Ga0495665_0000587 3300046531 Bacteria 18591
307 Ga0495665_0015666 3300046531 Bacteria 4080
308 Ga0495665_0099893 3300046531 Bacteria 1523
309 Ga0495586_0019750 3300046535 Bacteria 3588
310 Ga0495586_0021210 3300046535 Bacteria 3461
311 Ga0495597_0019913 3300046542 Bacteria 3133
312 Ga0495645_0000082 3300046543 Bacteria 65622
313 Ga0495645_0030462 3300046543 Bacteria 3929
314 Ga0495622_0000018 3300046557 Bacteria 173985
315 Ga0495622_0024373 3300046557 Bacteria 2825
316 Ga0495667_0059223 3300046559 Bacteria 2514
317 Ga0495625_0121155 3300046660 Bacteria 1780
318 Ga0495635_0007366 3300046663 Bacteria 7678
319 Ga0495635_0017880 3300046663 Bacteria 4951
320 Ga0495661_0016113 3300046665 Bacteria 4965
321 Ga0495657_0008291 3300046675 Bacteria 7958
322 Ga0495599_0020487 3300046678 Bacteria 4118
323 Ga0495599_0050901 3300046678 Bacteria 2595
324 Ga0495623_0001827 3300046679 Bacteria 14282
325 Ga0495623_0003785 3300046679 Bacteria 9964
326 Ga0495623_0031240 3300046679 Bacteria 3424
327 Ga0495623_0043374 3300046679 Bacteria 2862
328 Ga0495646_0002135 3300046680 Bacteria 12013
329 Ga0495646_0005415 3300046680 Bacteria 8062
330 Ga0495646_0020958 3300046680 Bacteria 4133
331 Ga0495646_0021618 3300046680 Bacteria 4063
332 Ga0495646_0115955 3300046680 Bacteria 1520
333 Ga0495669_0025132 3300046684 Bacteria 2596
334 Ga0495613_0032415 3300046689 Bacteria 3881
335 Ga0495613_0204871 3300046689 Bacteria 1389
336 Ga0495624_0000143 3300046690 Bacteria 51520
337 Ga0495624_0003207 3300046690 Bacteria 12190
338 Ga0495624_0017517 3300046690 Bacteria 4808
339 Ga0495670_0002144 3300046691 Bacteria 9756
340 Ga0495671_0078917 3300046692 Bacteria 1614
341 Ga0495649_0003177 3300046694 Bacteria 11230
342 Ga0495649_0142989 3300046694 Bacteria 1258
343 Ga0495589_0019897 3300046794 Bacteria 3434
344 Ga0495589_0041991 3300046794 Bacteria 2280
345 Ga0495589_0136512 3300046794 Bacteria 1176
346 Ga0495600_0000367 3300046809 Bacteria 23668
347 Ga0495600_0018847 3300046809 Bacteria 4403
348 Ga0495581_0004187 3300047315 Bacteria 8313
349 Ga0495581_0020266 3300047315 Bacteria 3860
350 Ga0495604_0002349 3300047317 Bacteria 15162
351 Ga0495604_0003876 3300047317 Bacteria 11913
352 Ga0495604_0033282 3300047317 Bacteria 4081
353 Ga0495674_0005133 3300047319 Bacteria 12574
354 Ga0495674_0005267 3300047319 Bacteria 12402
355 Ga0495674_0016418 3300047319 Bacteria 6905
356 Ga0495674_0023873 3300047319 Bacteria 5628
357 Ga0495674_0051747 3300047319 Bacteria 3619
358 Ga0495674_0082735 3300047319 Bacteria 2752
359 Ga0495674_0097128 3300047319 Bacteria 2509
360 Ga0495672_0003902 3300047320 Bacteria 12514
361 Ga0495672_0020207 3300047320 Bacteria 4371
362 Ga0495672_0044243 3300047320 Bacteria 2672
363 Ga0495676_0051254 3300047321 Bacteria 3304
364 Ga0495676_0097232 3300047321 Bacteria 2187
365 Ga0495680_0013741 3300047322 Bacteria 7047
366 Ga0495680_0019670 3300047322 Bacteria 5697
367 Ga0495680_0031035 3300047322 Bacteria 4353
368 Ga0495683_0002948 3300047323 Bacteria 10067
369 Ga0495683_0036148 3300047323 Bacteria 2508
370 Ga0495687_000005 3300047443 Bacteria 610401
371 Ga0495687_026516 3300047443 Bacteria 2726
372 Ga0495687_047347 3300047443 Bacteria 1851
373 Ga0495675_0001200 3300047444 Bacteria 15712
374 Ga0495675_0002423 3300047444 Bacteria 11146
375 Ga0495675_0022241 3300047444 Bacteria 4041
376 Ga0495675_0092722 3300047444 Bacteria 1895
377 Ga0495679_000013 3300047446 Bacteria 313222
378 Ga0495679_002176 3300047446 Bacteria 10284
379 Ga0495673_0008799 3300047469 Bacteria 5638
380 Ga0495673_0015538 3300047469 Bacteria 3920
381 Ga0495673_0065670 3300047469 Bacteria 1540
382 Ga0495684_0153269 3300047471 Bacteria 1722
383 Ga0495686_0000044 3300047472 Bacteria 288079
384 Ga0495686_0037914 3300047472 Bacteria 3086
385 Ga0495686_0046013 3300047472 Bacteria 2760
386 Ga0495686_0160662 3300047472 Bacteria 1313
387 Ga0495593_0001452 3300047673 Bacteria 13899
388 Ga0495593_0017184 3300047673 Bacteria 4071
389 Ga0495593_0021236 3300047673 Bacteria 3628
390 Ga0495593_0030675 3300047673 Bacteria 2940
391 Ga0495602_0015495 3300048088 Bacteria 7691
392 Ga0495602_0016626 3300048088 Bacteria 7394
393 Ga0495602_0041340 3300048088 Bacteria 4212
394 Ga0495614_0002048 3300048089 Bacteria 8867
395 Ga0495614_0009830 3300048089 Bacteria 4225
396 Ga0495626_0027875 3300048091 Bacteria 2743
397 Ga0496100_0001293 3300048903 Bacteria 12219
398 Ga0496100_0004171 3300048903 Bacteria 7619
399 Ga0496100_0030206 3300048903 Bacteria 3359
400 Ga0496101_0001353 3300048904 Bacteria 14678
401 Ga0496101_0005807 3300048904 Bacteria 7893
402 Ga0496101_0125277 3300048904 Bacteria 1946
403 Ga0496101_0134364 3300048904 Bacteria 1881
404 Ga0496102_0014438 3300048905 Bacteria 6862
405 Ga0496102_0062882 3300048905 Bacteria 3398
406 Ga0496102_0132827 3300048905 Bacteria 2331
407 Ga0496103_0001338 3300048906 Bacteria 16674
408 Ga0496103_0048362 3300048906 Bacteria 2628
409 Ga0496103_0062144 3300048906 Bacteria 2324
410 Ga0496104_0237807 3300048907 Bacteria 1733
411 Ga0496104_0335241 3300048907 Bacteria 1425
412 Ga0496104_0337758 3300048907 Bacteria 1419
413 Ga0496105_0031093 3300048908 Bacteria 4377
414 Ga0496106_0000010 3300048909 Bacteria 232347
415 Ga0496106_0011182 3300048909 Bacteria 6641
416 Ga0496106_0180181 3300048909 Bacteria 1677
417 Ga0496107_0038414 3300048910 Bacteria 3434
418 Ga0496109_0149581 3300048912 Bacteria 2186
419 Ga0496110_0016653 3300048913 Bacteria 6140
420 Ga0496110_0461740 3300048913 Bacteria 1157
421 Ga0496111_0004473 3300048914 Bacteria 8844
422 Ga0496112_0013438 3300048915 Bacteria 7558
423 Ga0496112_0055418 3300048915 Bacteria 3898
424 Ga0496112_0375125 3300048915 Bacteria 1364
425 Ga0496113_0004711 3300048916 Bacteria 8418
426 Ga0496113_0009811 3300048916 Bacteria 6300
427 Ga0496113_0300317 3300048916 Bacteria 1286
428 Ga0496115_0031033 3300048918 Bacteria 4209
429 Ga0496115_0033747 3300048918 Bacteria 4042
430 Ga0496116_0005121 3300048919 Bacteria 12310
431 Ga0496116_0038014 3300048919 Bacteria 3348
432 Ga0496116_0049562 3300048919 Bacteria 2807
433 Ga0496116_0085290 3300048919 Bacteria 1942
434 Ga0496116_0121031 3300048919 Bacteria 1515
435 Ga0496117_0001573 3300048920 Bacteria 32411
436 Ga0496117_0002608 3300048920 Bacteria 22404
437 Ga0496117_0014290 3300048920 Bacteria 6851
438 Ga0496117_0032284 3300048920 Bacteria 3981
439 Ga0496117_0062434 3300048920 Bacteria 2553
440 Ga0496117_0072832 3300048920 Bacteria 2294
441 Ga0496117_0079442 3300048920 Bacteria 2161
442 Ga0496117_0128887 3300048920 Bacteria 1537
443 Ga0496118_0000551 3300048921 Bacteria 61687
444 Ga0496118_0002914 3300048921 Bacteria 22222
445 Ga0496118_0002935 3300048921 Bacteria 22156
446 Ga0496118_0003413 3300048921 Bacteria 20076
447 Ga0496118_0019624 3300048921 Bacteria 6034
448 Ga0496118_0040951 3300048921 Bacteria 3675
449 Ga0496118_0048255 3300048921 Bacteria 3291
450 Ga0496118_0094987 3300048921 Bacteria 2037
451 Ga0496119_0029396 3300048922 Bacteria 3728
452 Ga0496120_0046700 3300048923 Bacteria 2501
453 Ga0496121_0002519 3300048924 Bacteria 27799
454 Ga0496121_0005770 3300048924 Bacteria 15705
455 Ga0496121_0008614 3300048924 Bacteria 11941
456 Ga0496121_0013868 3300048924 Bacteria 8621
457 Ga0496121_0310926 3300048924 Bacteria 1065
458 Ga0496122_0055127 3300048925 Bacteria 2977
459 Ga0496123_0018911 3300048926 Bacteria 5453
460 Ga0496123_0120112 3300048926 Bacteria 1481
461 Ga0496124_0030905 3300048927 Bacteria 4745
462 Ga0496124_0035641 3300048927 Bacteria 4351
463 Ga0496125_0044173 3300048928 Bacteria 3772
464 Ga0496125_0165505 3300048928 Bacteria 1495
465 Ga0496126_0000122 3300048929 Bacteria 182785
466 Ga0496126_0000164 3300048929 Bacteria 152791
467 Ga0496126_0000511 3300048929 Bacteria 75804
468 Ga0496126_0023435 3300048929 Bacteria 5983
469 Ga0496126_0044993 3300048929 Bacteria 4060
470 Ga0496126_0100060 3300048929 Bacteria 2538
471 Ga0496126_0146594 3300048929 Bacteria 2027
472 Ga0495678_010361 3300049459 Bacteria 4537
473 Ga0495678_101723 3300049459 Bacteria 994
474 Ga0495682_0024820 3300049460 Bacteria 2233
475 Ga0501034_0004245 3300049571 Bacteria 15984
476 Ga0501034_0210716 3300049571 Bacteria 1899
477 Ga0501037_0363451 3300049573 Bacteria 997
478 Ga0501041_0108616 3300049577 Bacteria 1721
479 Ga0501043_0023314 3300049579 Bacteria 4854
480 Ga0501047_0001625 3300049581 Bacteria 21911
481 Ga0501047_0086796 3300049581 Bacteria 3006
482 Ga0501067_0011248 3300049583 Bacteria 4953
483 Ga0501068_0011801 3300049584 Bacteria 4940
484 Ga0501073_0235836 3300049589 Bacteria 1263
485 Ga0501080_0001426 3300049742 Bacteria 20064
486 Ga0501044_0008439 3300049823 Bacteria 11298
487 Ga0501044_0227867 3300049823 Bacteria 1812
488 nmdc:mga0k408_66221_c1 3300050493 Bacteria 2104
489 nmdc:mga06z11_927_c1 3300050494 Bacteria 10674
490 nmdc:mga04h51_10279_c1 3300050495 Bacteria 2566
491 nmdc:mga07m45_12524_c1 3300050496 Bacteria 4484
492 nmdc:mga07m45_36017_c1 3300050496 Bacteria 2754
493 Ga0500578_0092904 3300053086 Bacteria 1914
494 Ga0500644_0010325 3300053088 Bacteria 2526
495 Ga0500646_0016030 3300053090 Bacteria 1954
496 Ga0500651_0014879 3300053093 Bacteria 4767
497 Ga0500641_0007275 3300053096 Bacteria 3946
498 Ga0500555_044580 3300053103 Bacteria 1227
499 Ga0500595_001895 3300053119 Bacteria 10770
500 Ga0500642_0000786 3300053130 Bacteria 9291
501 Ga0500604_0001588 3300053151 Bacteria 6380
502 Ga0500604_0010553 3300053151 Bacteria 2473
503 Ga0500616_0000705 3300053153 Bacteria 38798
504 Ga0500616_0019588 3300053153 Bacteria 3812
505 Ga0466962_0011427 3300061719 Bacteria 4275
506 Ga0466962_0013424 3300061719 Bacteria 3943
507 2600814897 2600255067 Bacteria 6795583
508 2501071537 2501025501 Bacteria 7768574
509 2501077045 2501025502 Bacteria 9641094
510 2501407057 2501025504 Bacteria 8008976
511 2509130951 2508501125 Bacteria 7208311
512 2511092729 2510917013 Bacteria 9951648
513 2511097951 2510917014 Bacteria 8296963
514 2511108138 2510917015 Bacteria 7950052
515 2514052413 2513237166 Bacteria 10373764
516 2516019828 2515154189 Bacteria 9629850
517 2527074953 2526164713 Bacteria 6780608
518 2563061295 2562617112 Bacteria 10918404
519 2599625342 2599185214 Bacteria 8209958
520 2599673206 2599185226 Bacteria 8233575
521 2599682876 2599185227 Bacteria 8246414
522 2599694814 2599185229 Bacteria 8216126
523 2644164454 2643221629 Bacteria 5850260
524 2644346275 2643221662 Bacteria 5851492
525 2713476257 2711768613 Bacteria 11048459
526 2738820998 2738541296 Bacteria 7285013
527 2738833480 2738541298 Bacteria 7286732
528 2738875007 2738541306 Bacteria 7284992
529 2739186636 2738543002 Bacteria 7284546
530 2739221605 2738543008 Bacteria 7282815
531 2746085633 2744054900 Bacteria 8399525
532 2746092783 2744054901 Bacteria 8397047
533 2792837646 2791355137 Bacteria 9654227
534 2819602133 2818991446 Bacteria 7757362
535 2819621624 2818991450 Bacteria 6962147
536 2831268277 2831265667 Bacteria 7184833
537 2842332824 2842324504 Bacteria 9364110
538 2842357030 2842348783 Bacteria 9002918
539 2842460808 2842454564 Bacteria 8730687
540 2856294543 2856287931 Bacteria 7223934
541 2857367916 2857357740 Bacteria 9937880
542 2883091958 2883087390 Bacteria 9532701
543 2885198192 2885198086 Bacteria 7212419
544 2885212428 2885211737 Bacteria 7212420
545 2899928799 2899924645 Bacteria 7487985
546 2900640944 2900634093 Bacteria 10263517
547 2904485243 2904483920 Bacteria 7545285
548 2904621733 2904615490 Bacteria 10047340
549 2919532272 2919527303 Bacteria 7718827
550 2928043265 2928037797 Bacteria 7273642
551 2928051142 2928044640 Bacteria 7271509
552 2928058637 2928051484 Bacteria 7773759
553 2928066124 2928064002 Bacteria 7419480
554 2928077840 2928070936 Bacteria 8062541
555 2928112155 2928108538 Bacteria 7360024
556 2928139301 2928135762 Bacteria 7259641
557 2928508561 2928503688 Bacteria 7268108
558 2945936713 2945934425 Bacteria 7444609
559 2945972113 2945972063 Bacteria 6086495
560 2961135478 2961127735 Bacteria 7196641
561 2990709357 2990703756 Bacteria 7715990
562 2996338833 2996336353 Bacteria 5511628
563 642427129 641736151 Bacteria 7477263
564 642596404 642555112 Bacteria 8676562
565 642616280 642555113 Bacteria 8214658
566 8055271757 8055266321 Bacteria 7999742
567 8055302765 8055301274 Bacteria 8587385
568 JGI24735J21928_10000095
569 JGI24735J21928_10000567
570 JGI24735J21928_10000850
571 JGI25156J39149_1000072
572 JGI25156J39149_1000682
573 JGI25156J39149_1003143
574 JGI25152J39213_1011261
575 JGI25150J39212_1002359
576 JGI25159J45721_1011623
577 JGI25159J45721_1012728
578 JGI25151J46595_10000406
579 JGI25151J46595_10033255
580 JGI25165J46597_1002126
581 JGI25153J46596_10001375
582 JGI25153J46596_10027553
583 rootH1_10100539
584 rootL2_10067516
585 rootL2_10122369
586 JGI25160J50197_1000534
587 JGI25160J50197_1015392
588 JGI25160J50197_1020567
589 JGI25161J50226_1006911
590 Ga0006562J51391_1124565
591 Ga0006562J51391_1124567
592 Ga0055533_1000123
593 Ga0055532_1000076
594 Ga0055527_1000038
595 Ga0055535_1000060
596 Ga0055535_1000472
597 Ga0055542_1000089
598 Ga0055542_1000103
599 Ga0055542_1000396
600 Ga0055529_1000106
601 Ga0055526_1018877
602 Ga0055526_1018911
603 Ga0055537_1003586
604 Ga0055524_1017335
605 Ga0055524_1017395
606 Ga0055536_1010899
607 Ga0055534_1010192
608 Ga0055534_1012069
609 Ga0055528_1016979
610 Ga0055530_10000237
611 Ga0055540_1007368
612 Ga0055531_10011793
613 Ga0055531_10011817
614 Ga0055543_1003354
615 Ga0055543_1009200
616 Ga0065165_1001724
617 Ga0065165_1008049
618 Ga0065165_1032743
619 Ga0070658_10066263
620 Ga0070683_100187478
621 Ga0070666_10066466
622 Ga0070682_100235653
623 Ga0070660_100001525
624 Ga0070671_100249830
625 Ga0070663_100137428
626 Ga0070663_100152729
627 Ga0068855_100088173
628 Ga0068857_100216154
629 Ga0068851_10024638
630 Ga0068862_100004007
631 Ga0068862_100036231
632 Ga0081540_1003971
633 Ga0075363_100185112
634 Ga0075367_10298410
635 Ga0075366_10039267
636 Ga0075370_10006253
637 Ga0099826_10098191
638 Ga0105251_10000153
639 Ga0105251_10001352
640 Ga0105240_10002746
641 Ga0105240_10376512
642 Ga0111539_10558978
643 Ga0105248_10179994
644 Ga0105239_10002039
645 Ga0157370_10003077
646 Ga0157370_10017529
647 Ga0157370_10082125
648 Ga0157369_10000280
649 Ga0157369_10015851
650 Ga0157369_10016809
651 Ga0157369_10104818
652 Ga0157369_10256953
653 Ga0157369_10516638
654 Ga0157374_10002550
655 Ga0163162_10011222
656 Ga0157372_10066010
657 Ga0157372_10636654
658 Ga0157375_10007805
659 Ga0182008_10035619
660 Ga0157376_10097444
661 Ga0182007_10002084
662 Ga0183361_10003
663 Ga0163161_10000072
664 Ga0206356_10649567
665 Ga0206354_10978505
666 Ga0206353_10180007
667 Ga0224712_10000525
668 Ga0209436_104647
669 Ga0209566_105841
670 Ga0209674_100005
671 Ga0209674_100185
672 Ga0209672_100001
673 Ga0209672_101222
674 Ga0209147_100001
675 Ga0209147_100352
676 Ga0209563_100558
677 Ga0207427_100608
678 Ga0209258_100001
679 Ga0209258_100133
680 Ga0207425_1000352
681 Ga0207425_1012932
682 Ga0209026_1000002
683 Ga0209148_1000003
684 Ga0209148_1000188
685 Ga0209759_1000002
686 Ga0209759_1000062
687 Ga0209759_1000093
688 Ga0209759_1000122
689 Ga0209759_1006802
690 Ga0209129_1000245
691 Ga0209129_1004337
692 Ga0209129_1005779
693 Ga0209233_1000198
694 Ga0209565_1000165
695 Ga0209565_1006089
696 Ga0209455_1000001
697 Ga0209673_1000454
698 Ga0209673_1001222
699 Ga0209673_1002781
700 Ga0209130_1001097
701 Ga0209130_1003703
702 Ga0209675_1000823
703 Ga0209675_1011933
704 Ga0209676_1000111
705 Ga0209025_1000157
706 Ga0209025_1000615
707 Ga0209025_1013697
708 Ga0209564_1000070
709 Ga0209564_1000352
710 Ga0209564_1003143
711 Ga0209758_1000005
712 Ga0209758_1000297
713 Ga0209758_1017089
714 Ga0209758_1048666
715 Ga0209050_1000111
716 Ga0209256_1000047
717 Ga0209256_1000238
718 Ga0207426_1000056
719 Ga0207426_1000194
720 Ga0207426_1000294
721 Ga0207426_1001208
722 Ga0209051_1000046
723 Ga0209051_1036611
724 Ga0209257_1000344
725 Ga0209257_1004797
726 Ga0209257_1027317
727 Ga0207656_10009713
728 Ga0207713_1000189
729 Ga0207713_1009383
730 Ga0207680_10059334
731 Ga0207647_10000406
732 Ga0207647_10017358
733 Ga0207647_10033398
734 Ga0207705_10144193
735 Ga0207695_10050701
736 Ga0207695_10406123
737 Ga0207657_10002402
738 Ga0207644_10219013
739 Ga0207711_10064890
740 Ga0207711_10131007
741 Ga0207667_10003983
742 Ga0207658_10533154
743 Ga0207639_10020183
744 Ga0207678_10157044
745 Ga0207678_10178411
746 Ga0207702_10693958
747 Ga0209371_1002502
748 Ga0209813_10065749
749 Ga0307515_10002180
750 Ga0268256_1022320
751 Ga0307513_10270482
752 Ga0307513_10300771
753 Ga0307509_10396341
754 Ga0307514_10006880
755 Ga0265314_10012669
756 Ga0265342_10089293
757 Ga0307412_10000003
758 Ga0307411_10126749
759 Ga0395899_0000031
760 Ga0395899_0006258
761 Ga0395899_0029309
762 Ga0395900_0000776
763 Ga0395900_0000980
764 Ga0395900_0088046
765 Ga0395900_0091955
766 Ga0395900_0140226
767 Ga0395898_0000040
768 Ga0395898_0001377
769 Ga0395898_0033260
770 Ga0395905_0000331
771 Ga0395905_0012724
772 Ga0395905_0225483
773 Ga0395905_0343939
774 Ga0395901_0000002
775 Ga0395901_0000059
776 Ga0395901_0001288
777 Ga0395901_0048474
778 Ga0395901_0237617
779 Ga0400483_024592
780 Ga0400483_276040
781 Ga0439465_0011528
782 Ga0439448_0000023
783 Ga0466969_0027479
784 Ga0466973_0010198
785 Ga0466965_0009456
786 Ga0466966_0000296
787 Ga0466966_0001064
788 Ga0466966_0004266
789 Ga0466961_0001043
790 Ga0466961_0142208
791 Ga0466963_0000764
792 Ga0466963_0025561
793 Ga0466971_0001128
794 Ga0466971_0012181
795 Ga0466971_0066415
796 Ga0466968_0048202
797 Ga0466957_0002214
798 Ga0466957_0025936
799 Ga0466960_0042049
800 Ga0466959_0046076
801 Ga0466959_0242135
802 Ga0466958_0003404
803 Ga0466958_0008148
804 Ga0466958_0014237
805 Ga0466967_0102460
806 Ga0466967_0226957
807 Ga0495592_0004960
808 Ga0495603_0001632
809 Ga0495603_0012371
810 Ga0495603_0214818
811 Ga0495603_0247828
812 Ga0495590_0015966
813 Ga0495590_0017035
814 Ga0495591_002036
815 Ga0495629_0000036
816 Ga0495629_0000111
817 Ga0495629_0003448
818 Ga0495629_0004776
819 Ga0495629_0023637
820 Ga0495638_0006956
821 Ga0495638_0164295
822 Ga0495638_0237035
823 Ga0495641_0052234
824 Ga0495651_0054399
825 Ga0495653_0000903
826 Ga0495653_0016706
827 Ga0495653_0029199
828 Ga0495653_0065153
829 Ga0495650_0000569
830 Ga0495650_0010765
831 Ga0495650_0015179
832 Ga0495580_0000364
833 Ga0495580_0001941
834 Ga0495582_0004954
835 Ga0495605_0011800
836 Ga0495605_0017027
837 Ga0495662_0017287
838 Ga0495662_0063289
839 Ga0495664_0009533
840 Ga0495664_0025079
841 Ga0495664_0075817
842 Ga0495584_0027937
843 Ga0495596_0013784
844 Ga0495596_0048840
845 Ga0495583_0008969
846 Ga0495583_0022960
847 Ga0495583_0039657
848 Ga0495606_0017327
849 Ga0495606_0027108
850 Ga0495606_0143111
851 Ga0495608_0019222
852 Ga0495608_0030652
853 Ga0495618_0006246
854 Ga0495620_0009714
855 Ga0495628_0001651
856 Ga0495628_0008812
857 Ga0495628_0023228
858 Ga0495628_0114204
859 Ga0495628_0185795
860 Ga0495630_0001875
861 Ga0495630_0010481
862 Ga0495630_0025993
863 Ga0495630_0040330
864 Ga0495630_0129068
865 Ga0495648_0034292
866 Ga0495648_0066575
867 Ga0495666_0001148
868 Ga0495666_0013551
869 Ga0495642_0006266
870 Ga0495642_0018489
871 Ga0495652_0005895
872 Ga0495652_0026938
873 Ga0495665_0000587
874 Ga0495665_0015666
875 Ga0495665_0099893
876 Ga0495586_0019750
877 Ga0495586_0021210
878 Ga0495597_0019913
879 Ga0495645_0000082
880 Ga0495645_0030462
881 Ga0495622_0000018
882 Ga0495622_0024373
883 Ga0495667_0059223
884 Ga0495625_0121155
885 Ga0495635_0007366
886 Ga0495635_0017880
887 Ga0495661_0016113
888 Ga0495657_0008291
889 Ga0495599_0020487
890 Ga0495599_0050901
891 Ga0495623_0001827
892 Ga0495623_0003785
893 Ga0495623_0031240
894 Ga0495623_0043374
895 Ga0495646_0002135
896 Ga0495646_0005415
897 Ga0495646_0020958
898 Ga0495646_0021618
899 Ga0495646_0115955
900 Ga0495669_0025132
901 Ga0495613_0032415
902 Ga0495613_0204871
903 Ga0495624_0000143
904 Ga0495624_0003207
905 Ga0495624_0017517
906 Ga0495670_0002144
907 Ga0495671_0078917
908 Ga0495649_0003177
909 Ga0495649_0142989
910 Ga0495589_0019897
911 Ga0495589_0041991
912 Ga0495589_0136512
913 Ga0495600_0000367
914 Ga0495600_0018847
915 Ga0495581_0004187
916 Ga0495581_0020266
917 Ga0495604_0002349
918 Ga0495604_0003876
919 Ga0495604_0033282
920 Ga0495674_0005133
921 Ga0495674_0005267
922 Ga0495674_0016418
923 Ga0495674_0023873
924 Ga0495674_0051747
925 Ga0495674_0082735
926 Ga0495674_0097128
927 Ga0495672_0003902
928 Ga0495672_0020207
929 Ga0495672_0044243
930 Ga0495676_0051254
931 Ga0495676_0097232
932 Ga0495680_0013741
933 Ga0495680_0019670
934 Ga0495680_0031035
935 Ga0495683_0002948
936 Ga0495683_0036148
937 Ga0495687_000005
938 Ga0495687_026516
939 Ga0495687_047347
940 Ga0495675_0001200
941 Ga0495675_0002423
942 Ga0495675_0022241
943 Ga0495675_0092722
944 Ga0495679_000013
945 Ga0495679_002176
946 Ga0495673_0008799
947 Ga0495673_0015538
948 Ga0495673_0065670
949 Ga0495684_0153269
950 Ga0495686_0000044
951 Ga0495686_0037914
952 Ga0495686_0046013
953 Ga0495686_0160662
954 Ga0495593_0001452
955 Ga0495593_0017184
956 Ga0495593_0021236
957 Ga0495593_0030675
958 Ga0495602_0015495
959 Ga0495602_0016626
960 Ga0495602_0041340
961 Ga0495614_0002048
962 Ga0495614_0009830
963 Ga0495626_0027875
964 Ga0496100_0001293
965 Ga0496100_0004171
966 Ga0496100_0030206
967 Ga0496101_0001353
968 Ga0496101_0005807
969 Ga0496101_0125277
970 Ga0496101_0134364
971 Ga0496102_0014438
972 Ga0496102_0062882
973 Ga0496102_0132827
974 Ga0496103_0001338
975 Ga0496103_0048362
976 Ga0496103_0062144
977 Ga0496104_0237807
978 Ga0496104_0335241
979 Ga0496104_0337758
980 Ga0496105_0031093
981 Ga0496106_0000010
982 Ga0496106_0011182
983 Ga0496106_0180181
984 Ga0496107_0038414
985 Ga0496109_0149581
986 Ga0496110_0016653
987 Ga0496110_0461740
988 Ga0496111_0004473
989 Ga0496112_0013438
990 Ga0496112_0055418
991 Ga0496112_0375125
992 Ga0496113_0004711
993 Ga0496113_0009811
994 Ga0496113_0300317
995 Ga0496115_0031033
996 Ga0496115_0033747
997 Ga0496116_0005121
998 Ga0496116_0038014
999 Ga0496116_0049562
1000 Ga0496116_0085290
1001 Ga0496116_0121031
1002 Ga0496117_0001573
1003 Ga0496117_0002608
1004 Ga0496117_0014290
1005 Ga0496117_0032284
1006 Ga0496117_0062434
1007 Ga0496117_0072832
1008 Ga0496117_0079442
1009 Ga0496117_0128887
1010 Ga0496118_0000551
1011 Ga0496118_0002914
1012 Ga0496118_0002935
1013 Ga0496118_0003413
1014 Ga0496118_0019624
1015 Ga0496118_0040951
1016 Ga0496118_0048255
1017 Ga0496118_0094987
1018 Ga0496119_0029396
1019 Ga0496120_0046700
1020 Ga0496121_0002519
1021 Ga0496121_0005770
1022 Ga0496121_0008614
1023 Ga0496121_0013868
1024 Ga0496121_0310926
1025 Ga0496122_0055127
1026 Ga0496123_0018911
1027 Ga0496123_0120112
1028 Ga0496124_0030905
1029 Ga0496124_0035641
1030 Ga0496125_0044173
1031 Ga0496125_0165505
1032 Ga0496126_0000122
1033 Ga0496126_0000164
1034 Ga0496126_0000511
1035 Ga0496126_0023435
1036 Ga0496126_0044993
1037 Ga0496126_0100060
1038 Ga0496126_0146594
1039 Ga0495678_010361
1040 Ga0495678_101723
1041 Ga0495682_0024820
1042 Ga0501034_0004245
1043 Ga0501034_0210716
1044 Ga0501037_0363451
1045 Ga0501041_0108616
1046 Ga0501043_0023314
1047 Ga0501047_0001625
1048 Ga0501047_0086796
1049 Ga0501067_0011248
1050 Ga0501068_0011801
1051 Ga0501073_0235836
1052 Ga0501080_0001426
1053 Ga0501044_0008439
1054 Ga0501044_0227867
1055 nmdc:mga0k408_66221_c1
1056 nmdc:mga06z11_927_c1
1057 nmdc:mga04h51_10279_c1
1058 nmdc:mga07m45_12524_c1
1059 nmdc:mga07m45_36017_c1
1060 Ga0500578_0092904
1061 Ga0500644_0010325
1062 Ga0500646_0016030
1063 Ga0500651_0014879
1064 Ga0500641_0007275
1065 Ga0500555_044580
1066 Ga0500595_001895
1067 Ga0500642_0000786
1068 Ga0500604_0001588
1069 Ga0500604_0010553
1070 Ga0500616_0000705
1071 Ga0500616_0019588
1072 Ga0466962_0011427
1073 Ga0466962_0013424
1074 2600814897
1075 2501071537
1076 2501077045
1077 2501407057
1078 2509130951
1079 2511092729
1080 2511097951
1081 2511108138
1082 2514052413
1083 2516019828
1084 2527074953
1085 2563061295
1086 2599625342
1087 2599673206
1088 2599682876
1089 2599694814
1090 2644164454
1091 2644346275
1092 2713476257
1093 2738820998
1094 2738833480
1095 2738875007
1096 2739186636
1097 2739221605
1098 2746085633
1099 2746092783
1100 2792837646
1101 2819602133
1102 2819621624
1103 2831268277
1104 2842332824
1105 2842357030
1106 2842460808
1107 2856294543
1108 2857367916
1109 2883091958
1110 2885198192
1111 2885212428
1112 2899928799
1113 2900640944
1114 2904485243
1115 2904621733
1116 2919532272
1117 2928043265
1118 2928051142
1119 2928058637
1120 2928066124
1121 2928077840
1122 2928112155
1123 2928139301
1124 2928508561
1125 2945936713
1126 2945972113
1127 2961135478
1128 2990709357
1129 2996338833
1130 642427129
1131 642596404
1132 642616280
1133 8055271757
1134 8055302765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

15

311

0.96

PF08543

Phos_pyr_kin

Phosphomethylpyrimidine kinase

137

295

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rk2-assembly2.cif.gz_C e. coli ribokinase complexed with ribose and adp, solved in space group p212121 0.9744 8 312
4xda-assembly1.cif.gz_A vibrio cholerae o395 ribokinase complexed with ribose, adp and sodium ion. 0.9659 8 312
1rk2-assembly2.cif.gz_C e. coli ribokinase complexed with ribose and adp, solved in space group p212121 0.965 8 312
6znx-assembly1.cif.gz_A ribokinase from thermus species 0.9605 10 309
4xda-assembly1.cif.gz_A vibrio cholerae o395 ribokinase complexed with ribose, adp and sodium ion. 0.9567 8 312
ID Description Score Start End Superfamily
af_Q9VK96_1_314_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9407 10 307 3.40.1190.20
af_O77425_1_304_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9259 6 301 3.40.1190.20
af_Q19133_1_311_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9238 3 307 3.40.1190.20
4x8fD00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9186 8 312 3.40.1190.20
3go6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9123 8 311 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A3N5I0F6-F1-model_v4 deleted 0.9752 148 314
AF-A0A523AR12-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.9742 124 314 GO:0006796
GO:0016301
AF-A0A7L6EDJ9-F1-model_v4 deleted 0.9707 7 312
AF-A0A7L2Q655-F1-model_v4 Ribokinase (EC 2.7.1.15) 0.9684 121 300 GO:0004747
GO:0005524
GO:0005829
GO:0006014
GO:0006753
GO:0046872
AF-A0A7X6EKP8-F1-model_v4 deleted 0.9671 47 166

Map