F464632

General Info

Members Datasets Scaffolds Average Seq Length
568 244 1137 167

Family's Representative Sequence

Representative Sequence 3300015687|Ga0183368_1003|Ga0183368_1003904
Length 196
Sequence MYLCCSDVFARLAPHPNPLPEGEREYGSQDRLPMNPKPNALSWLTLSALVIVLDQLSKWWALTALQPVGLPHPVIPGFLNWTLAFNTGAAFSFLATGDGWQRWFFVLLAVAISAVLVVWLHRTPRSDWKTAMPLALIVGGALGNLIDRLHAAQVTDFIHVYFREWNYPVFNVADCGITVGAVMLVVFGLFAGKSKA

Samples

Sample ID Description Type Environment
1 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
171 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
237 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
238 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
239 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
240 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
241 2739367700 Dyella sp. YR388 Isolate Unclassified
242 2884411467 Dyella sp. AD56 Isolate Rhizosphere
243 2928963466 Dyella japonica 1073 Isolate Unclassified
244 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.35
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.44
Nodule 0
Rhizoplane 2.64
Rhizosphere 74.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0183368_1003 3300015687 Bacteria 1276390
2 JGI24740J21852_10001688 3300001979 Bacteria 10135
3 JGI24739J22299_10000034 3300001989 Bacteria 37891
4 JGI24737J22298_10004787 3300001990 Bacteria 4702
5 JGI24735J21928_10014663 3300002067 Bacteria 2453
6 JGI25156J39149_1003075 3300002705 Bacteria 5643
7 JGI25156J39149_1009839 3300002705 Bacteria 2292
8 JGI25162J39368_1000028 3300002737 Bacteria 221876
9 JGI25162J39368_1000543 3300002737 Bacteria 28047
10 JGI25162J39368_1000892 3300002737 Bacteria 19475
11 JGI25162J39368_1002295 3300002737 Bacteria 7686
12 JGI25157J39369_1000126 3300002741 Bacteria 65430
13 JGI25157J39369_1001761 3300002741 Bacteria 7094
14 JGI25157J39369_1001836 3300002741 Bacteria 6683
15 JGI25163J39215_1000958 3300002771 Bacteria 6477
16 JGI25164J39214_1000012 3300002772 Bacteria 255140
17 JGI25164J39214_1000142 3300002772 Bacteria 68956
18 JGI25164J39214_1002877 3300002772 Bacteria 2383
19 JGI25165J46597_1000048 3300003214 Bacteria 254392
20 JGI25165J46597_1000090 3300003214 Bacteria 168833
21 JGI25165J46597_1002032 3300003214 Bacteria 7686
22 JGI25165J46597_1005517 3300003214 Bacteria 2421
23 rootH1_10072774 3300003316 Bacteria 1779
24 rootH1_10072774 3300003323 Bacteria 3443
25 rootH2_10013356 3300003320 Bacteria 1280
26 rootH1_10133242 3300003323 Bacteria 1157
27 Ga0006562J51391_1036936 3300003578 Bacteria 7281
28 Ga0006562J51391_1036939 3300003578 Bacteria 2050
29 Ga0055538_1000486 3300003751 Bacteria 14526
30 Ga0055533_1000275 3300003756 Bacteria 28133
31 Ga0055527_1000105 3300003760 Bacteria 60329
32 Ga0055527_1000208 3300003760 Bacteria 38056
33 Ga0055527_1000287 3300003760 Bacteria 29514
34 Ga0055535_1000027 3300003761 Bacteria 202056
35 Ga0055535_1000150 3300003761 Bacteria 74086
36 Ga0055535_1000151 3300003761 Bacteria 74028
37 Ga0055535_1001056 3300003761 Bacteria 17171
38 Ga0055535_1002070 3300003761 Bacteria 8026
39 Ga0055535_1005429 3300003761 Bacteria 2796
40 Ga0055542_1000034 3300003762 Bacteria 231972
41 Ga0055542_1000067 3300003762 Bacteria 154585
42 Ga0055542_1000198 3300003762 Bacteria 74085
43 Ga0055542_1000527 3300003762 Bacteria 34247
44 Ga0055542_1000545 3300003762 Bacteria 33464
45 Ga0055542_1000660 3300003762 Bacteria 28222
46 Ga0055529_1000056 3300003763 Bacteria 196316
47 Ga0055529_1000523 3300003763 Bacteria 33464
48 Ga0055529_1000579 3300003763 Bacteria 29514
49 Ga0055529_1000662 3300003763 Bacteria 24306
50 Ga0065165_1006392 3300005262 Bacteria 6200
51 Ga0070658_10055558 3300005327 Bacteria 3217
52 Ga0070658_10086966 3300005327 Bacteria 2572
53 Ga0070658_10562081 3300005327 Bacteria 987
54 Ga0070658_10614070 3300005327 Bacteria 943
55 Ga0070676_10940143 3300005328 Bacteria 646
56 Ga0070670_100328054 3300005331 Bacteria 1342
57 Ga0070666_10000012 3300005335 Bacteria 244720
58 Ga0070666_10054389 3300005335 Bacteria 2700
59 Ga0070680_100709226 3300005336 Bacteria 866
60 Ga0070660_100171894 3300005339 Bacteria 1750
61 Ga0070660_100323323 3300005339 Bacteria 1267
62 Ga0070660_100705777 3300005339 Bacteria 846
63 Ga0070661_100009137 3300005344 Bacteria 6852
64 Ga0070661_100596631 3300005344 Bacteria 893
65 Ga0070692_10033333 3300005345 Bacteria 2594
66 Ga0070668_100075406 3300005347 Bacteria 2633
67 Ga0070668_100103818 3300005347 Bacteria 2255
68 Ga0070668_100175998 3300005347 Bacteria 1745
69 Ga0070668_101114681 3300005347 Bacteria 713
70 Ga0070671_100063698 3300005355 Bacteria 3071
71 Ga0070688_100214591 3300005365 Bacteria 1353
72 Ga0070659_100075563 3300005366 Bacteria 2685
73 Ga0070659_100163573 3300005366 Bacteria 1820
74 Ga0070667_100007059 3300005367 Bacteria 9337
75 Ga0070667_100301452 3300005367 Bacteria 1443
76 Ga0070667_100865322 3300005367 Bacteria 841
77 Ga0070714_100000149 3300005435 Bacteria 55827
78 Ga0070714_100055414 3300005435 Bacteria 3388
79 Ga0070663_100205681 3300005455 Bacteria 1539
80 Ga0070663_100261468 3300005455 Bacteria 1373
81 Ga0070663_100341226 3300005455 Bacteria 1210
82 Ga0070663_101000942 3300005455 Bacteria 727
83 Ga0070662_100151274 3300005457 Bacteria 1807
84 Ga0070662_100702113 3300005457 Bacteria 856
85 Ga0070681_10033994 3300005458 Bacteria 5119
86 Ga0068867_100923786 3300005459 Bacteria 787
87 Ga0070685_10019167 3300005466 Bacteria 3689
88 Ga0070685_10825993 3300005466 Bacteria 685
89 Ga0070685_11227120 3300005466 Bacteria 571
90 Ga0070699_101094575 3300005518 Bacteria 731
91 Ga0070679_100038879 3300005530 Bacteria 4731
92 Ga0068853_100024989 3300005539 Bacteria 5012
93 Ga0068853_100145962 3300005539 Bacteria 2126
94 Ga0068853_100147633 3300005539 Bacteria 2114
95 Ga0068853_100361887 3300005539 Bacteria 1351
96 Ga0068853_100404284 3300005539 Bacteria 1278
97 Ga0070672_100255506 3300005543 Bacteria 1477
98 Ga0070696_100060690 3300005546 Bacteria 2644
99 Ga0070693_100085563 3300005547 Bacteria 1890
100 Ga0070665_100071479 3300005548 Bacteria 3476
101 Ga0070665_100348593 3300005548 Bacteria 1486
102 Ga0070665_101295367 3300005548 Bacteria 739
103 Ga0068857_100000672 3300005577 Bacteria 25353
104 Ga0068857_100594189 3300005577 Bacteria 1046
105 Ga0068854_100000561 3300005578 Bacteria 22299
106 Ga0068854_101100456 3300005578 Bacteria 708
107 Ga0068856_100001698 3300005614 Bacteria 23028
108 Ga0068856_100105886 3300005614 Bacteria 2807
109 Ga0068856_100238880 3300005614 Bacteria 1832
110 Ga0068856_100292199 3300005614 Bacteria 1647
111 Ga0068852_100016006 3300005616 Bacteria 5838
112 Ga0068852_100165957 3300005616 Bacteria 2066
113 Ga0068859_100002763 3300005617 Bacteria 17790
114 Ga0068851_10003445 3300005834 Bacteria 7041
115 Ga0068863_100075711 3300005841 Bacteria 3184
116 Ga0068863_100222077 3300005841 Bacteria 1821
117 Ga0068858_100418937 3300005842 Bacteria 1288
118 Ga0068858_100431404 3300005842 Bacteria 1268
119 Ga0068860_100127338 3300005843 Bacteria 2441
120 Ga0068860_100518709 3300005843 Bacteria 1191
121 Ga0068862_100002311 3300005844 Bacteria 17022
122 Ga0068862_100062819 3300005844 Bacteria 3195
123 Ga0068862_100172381 3300005844 Bacteria 1938
124 Ga0081455_10307949 3300005937 Bacteria 1133
125 Ga0081540_1005755 3300005983 Bacteria 9176
126 Ga0070712_100424011 3300006175 Bacteria 1103
127 Ga0097621_100431936 3300006237 Bacteria 1184
128 Ga0068871_100596079 3300006358 Bacteria 1004
129 Ga0068865_100622438 3300006881 Bacteria 915
130 Ga0097620_100002763 3300006931 Bacteria 17790
131 Ga0105240_10033676 3300009093 Bacteria 6615
132 Ga0105240_10270760 3300009093 Bacteria 1955
133 Ga0105240_10270761 3300009093 Bacteria 1955
134 Ga0105240_10686131 3300009093 Bacteria 1119
135 Ga0105240_10952420 3300009093 Bacteria 921
136 Ga0105245_10060083 3300009098 Bacteria 3423
137 Ga0105247_10156081 3300009101 Bacteria 1507
138 Ga0105243_11364747 3300009148 Bacteria 728
139 Ga0105241_10232599 3300009174 Bacteria 1554
140 Ga0105242_10449177 3300009176 Bacteria 1215
141 Ga0105248_10159318 3300009177 Bacteria 2546
142 Ga0105237_10000152 3300009545 Bacteria 96802
143 Ga0105237_10008719 3300009545 Bacteria 10949
144 Ga0105237_10237462 3300009545 Bacteria 1824
145 Ga0105237_10368758 3300009545 Bacteria 1441
146 Ga0105237_10727299 3300009545 Bacteria 999
147 Ga0105238_10000539 3300009551 Bacteria 39694
148 Ga0105238_10009781 3300009551 Bacteria 9599
149 Ga0105238_10140670 3300009551 Bacteria 2390
150 Ga0105238_10154185 3300009551 Bacteria 2272
151 Ga0105238_11594528 3300009551 Bacteria 683
152 Ga0105249_10359028 3300009553 Bacteria 1478
153 Ga0105239_10039526 3300010375 Bacteria 5168
154 Ga0105239_10225711 3300010375 Bacteria 2101
155 Ga0105239_10230689 3300010375 Bacteria 2077
156 Ga0105239_10292300 3300010375 Bacteria 1835
157 Ga0105239_10463245 3300010375 Bacteria 1439
158 Ga0105239_10714507 3300010375 Bacteria 1146
159 Ga0105239_11581930 3300010375 Bacteria 758
160 Ga0105239_12155620 3300010375 Bacteria 648
161 Ga0157373_10109786 3300013100 Bacteria 1939
162 Ga0157373_10311007 3300013100 Bacteria 1120
163 Ga0157373_11266470 3300013100 Bacteria 557
164 Ga0157370_10534242 3300013104 Bacteria 1076
165 Ga0157370_10689050 3300013104 Bacteria 933
166 Ga0157370_10690106 3300013104 Bacteria 932
167 Ga0157369_10000025 3300013105 Bacteria 225515
168 Ga0157369_10020462 3300013105 Bacteria 7396
169 Ga0157369_10070328 3300013105 Bacteria 3760
170 Ga0157369_10122541 3300013105 Bacteria 2758
171 Ga0157369_10286783 3300013105 Bacteria 1714
172 Ga0157369_10452202 3300013105 Bacteria 1330
173 Ga0157374_10630349 3300013296 Bacteria 1083
174 Ga0157374_10773442 3300013296 Bacteria 975
175 Ga0163162_10002678 3300013306 Bacteria 16879
176 Ga0163162_10010488 3300013306 Bacteria 9010
177 Ga0163162_10154445 3300013306 Bacteria 2414
178 Ga0163162_10480222 3300013306 Bacteria 1374
179 Ga0163162_11339030 3300013306 Bacteria 814
180 Ga0157372_10005257 3300013307 Bacteria 13747
181 Ga0157372_10006905 3300013307 Bacteria 12083
182 Ga0157372_10177706 3300013307 Bacteria 2464
183 Ga0157372_10407379 3300013307 Bacteria 1584
184 Ga0157372_10418708 3300013307 Bacteria 1561
185 Ga0157372_11844492 3300013307 Bacteria 695
186 Ga0157375_10001204 3300013308 Bacteria 22309
187 Ga0157375_10385191 3300013308 Bacteria 1569
188 Ga0157375_10819157 3300013308 Bacteria 1079
189 Ga0163163_10080519 3300014325 Bacteria 3257
190 Ga0182008_10035881 3300014497 Bacteria 2482
191 Ga0182008_10039312 3300014497 Bacteria 2364
192 Ga0182008_10145272 3300014497 Bacteria 1188
193 Ga0182008_10227372 3300014497 Bacteria 956
194 Ga0157376_10795321 3300014969 Bacteria 958
195 Ga0182006_1032272 3300015261 Bacteria 2106
196 Ga0182006_1035910 3300015261 Bacteria 1973
197 Ga0182006_1056106 3300015261 Bacteria 1501
198 Ga0182007_10042044 3300015262 Bacteria 1522
199 Ga0183369_1006 3300015685 Bacteria 449058
200 Ga0163161_10377208 3300017792 Bacteria 1133
201 Ga0163161_10476955 3300017792 Bacteria 1012
202 Ga0209760_100326 3300025207 Bacteria 14354
203 Ga0209784_100016 3300025224 Bacteria 481036
204 Ga0209566_101531 3300025225 Bacteria 6319
205 Ga0209674_100012 3300025226 Bacteria 950162
206 Ga0209674_100119 3300025226 Bacteria 135468
207 Ga0209674_100528 3300025226 Bacteria 15440
208 Ga0209672_100007 3300025228 Bacteria 959482
209 Ga0209672_100016 3300025228 Bacteria 522604
210 Ga0209672_100078 3300025228 Bacteria 156926
211 Ga0209672_100750 3300025228 Bacteria 15803
212 Ga0209672_100763 3300025228 Bacteria 15501
213 Ga0209563_100169 3300025230 Bacteria 46948
214 Ga0207427_100019 3300025231 Bacteria 513977
215 Ga0207427_100033 3300025231 Bacteria 338459
216 Ga0207427_100148 3300025231 Bacteria 79097
217 Ga0207427_100855 3300025231 Bacteria 13524
218 Ga0209437_100054 3300025233 Bacteria 366715
219 Ga0209437_100079 3300025233 Bacteria 275948
220 Ga0209437_100105 3300025233 Bacteria 220034
221 Ga0209437_100126 3300025233 Bacteria 192521
222 Ga0209258_100012 3300025242 Bacteria 825544
223 Ga0209258_100039 3300025242 Bacteria 386366
224 Ga0209258_100046 3300025242 Bacteria 369794
225 Ga0209258_100095 3300025242 Bacteria 223270
226 Ga0209258_100245 3300025242 Bacteria 100255
227 Ga0209258_100948 3300025242 Bacteria 13930
228 Ga0209258_103389 3300025242 Bacteria 3452
229 Ga0209646_1002877 3300025246 Bacteria 3595
230 Ga0209646_1003024 3300025246 Bacteria 3457
231 Ga0209026_1000012 3300025250 Bacteria 480426
232 Ga0209026_1000140 3300025250 Bacteria 115081
233 Ga0209026_1000682 3300025250 Bacteria 20450
234 Ga0209026_1001255 3300025250 Bacteria 11580
235 Ga0209677_102666 3300025253 Bacteria 6460
236 Ga0209148_1000001 3300025254 Bacteria 2545271
237 Ga0209148_1000002 3300025254 Bacteria 2399500
238 Ga0209148_1000014 3300025254 Bacteria 925277
239 Ga0209148_1000039 3300025254 Bacteria 482479
240 Ga0209148_1000087 3300025254 Bacteria 260905
241 Ga0209148_1000098 3300025254 Bacteria 233172
242 Ga0209759_1000404 3300025256 Bacteria 53269
243 Ga0209759_1000957 3300025256 Bacteria 20487
244 Ga0209759_1001106 3300025256 Bacteria 17418
245 Ga0209759_1018076 3300025256 Bacteria 1715
246 Ga0209129_1001461 3300025258 Bacteria 13179
247 Ga0209233_1000002 3300025261 Bacteria 2501366
248 Ga0209233_1000080 3300025261 Bacteria 338459
249 Ga0209233_1000121 3300025261 Bacteria 233309
250 Ga0209455_1000010 3300025272 Bacteria 959482
251 Ga0209455_1000034 3300025272 Bacteria 483129
252 Ga0209455_1000039 3300025272 Bacteria 437734
253 Ga0209455_1000126 3300025272 Bacteria 165771
254 Ga0209455_1003767 3300025272 Bacteria 5224
255 Ga0209758_1000849 3300025297 Bacteria 42560
256 Ga0207656_10002962 3300025321 Bacteria 5796
257 Ga0207680_10000013 3300025903 Bacteria 244716
258 Ga0207680_10163761 3300025903 Bacteria 1493
259 Ga0207647_10004378 3300025904 Bacteria 10474
260 Ga0207647_10053693 3300025904 Bacteria 2482
261 Ga0207645_10579782 3300025907 Bacteria 761
262 Ga0207705_10010260 3300025909 Bacteria 6815
263 Ga0207654_10018066 3300025911 Bacteria 3698
264 Ga0207654_10033108 3300025911 Bacteria 2862
265 Ga0207654_10097255 3300025911 Bacteria 1807
266 Ga0207654_10341235 3300025911 Bacteria 1029
267 Ga0207707_10059541 3300025912 Bacteria 3323
268 Ga0207707_10082597 3300025912 Bacteria 2805
269 Ga0207695_10000295 3300025913 Bacteria 123533
270 Ga0207695_10001184 3300025913 Bacteria 45016
271 Ga0207695_10008624 3300025913 Bacteria 12736
272 Ga0207695_10018793 3300025913 Bacteria 7976
273 Ga0207695_10192656 3300025913 Bacteria 1955
274 Ga0207671_10000031 3300025914 Bacteria 247030
275 Ga0207671_10012657 3300025914 Bacteria 6772
276 Ga0207671_10467431 3300025914 Bacteria 1005
277 Ga0207693_10396225 3300025915 Bacteria 1079
278 Ga0207660_10763319 3300025917 Bacteria 789
279 Ga0207657_10033707 3300025919 Bacteria 4613
280 Ga0207657_10104751 3300025919 Bacteria 2343
281 Ga0207649_10005950 3300025920 Bacteria 6616
282 Ga0207649_10032097 3300025920 Bacteria 3128
283 Ga0207649_10122798 3300025920 Bacteria 1753
284 Ga0207652_10023081 3300025921 Bacteria 5153
285 Ga0207694_10000704 3300025924 Bacteria 30012
286 Ga0207694_10010517 3300025924 Bacteria 6980
287 Ga0207694_10033174 3300025924 Bacteria 3955
288 Ga0207694_10050362 3300025924 Bacteria 3225
289 Ga0207650_10198853 3300025925 Bacteria 1604
290 Ga0207650_11143738 3300025925 Bacteria 663
291 Ga0207687_10252776 3300025927 Bacteria 1402
292 Ga0207664_10000093 3300025929 Bacteria 81829
293 Ga0207644_10150059 3300025931 Bacteria 1803
294 Ga0207690_10011741 3300025932 Bacteria 5239
295 Ga0207690_10032467 3300025932 Bacteria 3350
296 Ga0207690_10036445 3300025932 Bacteria 3185
297 Ga0207690_10065342 3300025932 Bacteria 2488
298 Ga0207690_10073295 3300025932 Bacteria 2367
299 Ga0207706_10085734 3300025933 Bacteria 2769
300 Ga0207706_10090200 3300025933 Bacteria 2695
301 Ga0207706_10592908 3300025933 Bacteria 952
302 Ga0207706_10821906 3300025933 Bacteria 788
303 Ga0207686_10382074 3300025934 Bacteria 1068
304 Ga0207704_10081861 3300025938 Bacteria 2089
305 Ga0207665_10428917 3300025939 Bacteria 1011
306 Ga0207711_10061066 3300025941 Bacteria 3249
307 Ga0207689_10318855 3300025942 Bacteria 1290
308 Ga0207667_10002389 3300025949 Bacteria 23499
309 Ga0207667_10002430 3300025949 Bacteria 23322
310 Ga0207667_10073624 3300025949 Bacteria 3549
311 Ga0207667_10092842 3300025949 Bacteria 3117
312 Ga0207667_10562765 3300025949 Bacteria 1152
313 Ga0207667_11498038 3300025949 Bacteria 646
314 Ga0207667_11864753 3300025949 Bacteria 564
315 Ga0207712_11057507 3300025961 Bacteria 721
316 Ga0207668_10064394 3300025972 Bacteria 2590
317 Ga0207668_10078756 3300025972 Bacteria 2381
318 Ga0207668_10877633 3300025972 Bacteria 797
319 Ga0207640_10000042 3300025981 Bacteria 102885
320 Ga0207640_11441706 3300025981 Bacteria 618
321 Ga0207658_10103929 3300025986 Bacteria 2231
322 Ga0207658_10294797 3300025986 Bacteria 1395
323 Ga0207658_11178969 3300025986 Bacteria 700
324 Ga0207703_10392688 3300026035 Bacteria 1286
325 Ga0207639_10002590 3300026041 Bacteria 12137
326 Ga0207639_10498549 3300026041 Bacteria 1112
327 Ga0207639_11004892 3300026041 Bacteria 781
328 Ga0207678_10037358 3300026067 Bacteria 4223
329 Ga0207678_10145824 3300026067 Bacteria 2020
330 Ga0207678_10168247 3300026067 Bacteria 1872
331 Ga0207702_10000340 3300026078 Bacteria 53705
332 Ga0207702_10249621 3300026078 Bacteria 1666
333 Ga0207702_10388025 3300026078 Bacteria 1344
334 Ga0207702_10401264 3300026078 Bacteria 1322
335 Ga0207702_10794041 3300026078 Bacteria 935
336 Ga0207641_10307211 3300026088 Bacteria 1500
337 Ga0207648_10802518 3300026089 Bacteria 876
338 Ga0207674_10003283 3300026116 Bacteria 19892
339 Ga0207674_10079374 3300026116 Bacteria 3286
340 Ga0207674_10842242 3300026116 Bacteria 884
341 Ga0207683_10332947 3300026121 Bacteria 1392
342 Ga0207698_10033342 3300026142 Bacteria 3741
343 Ga0207698_10295973 3300026142 Bacteria 1504
344 Ga0268266_10000021 3300028379 Bacteria 522453
345 Ga0268266_10044680 3300028379 Bacteria 3787
346 Ga0268266_10044691 3300028379 Bacteria 3787
347 Ga0268266_10108964 3300028379 Bacteria 2452
348 Ga0268266_10194105 3300028379 Bacteria 1855
349 Ga0268266_10287014 3300028379 Bacteria 1532
350 Ga0268266_10619142 3300028379 Bacteria 1040
351 Ga0268266_11194007 3300028379 Bacteria 736
352 Ga0268265_10000131 3300028380 Bacteria 95615
353 Ga0268265_10025633 3300028380 Bacteria 4189
354 Ga0268265_10103372 3300028380 Bacteria 2307
355 Ga0268265_11925695 3300028380 Bacteria 598
356 Ga0268264_10150753 3300028381 Bacteria 2084
357 Ga0307517_10117094 3300028786 Bacteria 1991
358 Ga0307517_10359366 3300028786 Bacteria 787
359 Ga0316575_10066473 3300031665 Bacteria 1444
360 Ga0307510_10013127 3300033180 Bacteria 9827
361 Ga0395899_0000175 3300037312 Bacteria 95781
362 Ga0395899_0062376 3300037312 Bacteria 2745
363 Ga0395899_0106429 3300037312 Bacteria 2019
364 Ga0395899_0137674 3300037312 Bacteria 1739
365 Ga0395899_0308734 3300037312 Bacteria 1068
366 Ga0395900_0000012 3300037418 Bacteria 401198
367 Ga0395900_0002519 3300037418 Bacteria 20088
368 Ga0395900_0158197 3300037418 Bacteria 2313
369 Ga0395900_0254584 3300037418 Bacteria 1755
370 Ga0395898_0000034 3300037466 Bacteria 356745
371 Ga0395898_0275543 3300037466 Bacteria 1604
372 Ga0395905_0218522 3300037471 Bacteria 1784
373 Ga0395901_0000153 3300038443 Bacteria 89901
374 Ga0395901_0009786 3300038443 Bacteria 9723
375 Ga0395901_0275221 3300038443 Bacteria 1750
376 Ga0395901_0288812 3300038443 Bacteria 1702
377 Ga0395901_0361114 3300038443 Bacteria 1497
378 Ga0395901_0411606 3300038443 Bacteria 1388
379 Ga0451789_0064352 3300041443 Bacteria 796
380 Ga0451793_0434983 3300041452 Bacteria 893
381 Ga0451797_0328390 3300041453 Bacteria 635
382 Ga0451807_0331359 3300041486 Bacteria 2406
383 Ga0451837_1083787 3300041494 Bacteria 1080
384 Ga0451849_0109245 3300041505 Bacteria 1209
385 Ga0451853_0284825 3300041512 Bacteria 871
386 Ga0451853_0745924 3300041512 Bacteria 1114
387 Ga0439448_0034344 3300042005 Bacteria 1620
388 Ga0466969_0003219 3300044656 Bacteria 8687
389 Ga0466969_0006865 3300044656 Bacteria 6057
390 Ga0466969_0012734 3300044656 Bacteria 4431
391 Ga0466972_0245870 3300044658 Bacteria 836
392 Ga0466989_0102555 3300044663 Bacteria 1757
393 Ga0466982_0000013 3300044672 Bacteria 136227
394 Ga0466965_0063806 3300044683 Bacteria 1844
395 Ga0466966_0014175 3300044684 Bacteria 5276
396 Ga0466966_0545384 3300044684 Bacteria 698
397 Ga0466961_0003307 3300044693 Bacteria 10049
398 Ga0466961_0004378 3300044693 Bacteria 8843
399 Ga0466961_0004782 3300044693 Bacteria 8527
400 Ga0466961_0010594 3300044693 Bacteria 5883
401 Ga0466963_0788436 3300044694 Bacteria 670
402 Ga0466964_0112011 3300044706 Bacteria 1218
403 Ga0466964_0156750 3300044706 Bacteria 1060
404 Ga0466971_0001495 3300044719 Bacteria 9869
405 Ga0466971_0008126 3300044719 Bacteria 4574
406 Ga0466971_0299834 3300044719 Bacteria 771
407 Ga0466968_0001106 3300044735 Bacteria 9528
408 Ga0466970_0010066 3300044765 Bacteria 4790
409 Ga0466957_0021697 3300044842 Bacteria 3784
410 Ga0466957_0235407 3300044842 Bacteria 1213
411 Ga0466959_0001362 3300045049 Bacteria 14925
412 Ga0466959_0007101 3300045049 Bacteria 7836
413 Ga0466959_0257955 3300045049 Bacteria 1200
414 Ga0466959_0326401 3300045049 Bacteria 1048
415 Ga0466958_0037196 3300045836 Bacteria 2916
416 Ga0466958_0109135 3300045836 Bacteria 1727
417 Ga0466958_0437240 3300045836 Bacteria 846
418 Ga0466967_0315914 3300045976 Bacteria 1506
419 Ga0495638_0000095 3300046460 Bacteria 141825
420 Ga0495638_0000314 3300046460 Bacteria 62575
421 Ga0495650_0000078 3300046471 Bacteria 245487
422 Ga0495650_0000497 3300046471 Bacteria 59612
423 Ga0495606_0001281 3300046507 Bacteria 34808
424 Ga0495606_0058884 3300046507 Bacteria 2467
425 Ga0495625_0017091 3300046660 Bacteria 5685
426 Ga0495625_0067426 3300046660 Bacteria 2518
427 Ga0495657_0575539 3300046675 Bacteria 653
428 Ga0495671_0290666 3300046692 Bacteria 787
429 Ga0495649_0001777 3300046694 Bacteria 15902
430 Ga0496104_0000016 3300048907 Bacteria 335025
431 Ga0496104_0360192 3300048907 Bacteria 1367
432 Ga0496105_0000010 3300048908 Bacteria 309880
433 Ga0496105_0382878 3300048908 Bacteria 1119
434 Ga0496106_0563629 3300048909 Bacteria 914
435 Ga0496109_1134102 3300048912 Bacteria 719
436 Ga0496114_0548903 3300048917 Bacteria 1021
437 Ga0496115_0000025 3300048918 Bacteria 151658
438 Ga0496115_0000543 3300048918 Bacteria 29378
439 Ga0496115_0074223 3300048918 Bacteria 2761
440 Ga0496115_0311411 3300048918 Bacteria 1289
441 Ga0496121_0016611 3300048924 Bacteria 7586
442 Ga0496121_0350558 3300048924 Bacteria 983
443 Ga0496121_0442388 3300048924 Bacteria 840
444 Ga0496122_0372905 3300048925 Bacteria 736
445 Ga0496124_0048537 3300048927 Bacteria 3627
446 Ga0496125_0000137 3300048928 Bacteria 160328
447 Ga0496125_0149756 3300048928 Bacteria 1605
448 Ga0496126_0010033 3300048929 Bacteria 9994
449 Ga0496126_0014545 3300048929 Bacteria 7949
450 Ga0496126_0017770 3300048929 Bacteria 7079
451 Ga0495682_0048289 3300049460 Bacteria 1552
452 Ga0501031_0021615 3300049568 Bacteria 4194
453 Ga0501031_0533506 3300049568 Bacteria 756
454 Ga0501032_0002060 3300049569 Bacteria 15876
455 Ga0501032_0022900 3300049569 Bacteria 4324
456 Ga0501032_0082686 3300049569 Bacteria 2136
457 Ga0501033_0001245 3300049570 Bacteria 22869
458 Ga0501033_0074871 3300049570 Bacteria 2485
459 Ga0501033_0452147 3300049570 Bacteria 892
460 Ga0501034_0003387 3300049571 Bacteria 18205
461 Ga0501034_0005193 3300049571 Bacteria 14286
462 Ga0501034_0124592 3300049571 Bacteria 2562
463 Ga0501034_0153761 3300049571 Bacteria 2275
464 Ga0501036_0032660 3300049572 Bacteria 4400
465 Ga0501036_0083554 3300049572 Bacteria 2699
466 Ga0501036_0217728 3300049572 Bacteria 1603
467 Ga0501037_0043787 3300049573 Bacteria 3289
468 Ga0501037_0077750 3300049573 Bacteria 2408
469 Ga0501037_0334502 3300049573 Bacteria 1047
470 Ga0501038_0002975 3300049574 Bacteria 15791
471 Ga0501038_0142973 3300049574 Bacteria 1956
472 Ga0501038_0217653 3300049574 Bacteria 1525
473 Ga0501038_0453819 3300049574 Bacteria 985
474 Ga0501038_0568251 3300049574 Bacteria 861
475 Ga0501039_0022444 3300049575 Bacteria 4844
476 Ga0501039_0024623 3300049575 Bacteria 4623
477 Ga0501042_0326855 3300049578 Bacteria 1108
478 Ga0501043_0066354 3300049579 Bacteria 2834
479 Ga0501043_0089633 3300049579 Bacteria 2417
480 Ga0501043_0166703 3300049579 Bacteria 1720
481 Ga0501043_0256300 3300049579 Bacteria 1346
482 Ga0501043_0350703 3300049579 Bacteria 1121
483 Ga0501043_0360476 3300049579 Bacteria 1103
484 Ga0501046_0019928 3300049580 Bacteria 5553
485 Ga0501046_0028816 3300049580 Bacteria 4518
486 Ga0501046_0141753 3300049580 Bacteria 1818
487 Ga0501046_0410434 3300049580 Bacteria 977
488 Ga0501047_0004207 3300049581 Bacteria 13559
489 Ga0501047_0007243 3300049581 Bacteria 10428
490 Ga0501047_0010730 3300049581 Bacteria 8660
491 Ga0501047_0239292 3300049581 Bacteria 1666
492 Ga0501047_0279166 3300049581 Bacteria 1515
493 Ga0501047_0338909 3300049581 Bacteria 1341
494 Ga0501048_0067417 3300049582 Bacteria 2529
495 Ga0501048_0228542 3300049582 Bacteria 1320
496 Ga0501048_0425976 3300049582 Bacteria 949
497 Ga0501048_0548509 3300049582 Bacteria 829
498 Ga0501067_0012924 3300049583 Bacteria 4621
499 Ga0501067_0087017 3300049583 Bacteria 1733
500 Ga0501067_0530119 3300049583 Bacteria 659
501 Ga0501069_0063697 3300049585 Bacteria 2059
502 Ga0501069_0278024 3300049585 Bacteria 979
503 Ga0501069_0325628 3300049585 Bacteria 903
504 Ga0501070_0004527 3300049586 Bacteria 11927
505 Ga0501070_0022929 3300049586 Bacteria 5226
506 Ga0501070_0101505 3300049586 Bacteria 2379
507 Ga0501070_0112346 3300049586 Bacteria 2251
508 Ga0501071_0156890 3300049587 Bacteria 1699
509 Ga0501072_0008520 3300049588 Bacteria 7779
510 Ga0501072_0322198 3300049588 Bacteria 1228
511 Ga0501073_0017853 3300049589 Bacteria 5135
512 Ga0501073_0113226 3300049589 Bacteria 1881
513 Ga0501073_0242000 3300049589 Bacteria 1246
514 Ga0501073_0249813 3300049589 Bacteria 1224
515 Ga0501074_0013244 3300049590 Bacteria 5996
516 Ga0501074_0015632 3300049590 Bacteria 5517
517 Ga0501074_0063521 3300049590 Bacteria 2659
518 Ga0501074_0090269 3300049590 Bacteria 2194
519 Ga0501074_0658660 3300049590 Bacteria 739
520 Ga0501079_0044354 3300049741 Bacteria 3432
521 Ga0501079_0090121 3300049741 Bacteria 2375
522 Ga0501080_0002085 3300049742 Bacteria 17356
523 Ga0501080_0002431 3300049742 Bacteria 16267
524 Ga0501080_0052824 3300049742 Bacteria 3782
525 Ga0501080_0062608 3300049742 Bacteria 3462
526 Ga0501080_0219284 3300049742 Bacteria 1741
527 Ga0501081_0284907 3300049743 Bacteria 1210
528 Ga0501083_0036783 3300049744 Bacteria 3337
529 Ga0501083_0111342 3300049744 Bacteria 1800
530 Ga0501083_0118470 3300049744 Bacteria 1737
531 Ga0501035_0016740 3300049822 Bacteria 6760
532 Ga0501035_0051521 3300049822 Bacteria 3685
533 Ga0501035_0145890 3300049822 Bacteria 2055
534 Ga0501035_0146497 3300049822 Bacteria 2050
535 Ga0501035_0171458 3300049822 Bacteria 1874
536 Ga0501035_0400959 3300049822 Bacteria 1141
537 Ga0501035_0729486 3300049822 Bacteria 797
538 Ga0501035_0880629 3300049822 Bacteria 710
539 Ga0501044_0053162 3300049823 Bacteria 4168
540 Ga0501044_0071731 3300049823 Bacteria 3521
541 Ga0501044_0098730 3300049823 Bacteria 2939
542 Ga0501044_0100441 3300049823 Bacteria 2911
543 Ga0501044_0103722 3300049823 Bacteria 2858
544 Ga0501044_0337539 3300049823 Bacteria 1428
545 Ga0501044_0407253 3300049823 Bacteria 1272
546 Ga0501045_0184266 3300049824 Bacteria 1555
547 Ga0501045_0656325 3300049824 Bacteria 775
548 Ga0500651_0001415 3300053093 Bacteria 12059
549 Ga0500651_0025470 3300053093 Bacteria 3712
550 Ga0500568_0000512 3300053139 Bacteria 28625
551 Ga0501084_0190511 3300054114 Bacteria 1730
552 Ga0501084_0615454 3300054114 Bacteria 917
553 Ga0501084_0869473 3300054114 Bacteria 758
554 Ga0500661_005296 3300055283 Bacteria 2413
555 Ga0501082_0000144 3300060353 Bacteria 59165
556 Ga0501082_0071307 3300060353 Bacteria 2992
557 Ga0501082_0177626 3300060353 Bacteria 1851
558 Ga0466962_0001995 3300061719 Bacteria 9639
559 Ga0466962_0007885 3300061719 Bacteria 5105
560 Ga0466962_0020978 3300061719 Bacteria 3140
561 2538832321 2537561836 Bacteria 3910579
562 2643830343 2643221562 Bacteria 4048635
563 2643895062 2643221577 Bacteria 3710843
564 2644477221 2643221685 Bacteria 3673288
565 2687583336 2687453130 Bacteria 4227172
566 2739731906 2739367700 Bacteria 4747630
567 2884413365 2884411467 Bacteria 5246714
568 2928964603 2928963466 Bacteria 5165703
569 2939612471 2939611941 Bacteria 3892017
570 Ga0183368_1003
571 JGI24740J21852_10001688
572 JGI24739J22299_10000034
573 JGI24737J22298_10004787
574 JGI24735J21928_10014663
575 JGI25156J39149_1003075
576 JGI25156J39149_1009839
577 JGI25162J39368_1000028
578 JGI25162J39368_1000543
579 JGI25162J39368_1000892
580 JGI25162J39368_1002295
581 JGI25157J39369_1000126
582 JGI25157J39369_1001761
583 JGI25157J39369_1001836
584 JGI25163J39215_1000958
585 JGI25164J39214_1000012
586 JGI25164J39214_1000142
587 JGI25164J39214_1002877
588 JGI25165J46597_1000048
589 JGI25165J46597_1000090
590 JGI25165J46597_1002032
591 JGI25165J46597_1005517
592 rootH1_10072774
593 rootH2_10013356
594 rootH1_10133242
595 Ga0006562J51391_1036936
596 Ga0006562J51391_1036939
597 Ga0055538_1000486
598 Ga0055533_1000275
599 Ga0055527_1000105
600 Ga0055527_1000208
601 Ga0055527_1000287
602 Ga0055535_1000027
603 Ga0055535_1000150
604 Ga0055535_1000151
605 Ga0055535_1001056
606 Ga0055535_1002070
607 Ga0055535_1005429
608 Ga0055542_1000034
609 Ga0055542_1000067
610 Ga0055542_1000198
611 Ga0055542_1000527
612 Ga0055542_1000545
613 Ga0055542_1000660
614 Ga0055529_1000056
615 Ga0055529_1000523
616 Ga0055529_1000579
617 Ga0055529_1000662
618 Ga0065165_1006392
619 Ga0070658_10055558
620 Ga0070658_10086966
621 Ga0070658_10562081
622 Ga0070658_10614070
623 Ga0070676_10940143
624 Ga0070670_100328054
625 Ga0070666_10000012
626 Ga0070666_10054389
627 Ga0070680_100709226
628 Ga0070660_100171894
629 Ga0070660_100323323
630 Ga0070660_100705777
631 Ga0070661_100009137
632 Ga0070661_100596631
633 Ga0070692_10033333
634 Ga0070668_100075406
635 Ga0070668_100103818
636 Ga0070668_100175998
637 Ga0070668_101114681
638 Ga0070671_100063698
639 Ga0070688_100214591
640 Ga0070659_100075563
641 Ga0070659_100163573
642 Ga0070667_100007059
643 Ga0070667_100301452
644 Ga0070667_100865322
645 Ga0070714_100000149
646 Ga0070714_100055414
647 Ga0070663_100205681
648 Ga0070663_100261468
649 Ga0070663_100341226
650 Ga0070663_101000942
651 Ga0070662_100151274
652 Ga0070662_100702113
653 Ga0070681_10033994
654 Ga0068867_100923786
655 Ga0070685_10019167
656 Ga0070685_10825993
657 Ga0070685_11227120
658 Ga0070699_101094575
659 Ga0070679_100038879
660 Ga0068853_100024989
661 Ga0068853_100145962
662 Ga0068853_100147633
663 Ga0068853_100361887
664 Ga0068853_100404284
665 Ga0070672_100255506
666 Ga0070696_100060690
667 Ga0070693_100085563
668 Ga0070665_100071479
669 Ga0070665_100348593
670 Ga0070665_101295367
671 Ga0068857_100000672
672 Ga0068857_100594189
673 Ga0068854_100000561
674 Ga0068854_101100456
675 Ga0068856_100001698
676 Ga0068856_100105886
677 Ga0068856_100238880
678 Ga0068856_100292199
679 Ga0068852_100016006
680 Ga0068852_100165957
681 Ga0068859_100002763
682 Ga0068851_10003445
683 Ga0068863_100075711
684 Ga0068863_100222077
685 Ga0068858_100418937
686 Ga0068858_100431404
687 Ga0068860_100127338
688 Ga0068860_100518709
689 Ga0068862_100002311
690 Ga0068862_100062819
691 Ga0068862_100172381
692 Ga0081455_10307949
693 Ga0081540_1005755
694 Ga0070712_100424011
695 Ga0097621_100431936
696 Ga0068871_100596079
697 Ga0068865_100622438
698 Ga0097620_100002763
699 Ga0105240_10033676
700 Ga0105240_10270760
701 Ga0105240_10270761
702 Ga0105240_10686131
703 Ga0105240_10952420
704 Ga0105245_10060083
705 Ga0105247_10156081
706 Ga0105243_11364747
707 Ga0105241_10232599
708 Ga0105242_10449177
709 Ga0105248_10159318
710 Ga0105237_10000152
711 Ga0105237_10008719
712 Ga0105237_10237462
713 Ga0105237_10368758
714 Ga0105237_10727299
715 Ga0105238_10000539
716 Ga0105238_10009781
717 Ga0105238_10140670
718 Ga0105238_10154185
719 Ga0105238_11594528
720 Ga0105249_10359028
721 Ga0105239_10039526
722 Ga0105239_10225711
723 Ga0105239_10230689
724 Ga0105239_10292300
725 Ga0105239_10463245
726 Ga0105239_10714507
727 Ga0105239_11581930
728 Ga0105239_12155620
729 Ga0157373_10109786
730 Ga0157373_10311007
731 Ga0157373_11266470
732 Ga0157370_10534242
733 Ga0157370_10689050
734 Ga0157370_10690106
735 Ga0157369_10000025
736 Ga0157369_10020462
737 Ga0157369_10070328
738 Ga0157369_10122541
739 Ga0157369_10286783
740 Ga0157369_10452202
741 Ga0157374_10630349
742 Ga0157374_10773442
743 Ga0163162_10002678
744 Ga0163162_10010488
745 Ga0163162_10154445
746 Ga0163162_10480222
747 Ga0163162_11339030
748 Ga0157372_10005257
749 Ga0157372_10006905
750 Ga0157372_10177706
751 Ga0157372_10407379
752 Ga0157372_10418708
753 Ga0157372_11844492
754 Ga0157375_10001204
755 Ga0157375_10385191
756 Ga0157375_10819157
757 Ga0163163_10080519
758 Ga0182008_10035881
759 Ga0182008_10039312
760 Ga0182008_10145272
761 Ga0182008_10227372
762 Ga0157376_10795321
763 Ga0182006_1032272
764 Ga0182006_1035910
765 Ga0182006_1056106
766 Ga0182007_10042044
767 Ga0183369_1006
768 Ga0163161_10377208
769 Ga0163161_10476955
770 Ga0209760_100326
771 Ga0209784_100016
772 Ga0209566_101531
773 Ga0209674_100012
774 Ga0209674_100119
775 Ga0209674_100528
776 Ga0209672_100007
777 Ga0209672_100016
778 Ga0209672_100078
779 Ga0209672_100750
780 Ga0209672_100763
781 Ga0209563_100169
782 Ga0207427_100019
783 Ga0207427_100033
784 Ga0207427_100148
785 Ga0207427_100855
786 Ga0209437_100054
787 Ga0209437_100079
788 Ga0209437_100105
789 Ga0209437_100126
790 Ga0209258_100012
791 Ga0209258_100039
792 Ga0209258_100046
793 Ga0209258_100095
794 Ga0209258_100245
795 Ga0209258_100948
796 Ga0209258_103389
797 Ga0209646_1002877
798 Ga0209646_1003024
799 Ga0209026_1000012
800 Ga0209026_1000140
801 Ga0209026_1000682
802 Ga0209026_1001255
803 Ga0209677_102666
804 Ga0209148_1000001
805 Ga0209148_1000002
806 Ga0209148_1000014
807 Ga0209148_1000039
808 Ga0209148_1000087
809 Ga0209148_1000098
810 Ga0209759_1000404
811 Ga0209759_1000957
812 Ga0209759_1001106
813 Ga0209759_1018076
814 Ga0209129_1001461
815 Ga0209233_1000002
816 Ga0209233_1000080
817 Ga0209233_1000121
818 Ga0209455_1000010
819 Ga0209455_1000034
820 Ga0209455_1000039
821 Ga0209455_1000126
822 Ga0209455_1003767
823 Ga0209758_1000849
824 Ga0207656_10002962
825 Ga0207680_10000013
826 Ga0207680_10163761
827 Ga0207647_10004378
828 Ga0207647_10053693
829 Ga0207645_10579782
830 Ga0207705_10010260
831 Ga0207654_10018066
832 Ga0207654_10033108
833 Ga0207654_10097255
834 Ga0207654_10341235
835 Ga0207707_10059541
836 Ga0207707_10082597
837 Ga0207695_10000295
838 Ga0207695_10001184
839 Ga0207695_10008624
840 Ga0207695_10018793
841 Ga0207695_10192656
842 Ga0207671_10000031
843 Ga0207671_10012657
844 Ga0207671_10467431
845 Ga0207693_10396225
846 Ga0207660_10763319
847 Ga0207657_10033707
848 Ga0207657_10104751
849 Ga0207649_10005950
850 Ga0207649_10032097
851 Ga0207649_10122798
852 Ga0207652_10023081
853 Ga0207694_10000704
854 Ga0207694_10010517
855 Ga0207694_10033174
856 Ga0207694_10050362
857 Ga0207650_10198853
858 Ga0207650_11143738
859 Ga0207687_10252776
860 Ga0207664_10000093
861 Ga0207644_10150059
862 Ga0207690_10011741
863 Ga0207690_10032467
864 Ga0207690_10036445
865 Ga0207690_10065342
866 Ga0207690_10073295
867 Ga0207706_10085734
868 Ga0207706_10090200
869 Ga0207706_10592908
870 Ga0207706_10821906
871 Ga0207686_10382074
872 Ga0207704_10081861
873 Ga0207665_10428917
874 Ga0207711_10061066
875 Ga0207689_10318855
876 Ga0207667_10002389
877 Ga0207667_10002430
878 Ga0207667_10073624
879 Ga0207667_10092842
880 Ga0207667_10562765
881 Ga0207667_11498038
882 Ga0207667_11864753
883 Ga0207712_11057507
884 Ga0207668_10064394
885 Ga0207668_10078756
886 Ga0207668_10877633
887 Ga0207640_10000042
888 Ga0207640_11441706
889 Ga0207658_10103929
890 Ga0207658_10294797
891 Ga0207658_11178969
892 Ga0207703_10392688
893 Ga0207639_10002590
894 Ga0207639_10498549
895 Ga0207639_11004892
896 Ga0207678_10037358
897 Ga0207678_10145824
898 Ga0207678_10168247
899 Ga0207702_10000340
900 Ga0207702_10249621
901 Ga0207702_10388025
902 Ga0207702_10401264
903 Ga0207702_10794041
904 Ga0207641_10307211
905 Ga0207648_10802518
906 Ga0207674_10003283
907 Ga0207674_10079374
908 Ga0207674_10842242
909 Ga0207683_10332947
910 Ga0207698_10033342
911 Ga0207698_10295973
912 Ga0268266_10000021
913 Ga0268266_10044680
914 Ga0268266_10044691
915 Ga0268266_10108964
916 Ga0268266_10194105
917 Ga0268266_10287014
918 Ga0268266_10619142
919 Ga0268266_11194007
920 Ga0268265_10000131
921 Ga0268265_10025633
922 Ga0268265_10103372
923 Ga0268265_11925695
924 Ga0268264_10150753
925 Ga0307517_10117094
926 Ga0307517_10359366
927 Ga0316575_10066473
928 Ga0307510_10013127
929 Ga0395899_0000175
930 Ga0395899_0062376
931 Ga0395899_0106429
932 Ga0395899_0137674
933 Ga0395899_0308734
934 Ga0395900_0000012
935 Ga0395900_0002519
936 Ga0395900_0158197
937 Ga0395900_0254584
938 Ga0395898_0000034
939 Ga0395898_0275543
940 Ga0395905_0218522
941 Ga0395901_0000153
942 Ga0395901_0009786
943 Ga0395901_0275221
944 Ga0395901_0288812
945 Ga0395901_0361114
946 Ga0395901_0411606
947 Ga0451789_0064352
948 Ga0451793_0434983
949 Ga0451797_0328390
950 Ga0451807_0331359
951 Ga0451837_1083787
952 Ga0451849_0109245
953 Ga0451853_0284825
954 Ga0451853_0745924
955 Ga0439448_0034344
956 Ga0466969_0003219
957 Ga0466969_0006865
958 Ga0466969_0012734
959 Ga0466972_0245870
960 Ga0466989_0102555
961 Ga0466982_0000013
962 Ga0466965_0063806
963 Ga0466966_0014175
964 Ga0466966_0545384
965 Ga0466961_0003307
966 Ga0466961_0004378
967 Ga0466961_0004782
968 Ga0466961_0010594
969 Ga0466963_0788436
970 Ga0466964_0112011
971 Ga0466964_0156750
972 Ga0466971_0001495
973 Ga0466971_0008126
974 Ga0466971_0299834
975 Ga0466968_0001106
976 Ga0466970_0010066
977 Ga0466957_0021697
978 Ga0466957_0235407
979 Ga0466959_0001362
980 Ga0466959_0007101
981 Ga0466959_0257955
982 Ga0466959_0326401
983 Ga0466958_0037196
984 Ga0466958_0109135
985 Ga0466958_0437240
986 Ga0466967_0315914
987 Ga0495638_0000095
988 Ga0495638_0000314
989 Ga0495650_0000078
990 Ga0495650_0000497
991 Ga0495606_0001281
992 Ga0495606_0058884
993 Ga0495625_0017091
994 Ga0495625_0067426
995 Ga0495657_0575539
996 Ga0495671_0290666
997 Ga0495649_0001777
998 Ga0496104_0000016
999 Ga0496104_0360192
1000 Ga0496105_0000010
1001 Ga0496105_0382878
1002 Ga0496106_0563629
1003 Ga0496109_1134102
1004 Ga0496114_0548903
1005 Ga0496115_0000025
1006 Ga0496115_0000543
1007 Ga0496115_0074223
1008 Ga0496115_0311411
1009 Ga0496121_0016611
1010 Ga0496121_0350558
1011 Ga0496121_0442388
1012 Ga0496122_0372905
1013 Ga0496124_0048537
1014 Ga0496125_0000137
1015 Ga0496125_0149756
1016 Ga0496126_0010033
1017 Ga0496126_0014545
1018 Ga0496126_0017770
1019 Ga0495682_0048289
1020 Ga0501031_0021615
1021 Ga0501031_0533506
1022 Ga0501032_0002060
1023 Ga0501032_0022900
1024 Ga0501032_0082686
1025 Ga0501033_0001245
1026 Ga0501033_0074871
1027 Ga0501033_0452147
1028 Ga0501034_0003387
1029 Ga0501034_0005193
1030 Ga0501034_0124592
1031 Ga0501034_0153761
1032 Ga0501036_0032660
1033 Ga0501036_0083554
1034 Ga0501036_0217728
1035 Ga0501037_0043787
1036 Ga0501037_0077750
1037 Ga0501037_0334502
1038 Ga0501038_0002975
1039 Ga0501038_0142973
1040 Ga0501038_0217653
1041 Ga0501038_0453819
1042 Ga0501038_0568251
1043 Ga0501039_0022444
1044 Ga0501039_0024623
1045 Ga0501042_0326855
1046 Ga0501043_0066354
1047 Ga0501043_0089633
1048 Ga0501043_0166703
1049 Ga0501043_0256300
1050 Ga0501043_0350703
1051 Ga0501043_0360476
1052 Ga0501046_0019928
1053 Ga0501046_0028816
1054 Ga0501046_0141753
1055 Ga0501046_0410434
1056 Ga0501047_0004207
1057 Ga0501047_0007243
1058 Ga0501047_0010730
1059 Ga0501047_0239292
1060 Ga0501047_0279166
1061 Ga0501047_0338909
1062 Ga0501048_0067417
1063 Ga0501048_0228542
1064 Ga0501048_0425976
1065 Ga0501048_0548509
1066 Ga0501067_0012924
1067 Ga0501067_0087017
1068 Ga0501067_0530119
1069 Ga0501069_0063697
1070 Ga0501069_0278024
1071 Ga0501069_0325628
1072 Ga0501070_0004527
1073 Ga0501070_0022929
1074 Ga0501070_0101505
1075 Ga0501070_0112346
1076 Ga0501071_0156890
1077 Ga0501072_0008520
1078 Ga0501072_0322198
1079 Ga0501073_0017853
1080 Ga0501073_0113226
1081 Ga0501073_0242000
1082 Ga0501073_0249813
1083 Ga0501074_0013244
1084 Ga0501074_0015632
1085 Ga0501074_0063521
1086 Ga0501074_0090269
1087 Ga0501074_0658660
1088 Ga0501079_0044354
1089 Ga0501079_0090121
1090 Ga0501080_0002085
1091 Ga0501080_0002431
1092 Ga0501080_0052824
1093 Ga0501080_0062608
1094 Ga0501080_0219284
1095 Ga0501081_0284907
1096 Ga0501083_0036783
1097 Ga0501083_0111342
1098 Ga0501083_0118470
1099 Ga0501035_0016740
1100 Ga0501035_0051521
1101 Ga0501035_0145890
1102 Ga0501035_0146497
1103 Ga0501035_0171458
1104 Ga0501035_0400959
1105 Ga0501035_0729486
1106 Ga0501035_0880629
1107 Ga0501044_0053162
1108 Ga0501044_0071731
1109 Ga0501044_0098730
1110 Ga0501044_0100441
1111 Ga0501044_0103722
1112 Ga0501044_0337539
1113 Ga0501044_0407253
1114 Ga0501045_0184266
1115 Ga0501045_0656325
1116 Ga0500651_0001415
1117 Ga0500651_0025470
1118 Ga0500568_0000512
1119 Ga0501084_0190511
1120 Ga0501084_0615454
1121 Ga0501084_0869473
1122 Ga0500661_005296
1123 Ga0501082_0000144
1124 Ga0501082_0071307
1125 Ga0501082_0177626
1126 Ga0466962_0001995
1127 Ga0466962_0007885
1128 Ga0466962_0020978
1129 2538832321
1130 2643830343
1131 2643895062
1132 2644477221
1133 2687583336
1134 2739731906
1135 2884413365
1136 2928964603
1137 2939612471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

46

190

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8753 10 154
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.8643 3 153
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.8643 7 152
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8484 10 154
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.8376 3 153
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8846 14 156 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8676 14 156 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8341 14 156 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8181 14 156 3.90.1420.10
af_P9WK99_39_178_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.7734 14 156 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A1J5DLZ5-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) 0.9312 66 162 GO:0004190
GO:0005886
GO:0006508
AF-A0A091C163-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9078 1 166 GO:0004190
GO:0005886
GO:0006508
AF-A0A4R2MXG1-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9041 2 161 GO:0004190
GO:0005886
GO:0006508
AF-A0A2S7UYD1-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9029 6 162 GO:0004190
GO:0005886
GO:0006508
AF-A1JJE2-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9022 6 155 GO:0004190
GO:0005886
GO:0006508

Map