F464656

General Info

Members Datasets Scaffolds Average Seq Length
568 350 495 263

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1228683|Ga0451853_1228683_2552_3340
Length 262
Sequence LPVLPGAEPYRHEGGEVGVLLCHGFTGSPQSLRPWARHLAGQGLTVSLPLLPGHGTRWQDMALTGWQDWYAEVDRELRALRARCTRVFVAGLSMGGTLALRLAAKHGEGAGGIEGVIVVNPSNKLHGLSPYALPVARHVVRSTKGITSDIAKEGVLETGYDRVPLHSAYSLRTFLRLVDTELPQVTQPLLLLHSVRDHVVPPADSARILSRVSSTDVTEILLEQSYHVATLDLDADRIFEESYAFIARIAPSVGKEGTAVGG

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
11 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
12 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
13 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
14 2643221714 Streptomyces sp. Root264 Isolate Unclassified
15 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
16 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
17 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
18 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
19 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
20 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
21 2808606448 Streptomyces sp. 193411 Isolate Unclassified
22 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
23 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
24 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
25 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
26 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
27 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
28 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
29 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
30 2862574272 Streptomyces sp. AcE210 Isolate Nodule
31 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
32 2867428634 Streptomyces sp. RP5T Isolate Unclassified
33 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
34 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
35 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
36 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
37 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
38 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
39 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
40 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
41 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
42 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
43 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
44 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
45 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
46 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
47 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
48 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
49 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
50 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
51 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
52 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
53 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
54 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
55 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
56 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
57 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
58 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
59 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
60 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
61 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
62 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
63 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
64 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
65 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
66 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
178 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
335 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
336 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
337 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
338 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
343 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
344 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
345 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
346 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
347 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
348 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
349 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
350 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.27
Metatranscriptomes 0.88
Isolates 12.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0.7
Rhizoplane 2.11
Rhizosphere 82.39
Stem 0
Stem Tuber 0
Unclassified 11.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10023255 3300001989 Bacteria 2192
2 JGI24737J22298_10004279 3300001990 Bacteria 4986
3 rootH1_10010278 3300003316 Bacteria 7321
4 rootH1_10031271 3300003316 Bacteria 2667
5 rootH2_10027403 3300003320 Bacteria 18484
6 rootH2_10091911 3300003320 Bacteria 2882
7 rootH2_10158663 3300003320 Bacteria 1211
8 rootL2_10024691 3300003322 Bacteria 7673
9 rootL2_10066964 3300003322 Bacteria 1799
10 rootH1_10034984 3300003323 Bacteria 2621
11 rootH1_10360870 3300003323 Bacteria 1662
12 Ga0006562J51391_1102959 3300003578 Bacteria 6230
13 Ga0006562J51391_1102960 3300003578 Bacteria 4470
14 Ga0070661_100037388 3300005344 Bacteria 3531
15 Ga0070663_100464743 3300005455 Bacteria 1045
16 Ga0070707_100036920 3300005468 Bacteria 4663
17 Ga0070698_100248118 3300005471 Bacteria 1713
18 Ga0070699_100008113 3300005518 Bacteria 9119
19 Ga0070697_100006229 3300005536 Bacteria 9238
20 Ga0068853_100053625 3300005539 Bacteria 3472
21 Ga0070665_100038014 3300005548 Bacteria 4838
22 Ga0070665_100154827 3300005548 Bacteria 2294
23 Ga0068855_100001116 3300005563 Bacteria 33381
24 Ga0068854_100024692 3300005578 Bacteria 4118
25 Ga0068852_100004978 3300005616 Bacteria 9451
26 Ga0068864_100015806 3300005618 Bacteria 6279
27 Ga0068851_10196789 3300005834 Bacteria 1123
28 Ga0068858_100154120 3300005842 Bacteria 2161
29 Ga0081455_10002841 3300005937 Bacteria 20392
30 Ga0081455_10036518 3300005937 Bacteria 4374
31 Ga0070717_10014967 3300006028 Bacteria 5975
32 Ga0075365_10105081 3300006038 Bacteria 1937
33 Ga0075368_10006078 3300006042 Bacteria 4197
34 Ga0075363_100002201 3300006048 Bacteria 7863
35 Ga0075367_10029300 3300006178 Bacteria 3148
36 Ga0099826_10034755 3300006948 Bacteria 3596
37 Ga0099794_10086779 3300007265 Bacteria 1550
38 Ga0105251_10051824 3300009011 Bacteria 1956
39 Ga0105244_10073308 3300009036 Bacteria 1704
40 Ga0105240_10055853 3300009093 Bacteria 4943
41 Ga0105245_10242747 3300009098 Bacteria 1747
42 Ga0105247_10017248 3300009101 Bacteria 4334
43 Ga0105243_10340006 3300009148 Bacteria 1374
44 Ga0105241_10000679 3300009174 Bacteria 25627
45 Ga0105241_10034637 3300009174 Bacteria 3795
46 Ga0105237_10130765 3300009545 Bacteria 2504
47 Ga0105238_10010167 3300009551 Bacteria 9437
48 Ga0105238_10215251 3300009551 Bacteria 1897
49 Ga0105238_10314370 3300009551 Bacteria 1551
50 Ga0105239_10037296 3300010375 Bacteria 5331
51 Ga0105246_10002113 3300011119 Bacteria 11983
52 Ga0157343_1000829 3300012488 Bacteria 1357
53 Ga0157373_10042310 3300013100 Bacteria 3256
54 Ga0157371_10076264 3300013102 Bacteria 2374
55 Ga0157369_10071398 3300013105 Bacteria 3727
56 Ga0157372_10151979 3300013307 Bacteria 2672
57 Ga0157375_10102777 3300013308 Bacteria 2943
58 Ga0163163_10016694 3300014325 Bacteria 6828
59 Ga0182008_10000486 3300014497 Bacteria 29992
60 Ga0157376_10723962 3300014969 Bacteria 1002
61 Ga0182007_10000417 3300015262 Bacteria 26024
62 Ga0182005_1017455 3300015265 Bacteria 1987
63 Ga0183367_1007 3300015688 Bacteria 498079
64 Ga0206354_11636024 3300020081 Bacteria 4190
65 Ga0213875_10028957 3300021388 Bacteria 2626
66 Ga0213875_10079620 3300021388 Bacteria 1529
67 Ga0224712_10040279 3300022467 Bacteria 1757
68 Ga0209758_1001981 3300025297 Bacteria 22138
69 Ga0207426_1026436 3300025302 Bacteria 1944
70 Ga0207426_1038319 3300025302 Bacteria 1510
71 Ga0207656_10189875 3300025321 Bacteria 989
72 Ga0207653_10003530 3300025885 Bacteria 4926
73 Ga0207647_10008916 3300025904 Bacteria 7154
74 Ga0207647_10040323 3300025904 Bacteria 2942
75 Ga0207654_10006807 3300025911 Bacteria 5749
76 Ga0207695_10001784 3300025913 Bacteria 33946
77 Ga0207671_10000197 3300025914 Bacteria 93773
78 Ga0207646_10011452 3300025922 Bacteria 8594
79 Ga0207694_10001211 3300025924 Bacteria 22390
80 Ga0207664_10297725 3300025929 Bacteria 1419
81 Ga0207667_10013515 3300025949 Bacteria 9334
82 Ga0207667_10459336 3300025949 Bacteria 1293
83 Ga0207640_10004638 3300025981 Bacteria 7459
84 Ga0207703_10025726 3300026035 Bacteria 4630
85 Ga0207639_10302198 3300026041 Bacteria 1415
86 Ga0207678_10032455 3300026067 Bacteria 4550
87 Ga0207698_10015142 3300026142 Bacteria 5156
88 Ga0209282_1093592 3300027666 Bacteria 1567
89 Ga0209813_10003206 3300027866 Bacteria 3815
90 Ga0268266_10077906 3300028379 Bacteria 2883
91 Ga0268266_10092995 3300028379 Bacteria 2646
92 Ga0307517_10018082 3300028786 Bacteria 9139
93 Ga0307517_10075082 3300028786 Bacteria 2971
94 Ga0307515_10007501 3300028794 Bacteria 21554
95 Ga0307515_10084333 3300028794 Bacteria 4082
96 Ga0307515_10179707 3300028794 Bacteria 2071
97 Ga0268256_1010041 3300030500 Bacteria 3093
98 Ga0307512_10000928 3300030522 Bacteria 43100
99 Ga0307512_10023281 3300030522 Bacteria 5538
100 Ga0265760_10033750 3300031090 Bacteria 1512
101 Ga0307513_10047966 3300031456 Bacteria 4641
102 Ga0307508_10003596 3300031616 Bacteria 15586
103 Ga0307508_10005083 3300031616 Bacteria 12620
104 Ga0307508_10167308 3300031616 Bacteria 1802
105 Ga0307514_10025550 3300031649 Bacteria 4777
106 Ga0307514_10038303 3300031649 Bacteria 3792
107 Ga0307514_10055105 3300031649 Bacteria 3059
108 Ga0307514_10076253 3300031649 Bacteria 2497
109 Ga0307516_10001107 3300031730 Bacteria 37573
110 Ga0307516_10039828 3300031730 Bacteria 4681
111 Ga0307516_10243686 3300031730 Bacteria 1495
112 Ga0307410_10193601 3300031852 Bacteria 1548
113 Ga0307416_100160649 3300032002 Bacteria 2076
114 Ga0307507_10044230 3300033179 Bacteria 4405
115 Ga0307510_10065591 3300033180 Bacteria 3675
116 Ga0373926_0004377 3300035083 Bacteria 4633
117 Ga0373929_0002320 3300035085 Bacteria 3501
118 Ga0373944_0001963 3300035089 Bacteria 5213
119 Ga0373949_0008455 3300035090 Bacteria 2252
120 Ga0373951_0008897 3300035091 Bacteria 2264
121 Ga0373923_0000179 3300035111 Bacteria 12695
122 Ga0373936_0000270 3300035113 Bacteria 17147
123 Ga0373939_0004427 3300035114 Bacteria 3320
124 Ga0373941_0002580 3300035115 Bacteria 4014
125 Ga0373945_0003964 3300035116 Bacteria 4682
126 Ga0373954_0002763 3300035118 Bacteria 7390
127 Ga0373956_0001686 3300035119 Bacteria 9097
128 Ga0373957_0005664 3300035120 Bacteria 3885
129 Ga0373943_0002519 3300035170 Bacteria 8333
130 Ga0373946_0000573 3300035171 Bacteria 12133
131 Ga0373955_0002817 3300035172 Bacteria 7638
132 Ga0373961_0009815 3300035241 Bacteria 2347
133 Ga0373924_0000459 3300035410 Bacteria 12513
134 Ga0373927_0001795 3300035695 Bacteria 16014
135 Ga0373933_0009548 3300035724 Bacteria 5296
136 Ga0373947_0002555 3300035725 Bacteria 10932
137 Ga0395898_0097281 3300037466 Bacteria 2827
138 Ga0436364_0661135 3300037853 Bacteria 9590
139 Ga0439439_0010508 3300041406 Bacteria 2214
140 Ga0451791_0640598 3300041451 Bacteria 1740
141 Ga0451837_1241739 3300041494 Bacteria 4413
142 Ga0451853_0711683 3300041512 Bacteria 1869
143 Ga0451853_1228683 3300041512 Bacteria 3456
144 Ga0439433_0011669 3300041999 Bacteria 1925
145 Ga0439442_011382 3300042002 Bacteria 1811
146 Ga0439448_0025107 3300042005 Bacteria 1867
147 Ga0439449_0001336 3300042007 Bacteria 9661
148 Ga0439455_0000063 3300042012 Bacteria 9665
149 Ga0439457_004235 3300042014 Bacteria 3777
150 Ga0439462_0009074 3300042015 Bacteria 2516
151 Ga0450903_000152 3300042138 Bacteria 15217
152 Ga0439458_0004411 3300042157 Bacteria 3232
153 Ga0466972_0026645 3300044658 Bacteria 2864
154 Ga0466972_0045089 3300044658 Bacteria 2137
155 Ga0466965_0004218 3300044683 Bacteria 6387
156 Ga0466965_0075640 3300044683 Bacteria 1698
157 Ga0466966_0008759 3300044684 Bacteria 6699
158 Ga0466966_0023227 3300044684 Bacteria 4062
159 Ga0466961_0008025 3300044693 Bacteria 6727
160 Ga0466961_0014821 3300044693 Bacteria 5009
161 Ga0466961_0018271 3300044693 Bacteria 4508
162 Ga0466963_0050128 3300044694 Bacteria 2763
163 Ga0466971_0000796 3300044719 Bacteria 12735
164 Ga0466971_0046873 3300044719 Bacteria 1942
165 Ga0466970_0001789 3300044765 Bacteria 10353
166 Ga0466970_0050535 3300044765 Bacteria 2217
167 Ga0466970_0110041 3300044765 Bacteria 1504
168 Ga0466970_0255825 3300044765 Bacteria 982
169 Ga0466957_0003220 3300044842 Bacteria 8929
170 Ga0466960_0009254 3300044901 Bacteria 4056
171 Ga0466959_0000221 3300045049 Bacteria 37038
172 Ga0466958_0003039 3300045836 Bacteria 8598
173 Ga0466967_0019734 3300045976 Bacteria 5428
174 Ga0466967_0060452 3300045976 Bacteria 3357
175 Ga0495617_007479 3300046452 Bacteria 3790
176 Ga0495627_031960 3300046453 Bacteria 1659
177 Ga0495592_0008040 3300046454 Bacteria 7921
178 Ga0495592_0015898 3300046454 Bacteria 5709
179 Ga0495603_0001034 3300046455 Bacteria 16081
180 Ga0495603_0005308 3300046455 Bacteria 7684
181 Ga0495603_0007257 3300046455 Bacteria 6656
182 Ga0495603_0022146 3300046455 Bacteria 3847
183 Ga0495603_0059891 3300046455 Bacteria 2250
184 Ga0495603_0104367 3300046455 Bacteria 1654
185 Ga0495590_0021229 3300046457 Bacteria 2303
186 Ga0495629_0005562 3300046459 Bacteria 9407
187 Ga0495629_0009064 3300046459 Bacteria 7292
188 Ga0495629_0011240 3300046459 Bacteria 6502
189 Ga0495629_0040064 3300046459 Bacteria 3296
190 Ga0495629_0042383 3300046459 Bacteria 3199
191 Ga0495629_0066017 3300046459 Bacteria 2525
192 Ga0495629_0128997 3300046459 Bacteria 1761
193 Ga0495629_0187888 3300046459 Bacteria 1430
194 Ga0495638_0034171 3300046460 Bacteria 3247
195 Ga0495638_0079725 3300046460 Bacteria 1990
196 Ga0495638_0197834 3300046460 Bacteria 1136
197 Ga0495641_0007716 3300046461 Bacteria 6672
198 Ga0495651_0001608 3300046462 Bacteria 17489
199 Ga0495651_0008217 3300046462 Bacteria 7999
200 Ga0495651_0017761 3300046462 Bacteria 5507
201 Ga0495651_0020069 3300046462 Bacteria 5186
202 Ga0495653_0146951 3300046463 Bacteria 1651
203 Ga0495653_0241614 3300046463 Bacteria 1203
204 Ga0495580_0007269 3300046472 Bacteria 8904
205 Ga0495582_0009887 3300046473 Bacteria 5249
206 Ga0495582_0019588 3300046473 Bacteria 3701
207 Ga0495582_0027672 3300046473 Bacteria 3109
208 Ga0495639_0004782 3300046475 Bacteria 5822
209 Ga0495662_0002329 3300046476 Bacteria 9570
210 Ga0495662_0002671 3300046476 Bacteria 9011
211 Ga0495662_0117874 3300046476 Bacteria 1302
212 Ga0495664_0003143 3300046477 Bacteria 8966
213 Ga0495664_0014549 3300046477 Bacteria 4462
214 Ga0495664_0082658 3300046477 Bacteria 1926
215 Ga0495584_0226430 3300046491 Bacteria 950
216 Ga0495585_0008157 3300046492 Bacteria 6363
217 Ga0495585_0049464 3300046492 Bacteria 2334
218 Ga0495585_0050229 3300046492 Bacteria 2314
219 Ga0495585_0059066 3300046492 Bacteria 2114
220 Ga0495585_0096131 3300046492 Bacteria 1590
221 Ga0495594_0000111 3300046499 Bacteria 38274
222 Ga0495594_0058695 3300046499 Bacteria 2126
223 Ga0495596_0054631 3300046500 Bacteria 1561
224 Ga0495607_0012279 3300046501 Bacteria 5662
225 Ga0495583_0036426 3300046506 Bacteria 2340
226 Ga0495583_0099637 3300046506 Bacteria 1241
227 Ga0495606_0006317 3300046507 Bacteria 10976
228 Ga0495608_0005658 3300046511 Bacteria 8919
229 Ga0495608_0065965 3300046511 Bacteria 2370
230 Ga0495608_0227265 3300046511 Bacteria 1169
231 Ga0495616_0001639 3300046513 Bacteria 15348
232 Ga0495618_0001158 3300046514 Bacteria 17855
233 Ga0495618_0057699 3300046514 Bacteria 2458
234 Ga0495618_0090649 3300046514 Bacteria 1954
235 Ga0495620_0005733 3300046515 Bacteria 6904
236 Ga0495620_0010234 3300046515 Bacteria 4947
237 Ga0495620_0084724 3300046515 Bacteria 1278
238 Ga0495628_0012311 3300046516 Bacteria 7211
239 Ga0495628_0038682 3300046516 Bacteria 3817
240 Ga0495628_0091009 3300046516 Bacteria 2361
241 Ga0495628_0101392 3300046516 Bacteria 2221
242 Ga0495630_0002481 3300046517 Bacteria 12782
243 Ga0495630_0283644 3300046517 Bacteria 1265
244 Ga0495631_0005423 3300046518 Bacteria 6674
245 Ga0495632_0020295 3300046519 Bacteria 3599
246 Ga0495643_0014682 3300046522 Bacteria 4653
247 Ga0495648_0121731 3300046524 Bacteria 1401
248 Ga0495666_0001980 3300046526 Bacteria 10111
249 Ga0495666_0006627 3300046526 Bacteria 5822
250 Ga0495642_0065028 3300046528 Bacteria 1518
251 Ga0495652_0014624 3300046529 Bacteria 7036
252 Ga0495652_0019813 3300046529 Bacteria 5986
253 Ga0495652_0031081 3300046529 Bacteria 4679
254 Ga0495652_0033521 3300046529 Bacteria 4483
255 Ga0495654_0031996 3300046530 Bacteria 2668
256 Ga0495665_0000949 3300046531 Bacteria 15287
257 Ga0495640_0006036 3300046533 Bacteria 9612
258 Ga0495640_0008552 3300046533 Bacteria 8023
259 Ga0495640_0020160 3300046533 Bacteria 4911
260 Ga0495586_0005898 3300046535 Bacteria 6551
261 Ga0495587_0003176 3300046536 Bacteria 10985
262 Ga0495587_0012417 3300046536 Bacteria 5361
263 Ga0495587_0064828 3300046536 Bacteria 2134
264 Ga0495609_0053769 3300046538 Bacteria 1789
265 Ga0495597_0038913 3300046542 Bacteria 2130
266 Ga0495645_0005997 3300046543 Bacteria 8403
267 Ga0495645_0023893 3300046543 Bacteria 4431
268 Ga0495622_0022481 3300046557 Bacteria 2938
269 Ga0495622_0049154 3300046557 Bacteria 1958
270 Ga0495622_0072929 3300046557 Bacteria 1584
271 Ga0495633_0009428 3300046558 Bacteria 5394
272 Ga0495667_0010940 3300046559 Bacteria 6131
273 Ga0495667_0080576 3300046559 Bacteria 2116
274 Ga0495667_0134259 3300046559 Bacteria 1596
275 Ga0495668_0192067 3300046616 Bacteria 1118
276 Ga0495634_0003554 3300046642 Bacteria 12476
277 Ga0495634_0005054 3300046642 Bacteria 10185
278 Ga0495634_0046183 3300046642 Bacteria 2940
279 Ga0495634_0186743 3300046642 Bacteria 1295
280 Ga0495625_0008340 3300046660 Bacteria 8845
281 Ga0495625_0080941 3300046660 Bacteria 2261
282 Ga0495625_0125391 3300046660 Bacteria 1744
283 Ga0495625_0161807 3300046660 Bacteria 1499
284 Ga0495635_0008805 3300046663 Bacteria 7047
285 Ga0495635_0011810 3300046663 Bacteria 6123
286 Ga0495635_0050558 3300046663 Bacteria 2865
287 Ga0495635_0068843 3300046663 Bacteria 2427
288 Ga0495661_0021331 3300046665 Bacteria 4224
289 Ga0495588_0001321 3300046674 Bacteria 10580
290 Ga0495588_0025157 3300046674 Bacteria 2964
291 Ga0495588_0050957 3300046674 Bacteria 2131
292 Ga0495657_0004186 3300046675 Bacteria 11551
293 Ga0495657_0007149 3300046675 Bacteria 8659
294 Ga0495657_0010056 3300046675 Bacteria 7132
295 Ga0495657_0023234 3300046675 Bacteria 4431
296 Ga0495657_0025849 3300046675 Bacteria 4165
297 Ga0495599_0005904 3300046678 Bacteria 7358
298 Ga0495623_0032207 3300046679 Bacteria 3370
299 Ga0495646_0001777 3300046680 Bacteria 12956
300 Ga0495646_0004922 3300046680 Bacteria 8434
301 Ga0495646_0035666 3300046680 Bacteria 3085
302 Ga0495658_0001610 3300046683 Bacteria 11760
303 Ga0495613_0000630 3300046689 Bacteria 28033
304 Ga0495613_0008303 3300046689 Bacteria 7709
305 Ga0495613_0022135 3300046689 Bacteria 4736
306 Ga0495613_0037057 3300046689 Bacteria 3616
307 Ga0495613_0051323 3300046689 Bacteria 3039
308 Ga0495613_0059808 3300046689 Bacteria 2791
309 Ga0495613_0061039 3300046689 Bacteria 2761
310 Ga0495624_0007906 3300046690 Bacteria 7462
311 Ga0495624_0092995 3300046690 Bacteria 1859
312 Ga0495624_0111532 3300046690 Bacteria 1681
313 Ga0495624_0170699 3300046690 Bacteria 1327
314 Ga0495671_0027146 3300046692 Bacteria 2959
315 Ga0495649_0076912 3300046694 Bacteria 1786
316 Ga0495649_0087199 3300046694 Bacteria 1665
317 Ga0495589_0007288 3300046794 Bacteria 5793
318 Ga0495589_0011127 3300046794 Bacteria 4669
319 Ga0495589_0020988 3300046794 Bacteria 3337
320 Ga0495589_0034816 3300046794 Bacteria 2526
321 Ga0495589_0035055 3300046794 Bacteria 2517
322 Ga0495589_0040461 3300046794 Bacteria 2327
323 Ga0495589_0086613 3300046794 Bacteria 1521
324 Ga0495589_0151556 3300046794 Bacteria 1107
325 Ga0495600_0004243 3300046809 Bacteria 8562
326 Ga0495600_0023128 3300046809 Bacteria 3997
327 Ga0495600_0059890 3300046809 Bacteria 2486
328 Ga0495600_0301257 3300046809 Bacteria 1011
329 Ga0495660_0054424 3300046810 Bacteria 2168
330 Ga0495581_0000305 3300047315 Bacteria 24028
331 Ga0495581_0056717 3300047315 Bacteria 2261
332 Ga0495581_0076003 3300047315 Bacteria 1943
333 Ga0495604_0001535 3300047317 Bacteria 19018
334 Ga0495604_0004413 3300047317 Bacteria 11135
335 Ga0495604_0177205 3300047317 Bacteria 1493
336 Ga0495636_0005199 3300047318 Bacteria 5104
337 Ga0495636_0013558 3300047318 Bacteria 3234
338 Ga0495636_0015527 3300047318 Bacteria 3035
339 Ga0495636_0145595 3300047318 Bacteria 1060
340 Ga0495674_0017578 3300047319 Bacteria 6657
341 Ga0495674_0017867 3300047319 Bacteria 6604
342 Ga0495674_0142144 3300047319 Bacteria 2017
343 Ga0495672_0043311 3300047320 Bacteria 2707
344 Ga0495676_0001395 3300047321 Bacteria 20787
345 Ga0495676_0001519 3300047321 Bacteria 20084
346 Ga0495676_0001817 3300047321 Bacteria 18689
347 Ga0495676_0002979 3300047321 Bacteria 15311
348 Ga0495676_0005146 3300047321 Bacteria 11976
349 Ga0495676_0012861 3300047321 Bacteria 7525
350 Ga0495676_0028986 3300047321 Bacteria 4718
351 Ga0495676_0087994 3300047321 Bacteria 2331
352 Ga0495680_0004630 3300047322 Bacteria 13105
353 Ga0495680_0018051 3300047322 Bacteria 6003
354 Ga0495683_0016965 3300047323 Bacteria 3777
355 Ga0495683_0152249 3300047323 Bacteria 1075
356 Ga0495687_002506 3300047443 Bacteria 14592
357 Ga0495687_002992 3300047443 Bacteria 12772
358 Ga0495687_085233 3300047443 Bacteria 1225
359 Ga0495675_0004054 3300047444 Bacteria 8874
360 Ga0495675_0020437 3300047444 Bacteria 4210
361 Ga0495675_0021152 3300047444 Bacteria 4141
362 Ga0495675_0083151 3300047444 Bacteria 2015
363 Ga0495679_056717 3300047446 Bacteria 1160
364 Ga0495685_001271 3300047447 Bacteria 7708
365 Ga0495685_002146 3300047447 Bacteria 6127
366 Ga0495685_003661 3300047447 Bacteria 4910
367 Ga0495685_006566 3300047447 Bacteria 3815
368 Ga0495685_015803 3300047447 Bacteria 2577
369 Ga0495685_025479 3300047447 Bacteria 2034
370 Ga0495673_0072456 3300047469 Bacteria 1446
371 Ga0495681_0003085 3300047470 Bacteria 11681
372 Ga0495681_0031329 3300047470 Bacteria 2693
373 Ga0495684_0016816 3300047471 Bacteria 5635
374 Ga0495684_0068724 3300047471 Bacteria 2694
375 Ga0495684_0181775 3300047471 Bacteria 1558
376 Ga0495593_0002438 3300047673 Bacteria 11179
377 Ga0495593_0054248 3300047673 Bacteria 2113
378 Ga0495593_0087270 3300047673 Bacteria 1608
379 Ga0495602_0019844 3300048088 Bacteria 6659
380 Ga0495602_0077346 3300048088 Bacteria 2816
381 Ga0495614_0000131 3300048089 Bacteria 26370
382 Ga0495614_0003163 3300048089 Bacteria 7348
383 Ga0495614_0095803 3300048089 Bacteria 1294
384 Ga0495614_0099073 3300048089 Bacteria 1272
385 Ga0495626_0009599 3300048091 Bacteria 5221
386 Ga0496100_0022230 3300048903 Bacteria 3835
387 Ga0496101_0027285 3300048904 Bacteria 3976
388 Ga0496103_0003463 3300048906 Bacteria 9645
389 Ga0496104_0561930 3300048907 Bacteria 1051
390 Ga0496107_0031411 3300048910 Bacteria 3789
391 Ga0496108_0029839 3300048911 Bacteria 4519
392 Ga0496109_0024924 3300048912 Bacteria 5325
393 Ga0496109_0103971 3300048912 Bacteria 2636
394 Ga0496110_0197445 3300048913 Bacteria 1827
395 Ga0496111_0030194 3300048914 Bacteria 3854
396 Ga0496115_0045230 3300048918 Bacteria 3513
397 Ga0495678_042549 3300049459 Bacteria 1810
398 Ga0495682_0066072 3300049460 Bacteria 1304
399 Ga0501031_0001307 3300049568 Bacteria 15277
400 Ga0501031_0009825 3300049568 Bacteria 6229
401 Ga0501032_0000349 3300049569 Bacteria 38615
402 Ga0501032_0005515 3300049569 Bacteria 9387
403 Ga0501032_0047458 3300049569 Bacteria 2899
404 Ga0501032_0167261 3300049569 Bacteria 1442
405 Ga0501033_0028204 3300049570 Bacteria 4220
406 Ga0501033_0333892 3300049570 Bacteria 1063
407 Ga0501034_0001622 3300049571 Bacteria 29187
408 Ga0501034_0026378 3300049571 Bacteria 5917
409 Ga0501034_0030389 3300049571 Bacteria 5491
410 Ga0501034_0104751 3300049571 Bacteria 2822
411 Ga0501034_0337165 3300049571 Bacteria 1438
412 Ga0501034_0649831 3300049571 Bacteria 956
413 Ga0501036_0001540 3300049572 Bacteria 17817
414 Ga0501036_0003409 3300049572 Bacteria 12699
415 Ga0501036_0004543 3300049572 Bacteria 11203
416 Ga0501036_0071014 3300049572 Bacteria 2944
417 Ga0501036_0351127 3300049572 Bacteria 1231
418 Ga0501037_0001578 3300049573 Bacteria 16612
419 Ga0501037_0217187 3300049573 Bacteria 1346
420 Ga0501038_0001555 3300049574 Bacteria 21204
421 Ga0501038_0003049 3300049574 Bacteria 15614
422 Ga0501038_0027827 3300049574 Bacteria 5023
423 Ga0501038_0035596 3300049574 Bacteria 4370
424 Ga0501038_0101486 3300049574 Bacteria 2395
425 Ga0501039_0017276 3300049575 Bacteria 5535
426 Ga0501039_0040070 3300049575 Bacteria 3616
427 Ga0501039_0047269 3300049575 Bacteria 3326
428 Ga0501039_0071714 3300049575 Bacteria 2691
429 Ga0501039_0108569 3300049575 Bacteria 2169
430 Ga0501041_0001735 3300049577 Bacteria 12246
431 Ga0501042_0022347 3300049578 Bacteria 4419
432 Ga0501043_0001089 3300049579 Bacteria 23889
433 Ga0501043_0003740 3300049579 Bacteria 12505
434 Ga0501043_0246267 3300049579 Bacteria 1377
435 Ga0501046_0026729 3300049580 Bacteria 4713
436 Ga0501046_0294735 3300049580 Bacteria 1186
437 Ga0501047_0000309 3300049581 Bacteria 56264
438 Ga0501047_0010681 3300049581 Bacteria 8676
439 Ga0501047_0017046 3300049581 Bacteria 6946
440 Ga0501047_0082490 3300049581 Bacteria 3090
441 Ga0501047_0124499 3300049581 Bacteria 2458
442 Ga0501048_0004125 3300049582 Bacteria 11075
443 Ga0501067_0002254 3300049583 Bacteria 10636
444 Ga0501068_0003991 3300049584 Bacteria 8031
445 Ga0501069_0005428 3300049585 Bacteria 6628
446 Ga0501069_0131955 3300049585 Bacteria 1431
447 Ga0501070_0013335 3300049586 Bacteria 6931
448 Ga0501070_0103501 3300049586 Bacteria 2355
449 Ga0501070_0128230 3300049586 Bacteria 2096
450 Ga0501070_0149117 3300049586 Bacteria 1930
451 Ga0501071_0032578 3300049587 Bacteria 3701
452 Ga0501072_0000317 3300049588 Bacteria 34327
453 Ga0501073_0015982 3300049589 Bacteria 5439
454 Ga0501074_0003195 3300049590 Bacteria 11555
455 Ga0501074_0007301 3300049590 Bacteria 7990
456 Ga0501076_0075571 3300049592 Bacteria 2701
457 Ga0501077_0013607 3300049593 Bacteria 5101
458 Ga0501079_0006382 3300049741 Bacteria 8853
459 Ga0501080_0061124 3300049742 Bacteria 3507
460 Ga0501083_0003239 3300049744 Bacteria 11358
461 Ga0501035_0000922 3300049822 Bacteria 31150
462 Ga0501035_0004035 3300049822 Bacteria 13982
463 Ga0501035_0019288 3300049822 Bacteria 6276
464 Ga0501035_0069274 3300049822 Bacteria 3127
465 Ga0501035_0153926 3300049822 Bacteria 1993
466 Ga0501035_0180180 3300049822 Bacteria 1820
467 Ga0501035_0250687 3300049822 Bacteria 1503
468 Ga0501044_0006047 3300049823 Bacteria 13359
469 Ga0501044_0009976 3300049823 Bacteria 10317
470 Ga0501044_0019316 3300049823 Bacteria 7292
471 Ga0501044_0159597 3300049823 Bacteria 2233
472 Ga0501044_0163973 3300049823 Bacteria 2197
473 Ga0501044_0168349 3300049823 Bacteria 2164
474 Ga0501045_0068301 3300049824 Bacteria 2611
475 Ga0501045_0241764 3300049824 Bacteria 1344
476 nmdc:mga0yw44_94293_c1 3300050492 Bacteria 1897
477 nmdc:mga06z11_648_c1 3300050494 Bacteria 12669
478 nmdc:mga04h51_88277_c1 3300050495 Bacteria 1112
479 nmdc:mga07m45_38702_c1 3300050496 Bacteria 2662
480 nmdc:mga07m45_88319_c1 3300050496 Bacteria 1774
481 Ga0495601_0003763 3300053077 Bacteria 8730
482 Ga0495612_0008042 3300053078 Bacteria 4293
483 Ga0495595_0207328 3300053084 Bacteria 976
484 Ga0495619_0002040 3300053085 Bacteria 13424
485 Ga0500553_127374 3300053101 Bacteria 1035
486 Ga0500560_000251 3300053107 Bacteria 6613
487 Ga0500572_007783 3300053111 Bacteria 2489
488 Ga0500573_0047361 3300053140 Bacteria 2477
489 Ga0500600_0026502 3300053149 Bacteria 3441
490 Ga0500600_0042859 3300053149 Bacteria 2605
491 Ga0501084_0014370 3300054114 Bacteria 6561
492 Ga0501082_0002650 3300060353 Bacteria 15649
493 Ga0466962_0000218 3300061719 Bacteria 23781
494 Ga0466962_0055925 3300061719 Bacteria 1885
495 Ga0466962_0124577 3300061719 Bacteria 1244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0005562 Ga0495629_0005562_1125_1787 220
2 3300046499 Ga0495594_0000111 Ga0495594_0000111_13430_14092 220
3 3300046674 Ga0495588_0025157 Ga0495588_0025157_222_884 220
4 3300047321 Ga0495676_0001817 Ga0495676_0001817_10407_11069 220
5 3300049571 Ga0501034_0001622 Ga0501034_0001622_6783_7469 228
6 3300049572 Ga0501036_0001540 Ga0501036_0001540_5913_6599 228
7 3300049574 Ga0501038_0101486 Ga0501038_0101486_1087_1773 228
8 3300049575 Ga0501039_0017276 Ga0501039_0017276_4069_4755 228
9 3300049579 Ga0501043_0001089 Ga0501043_0001089_5178_5864 228
10 3300049586 Ga0501070_0013335 Ga0501070_0013335_3559_4245 228
11 3300049590 Ga0501074_0003195 Ga0501074_0003195_715_1401 228
12 3300049822 Ga0501035_0004035 Ga0501035_0004035_10497_11183 228
13 3300046794 Ga0495589_0151556 Ga0495589_0151556_52_777 241
14 3300044658 Ga0466972_0045089 Ga0466972_0045089_286_1017 243
15 3300044765 Ga0466970_0110041 Ga0466970_0110041_321_1052 243
16 3300044901 Ga0466960_0009254 Ga0466960_0009254_3040_3771 243
17 3300046794 Ga0495589_0086613 Ga0495589_0086613_210_1037 243
18 3300047318 Ga0495636_0005199 Ga0495636_0005199_1754_2581 243
19 3300047443 Ga0495687_002506 Ga0495687_002506_1163_1990 243
20 3300047447 Ga0495685_006566 Ga0495685_006566_809_1636 243
21 iso_pu_bacteria 2990088156 2990088433 247
22 3300021388 Ga0213875_10028957 Ga0213875_100289573 249
23 3300037853 Ga0436364_0661135 Ga0436364_0661135_5857_6627 249
24 iso_pu_bacteria 2990044586 2990049423 249
25 3300035083 Ga0373926_0004377 Ga0373926_0004377_1708_2466 250
26 3300035089 Ga0373944_0001963 Ga0373944_0001963_2620_3378 250
27 3300035111 Ga0373923_0000179 Ga0373923_0000179_2684_3442 250
28 3300035113 Ga0373936_0000270 Ga0373936_0000270_11762_12520 250
29 3300035116 Ga0373945_0003964 Ga0373945_0003964_3423_4181 250
30 3300035118 Ga0373954_0002763 Ga0373954_0002763_324_1082 250
31 3300035120 Ga0373957_0005664 Ga0373957_0005664_731_1489 250
32 3300035170 Ga0373943_0002519 Ga0373943_0002519_5621_6379 250
33 3300035171 Ga0373946_0000573 Ga0373946_0000573_6267_7025 250
34 3300035172 Ga0373955_0002817 Ga0373955_0002817_6821_7579 250
35 3300035410 Ga0373924_0000459 Ga0373924_0000459_7084_7842 250
36 3300035695 Ga0373927_0001795 Ga0373927_0001795_11949_12707 250
37 3300035724 Ga0373933_0009548 Ga0373933_0009548_3409_4167 250
38 3300035725 Ga0373947_0002555 Ga0373947_0002555_5066_5824 250
39 3300046454 Ga0495592_0015898 Ga0495592_0015898_1543_2301 250
40 3300046455 Ga0495603_0005308 Ga0495603_0005308_3994_4752 250
41 3300046459 Ga0495629_0011240 Ga0495629_0011240_5480_6238 250
42 3300046459 Ga0495629_0128997 Ga0495629_0128997_921_1682 250
43 3300046461 Ga0495641_0007716 Ga0495641_0007716_4500_5258 250
44 3300046462 Ga0495651_0017761 Ga0495651_0017761_4485_5243 250
45 3300046472 Ga0495580_0007269 Ga0495580_0007269_439_1197 250
46 3300046473 Ga0495582_0009887 Ga0495582_0009887_3192_3950 250
47 3300046475 Ga0495639_0004782 Ga0495639_0004782_3801_4559 250
48 3300046476 Ga0495662_0002329 Ga0495662_0002329_3192_3950 250
49 3300046477 Ga0495664_0003143 Ga0495664_0003143_6419_7177 250
50 3300046511 Ga0495608_0005658 Ga0495608_0005658_7335_8093 250
51 3300046514 Ga0495618_0001158 Ga0495618_0001158_5978_6736 250
52 3300046516 Ga0495628_0091009 Ga0495628_0091009_189_947 250
53 3300046517 Ga0495630_0002481 Ga0495630_0002481_4485_5243 250
54 3300046526 Ga0495666_0001980 Ga0495666_0001980_1690_2448 250
55 3300046529 Ga0495652_0014624 Ga0495652_0014624_6014_6772 250
56 3300046531 Ga0495665_0000949 Ga0495665_0000949_264_1022 250
57 3300046533 Ga0495640_0008552 Ga0495640_0008552_5109_5867 250
58 3300046536 Ga0495587_0012417 Ga0495587_0012417_419_1177 250
59 3300046543 Ga0495645_0023893 Ga0495645_0023893_265_1023 250
60 3300046559 Ga0495667_0010940 Ga0495667_0010940_265_1023 250
61 3300046642 Ga0495634_0005054 Ga0495634_0005054_4628_5386 250
62 3300046663 Ga0495635_0008805 Ga0495635_0008805_1790_2548 250
63 3300046674 Ga0495588_0050957 Ga0495588_0050957_1176_1934 250
64 3300046675 Ga0495657_0023234 Ga0495657_0023234_3409_4167 250
65 3300046678 Ga0495599_0005904 Ga0495599_0005904_3192_3950 250
66 3300046679 Ga0495623_0032207 Ga0495623_0032207_1287_2045 250
67 3300046680 Ga0495646_0004922 Ga0495646_0004922_4485_5243 250
68 3300046683 Ga0495658_0001610 Ga0495658_0001610_365_1123 250
69 3300046690 Ga0495624_0007906 Ga0495624_0007906_1084_1842 250
70 3300046690 Ga0495624_0170699 Ga0495624_0170699_434_1198 250
71 3300046809 Ga0495600_0004243 Ga0495600_0004243_4613_5371 250
72 3300047315 Ga0495581_0000305 Ga0495581_0000305_11558_12316 250
73 3300047317 Ga0495604_0004413 Ga0495604_0004413_7579_8337 250
74 3300047319 Ga0495674_0017578 Ga0495674_0017578_4485_5243 250
75 3300047321 Ga0495676_0005146 Ga0495676_0005146_9301_10059 250
76 3300047322 Ga0495680_0004630 Ga0495680_0004630_5621_6379 250
77 3300047444 Ga0495675_0004054 Ga0495675_0004054_3060_3818 250
78 3300047471 Ga0495684_0016816 Ga0495684_0016816_265_1023 250
79 3300047673 Ga0495593_0002438 Ga0495593_0002438_5313_6071 250
80 3300048088 Ga0495602_0019844 Ga0495602_0019844_617_1375 250
81 3300048089 Ga0495614_0099073 Ga0495614_0099073_452_1210 250
82 3300049569 Ga0501032_0167261 Ga0501032_0167261_549_1403 250
83 3300049570 Ga0501033_0333892 Ga0501033_0333892_112_936 250
84 3300049571 Ga0501034_0337165 Ga0501034_0337165_575_1399 250
85 3300049571 Ga0501034_0649831 Ga0501034_0649831_82_930 250
86 3300049572 Ga0501036_0351127 Ga0501036_0351127_280_1104 250
87 3300049573 Ga0501037_0217187 Ga0501037_0217187_554_1318 250
88 3300049575 Ga0501039_0071714 Ga0501039_0071714_1747_2589 250
89 3300049579 Ga0501043_0246267 Ga0501043_0246267_171_995 250
90 3300049581 Ga0501047_0000309 Ga0501047_0000309_27571_28335 250
91 3300049581 Ga0501047_0124499 Ga0501047_0124499_125_949 250
92 3300049586 Ga0501070_0128230 Ga0501070_0128230_660_1502 250
93 3300049822 Ga0501035_0069274 Ga0501035_0069274_341_1165 250
94 3300049822 Ga0501035_0153926 Ga0501035_0153926_311_1165 250
95 3300049823 Ga0501044_0163973 Ga0501044_0163973_45_899 250
96 3300049823 Ga0501044_0168349 Ga0501044_0168349_759_1523 250
97 3300053077 Ga0495601_0003763 Ga0495601_0003763_4635_5393 250
98 3300053084 Ga0495595_0207328 Ga0495595_0207328_13_771 250
99 3300053085 Ga0495619_0002040 Ga0495619_0002040_9456_10214 250
100 3300053140 Ga0500573_0047361 Ga0500573_0047361_815_1579 250
101 iso_pu_bacteria 2818991472 2819743241 250
102 3300005455 Ga0070663_100464743 Ga0070663_1004647431 251
103 3300005548 Ga0070665_100038014 Ga0070665_1000380143 251
104 3300005563 Ga0068855_100001116 Ga0068855_10000111620 251
105 3300005578 Ga0068854_100024692 Ga0068854_1000246922 251
106 3300005616 Ga0068852_100004978 Ga0068852_1000049788 251
107 3300005834 Ga0068851_10196789 Ga0068851_101967892 251
108 3300009093 Ga0105240_10055853 Ga0105240_100558536 251
109 3300009174 Ga0105241_10000679 Ga0105241_1000067913 251
110 3300009545 Ga0105237_10130765 Ga0105237_101307652 251
111 3300009551 Ga0105238_10010167 Ga0105238_100101672 251
112 3300010375 Ga0105239_10037296 Ga0105239_100372962 251
113 3300021388 Ga0213875_10079620 Ga0213875_100796202 251
114 3300022467 Ga0224712_10040279 Ga0224712_100402791 251
115 3300025321 Ga0207656_10189875 Ga0207656_101898752 251
116 3300025904 Ga0207647_10040323 Ga0207647_100403232 251
117 3300025911 Ga0207654_10006807 Ga0207654_100068076 251
118 3300025913 Ga0207695_10001784 Ga0207695_1000178413 251
119 3300025914 Ga0207671_10000197 Ga0207671_1000019720 251
120 3300025924 Ga0207694_10001211 Ga0207694_100012112 251
121 3300025949 Ga0207667_10013515 Ga0207667_100135158 251
122 3300025981 Ga0207640_10004638 Ga0207640_100046383 251
123 3300026041 Ga0207639_10302198 Ga0207639_103021981 251
124 3300026067 Ga0207678_10032455 Ga0207678_100324556 251
125 3300026142 Ga0207698_10015142 Ga0207698_100151425 251
126 3300028379 Ga0268266_10092995 Ga0268266_100929952 251
127 3300028786 Ga0307517_10075082 Ga0307517_100750823 251
128 3300031090 Ga0265760_10033750 Ga0265760_100337502 251
129 3300031616 Ga0307508_10003596 Ga0307508_100035965 251
130 3300031649 Ga0307514_10038303 Ga0307514_100383033 251
131 3300031730 Ga0307516_10243686 Ga0307516_102436862 251
132 3300044693 Ga0466961_0018271 Ga0466961_0018271_3323_4114 251
133 3300044765 Ga0466970_0255825 Ga0466970_0255825_134_925 251
134 3300046462 Ga0495651_0020069 Ga0495651_0020069_3378_4187 251
135 3300046529 Ga0495652_0019813 Ga0495652_0019813_1707_2516 251
136 3300046557 Ga0495622_0049154 Ga0495622_0049154_1085_1891 251
137 3300046559 Ga0495667_0080576 Ga0495667_0080576_976_1785 251
138 3300046559 Ga0495667_0134259 Ga0495667_0134259_408_1193 251
139 3300046690 Ga0495624_0092995 Ga0495624_0092995_78_887 251
140 3300046809 Ga0495600_0023128 Ga0495600_0023128_1236_2045 251
141 3300047315 Ga0495581_0056717 Ga0495581_0056717_209_1015 251
142 3300049569 Ga0501032_0047458 Ga0501032_0047458_951_1721 251
143 3300049572 Ga0501036_0071014 Ga0501036_0071014_1490_2260 251
144 3300049574 Ga0501038_0035596 Ga0501038_0035596_969_1739 251
145 3300049575 Ga0501039_0047269 Ga0501039_0047269_897_1667 251
146 3300049581 Ga0501047_0082490 Ga0501047_0082490_1973_2743 251
147 3300049822 Ga0501035_0180180 Ga0501035_0180180_911_1681 251
148 3300049824 Ga0501045_0068301 Ga0501045_0068301_709_1479 251
149 iso_pu_bacteria 3006321560 3006322447 251
150 3300005344 Ga0070661_100037388 Ga0070661_1000373884 252
151 3300005468 Ga0070707_100036920 Ga0070707_1000369202 252
152 3300005518 Ga0070699_100008113 Ga0070699_1000081136 252
153 3300005536 Ga0070697_100006229 Ga0070697_1000062296 252
154 3300005618 Ga0068864_100015806 Ga0068864_1000158064 252
155 3300005842 Ga0068858_100154120 Ga0068858_1001541203 252
156 3300006028 Ga0070717_10014967 Ga0070717_100149673 252
157 3300007265 Ga0099794_10086779 Ga0099794_100867792 252
158 3300009011 Ga0105251_10051824 Ga0105251_100518242 252
159 3300009098 Ga0105245_10242747 Ga0105245_102427473 252
160 3300009101 Ga0105247_10017248 Ga0105247_100172484 252
161 3300009174 Ga0105241_10034637 Ga0105241_100346374 252
162 3300009551 Ga0105238_10314370 Ga0105238_103143702 252
163 3300012488 Ga0157343_1000829 Ga0157343_10008292 252
164 3300013100 Ga0157373_10042310 Ga0157373_100423103 252
165 3300013102 Ga0157371_10076264 Ga0157371_100762644 252
166 3300013308 Ga0157375_10102777 Ga0157375_101027772 252
167 3300014325 Ga0163163_10016694 Ga0163163_100166943 252
168 3300014969 Ga0157376_10723962 Ga0157376_107239621 252
169 3300020081 Ga0206354_11636024 Ga0206354_116360245 252
170 3300025885 Ga0207653_10003530 Ga0207653_100035305 252
171 3300025922 Ga0207646_10011452 Ga0207646_1001145210 252
172 3300025929 Ga0207664_10297725 Ga0207664_102977252 252
173 3300026035 Ga0207703_10025726 Ga0207703_100257263 252
174 3300035085 Ga0373929_0002320 Ga0373929_0002320_2270_3037 252
175 3300035090 Ga0373949_0008455 Ga0373949_0008455_1389_2156 252
176 3300035091 Ga0373951_0008897 Ga0373951_0008897_572_1339 252
177 3300035114 Ga0373939_0004427 Ga0373939_0004427_2036_2803 252
178 3300035115 Ga0373941_0002580 Ga0373941_0002580_1059_1826 252
179 3300035119 Ga0373956_0001686 Ga0373956_0001686_1525_2292 252
180 3300035241 Ga0373961_0009815 Ga0373961_0009815_214_981 252
181 3300046514 Ga0495618_0057699 Ga0495618_0057699_1297_2064 252
182 3300046517 Ga0495630_0283644 Ga0495630_0283644_367_1134 252
183 3300046642 Ga0495634_0186743 Ga0495634_0186743_103_870 252
184 3300046663 Ga0495635_0050558 Ga0495635_0050558_1314_2081 252
185 3300047319 Ga0495674_0017867 Ga0495674_0017867_5042_5809 252
186 3300047471 Ga0495684_0181775 Ga0495684_0181775_146_913 252
187 3300048903 Ga0496100_0022230 Ga0496100_0022230_1130_1897 252
188 3300048904 Ga0496101_0027285 Ga0496101_0027285_2058_2825 252
189 3300048906 Ga0496103_0003463 Ga0496103_0003463_640_1407 252
190 3300048907 Ga0496104_0561930 Ga0496104_0561930_13_780 252
191 3300048910 Ga0496107_0031411 Ga0496107_0031411_1109_1876 252
192 3300048912 Ga0496109_0103971 Ga0496109_0103971_1535_2302 252
193 3300048913 Ga0496110_0197445 Ga0496110_0197445_918_1685 252
194 3300048914 Ga0496111_0030194 Ga0496111_0030194_2272_3039 252
195 3300048918 Ga0496115_0045230 Ga0496115_0045230_2089_2856 252
196 3300049568 Ga0501031_0001307 Ga0501031_0001307_2442_3227 252
197 3300049569 Ga0501032_0000349 Ga0501032_0000349_9575_10360 252
198 3300049571 Ga0501034_0030389 Ga0501034_0030389_2442_3227 252
199 3300049572 Ga0501036_0003409 Ga0501036_0003409_2442_3227 252
200 3300049573 Ga0501037_0001578 Ga0501037_0001578_2442_3227 252
201 3300049574 Ga0501038_0001555 Ga0501038_0001555_6274_7059 252
202 3300049575 Ga0501039_0040070 Ga0501039_0040070_1747_2532 252
203 3300049577 Ga0501041_0001735 Ga0501041_0001735_11047_11832 252
204 3300049578 Ga0501042_0022347 Ga0501042_0022347_1560_2345 252
205 3300049579 Ga0501043_0003740 Ga0501043_0003740_2442_3227 252
206 3300049580 Ga0501046_0026729 Ga0501046_0026729_2700_3485 252
207 3300049581 Ga0501047_0010681 Ga0501047_0010681_2442_3227 252
208 3300049582 Ga0501048_0004125 Ga0501048_0004125_3635_4420 252
209 3300049583 Ga0501067_0002254 Ga0501067_0002254_9551_10336 252
210 3300049584 Ga0501068_0003991 Ga0501068_0003991_3635_4420 252
211 3300049585 Ga0501069_0005428 Ga0501069_0005428_3402_4187 252
212 3300049587 Ga0501071_0032578 Ga0501071_0032578_1229_2014 252
213 3300049588 Ga0501072_0000317 Ga0501072_0000317_24119_24904 252
214 3300049589 Ga0501073_0015982 Ga0501073_0015982_2203_2988 252
215 3300049590 Ga0501074_0007301 Ga0501074_0007301_6528_7313 252
216 3300049592 Ga0501076_0075571 Ga0501076_0075571_1319_2104 252
217 3300049593 Ga0501077_0013607 Ga0501077_0013607_3730_4515 252
218 3300049741 Ga0501079_0006382 Ga0501079_0006382_3731_4516 252
219 3300049742 Ga0501080_0061124 Ga0501080_0061124_1510_2295 252
220 3300049744 Ga0501083_0003239 Ga0501083_0003239_8372_9157 252
221 3300049822 Ga0501035_0000922 Ga0501035_0000922_28059_28844 252
222 3300049823 Ga0501044_0006047 Ga0501044_0006047_10133_10918 252
223 3300053078 Ga0495612_0008042 Ga0495612_0008042_1787_2554 252
224 3300054114 Ga0501084_0014370 Ga0501084_0014370_1440_2225 252
225 3300060353 Ga0501082_0002650 Ga0501082_0002650_5830_6615 252
226 iso_pu_bacteria 2862705112 2862705872 252
227 iso_pu_bacteria 8008485437 8008489507 252
228 iso_pu_bacteria 8025524527 8025528917 252
229 iso_pu_bacteria 8056667051 8056672487 252
230 3300046492 Ga0495585_0049464 Ga0495585_0049464_1067_1849 253
231 3300003320 rootH2_10091911 rootH2_100919114 254
232 3300028379 Ga0268266_10077906 Ga0268266_100779063 254
233 3300046454 Ga0495592_0008040 Ga0495592_0008040_6162_6971 254
234 3300046455 Ga0495603_0104367 Ga0495603_0104367_138_947 254
235 3300046459 Ga0495629_0042383 Ga0495629_0042383_1732_2541 254
236 3300046492 Ga0495585_0096131 Ga0495585_0096131_23_832 254
237 3300046511 Ga0495608_0227265 Ga0495608_0227265_214_1023 254
238 3300046516 Ga0495628_0012311 Ga0495628_0012311_2311_3120 254
239 3300046533 Ga0495640_0006036 Ga0495640_0006036_7853_8662 254
240 3300046642 Ga0495634_0046183 Ga0495634_0046183_975_1784 254
241 3300046675 Ga0495657_0004186 Ga0495657_0004186_9850_10659 254
242 3300046689 Ga0495613_0022135 Ga0495613_0022135_1850_2659 254
243 3300047315 Ga0495581_0076003 Ga0495581_0076003_938_1747 254
244 3300047321 Ga0495676_0002979 Ga0495676_0002979_1877_2686 254
245 3300047444 Ga0495675_0083151 Ga0495675_0083151_862_1671 254
246 3300049568 Ga0501031_0009825 Ga0501031_0009825_4566_5345 254
247 3300049823 Ga0501044_0159597 Ga0501044_0159597_933_1712 254
248 iso_pu_bacteria 3006393351 3006399757 254
249 iso_pu_bacteria 8025478263 8025485929 254
250 3300005937 Ga0081455_10002841 Ga0081455_100028414 255
251 iso_pu_bacteria 2547132111 2547409583 255
252 iso_pu_bacteria 2554235005 2554258967 255
253 iso_pu_bacteria 2582581312 2585301073 255
254 iso_pu_bacteria 2582581313 2585306810 255
255 iso_pu_bacteria 2582581314 2585314067 255
256 iso_pu_bacteria 2616644814 2616694295 255
257 iso_pu_bacteria 2643221548 2643759318 255
258 iso_pu_bacteria 2643221578 2643897387 255
259 iso_pu_bacteria 2643221647 2644265534 255
260 iso_pu_bacteria 2643221673 2644408532 255
261 iso_pu_bacteria 2643221677 2644432043 255
262 iso_pu_bacteria 2643221678 2644435793 255
263 iso_pu_bacteria 2643221682 2644463264 255
264 iso_pu_bacteria 2643221714 2644629383 255
265 iso_pu_bacteria 2784132148 2784587392 255
266 iso_pu_bacteria 2784746768 2785367941 255
267 iso_pu_bacteria 2786546132 2786668994 255
268 iso_pu_bacteria 2802429296 2804844407 255
269 iso_pu_bacteria 2808606359 2808840602 255
270 iso_pu_bacteria 2808606448 2809230965 255
271 iso_pu_bacteria 2808606982 2811847614 255
272 iso_pu_bacteria 2811994917 2812481704 255
273 iso_pu_bacteria 2818991463 2819694104 255
274 iso_pu_bacteria 2852635781 2852638437 255
275 iso_pu_bacteria 2862178590 2862182938 255
276 iso_pu_bacteria 2862281513 2862288675 255
277 iso_pu_bacteria 2862290372 2862292506 255
278 iso_pu_bacteria 2862574272 2862582928 255
279 iso_pu_bacteria 2867428634 2867432621 255
280 iso_pu_bacteria 2873151551 2873157012 255
281 iso_pu_bacteria 2875391855 2875393330 255
282 iso_pu_bacteria 2877676314 2877682604 255
283 iso_pu_bacteria 2912757875 2912759520 255
284 iso_pu_bacteria 2918501144 2918503202 255
285 iso_pu_bacteria 2919468124 2919468153 255
286 iso_pu_bacteria 2946045630 2946051361 255
287 iso_pu_bacteria 2946064051 2946066329 255
288 iso_pu_bacteria 2946072368 2946074597 255
289 iso_pu_bacteria 2947224130 2947231049 255
290 iso_pu_bacteria 2954380949 2954387801 255
291 iso_pu_bacteria 2954673503 2954675276 255
292 iso_pu_bacteria 2954682443 2954688857 255
293 iso_pu_bacteria 2954691527 2954698613 255
294 iso_pu_bacteria 2954701450 2954703612 255
295 iso_pu_bacteria 2954711539 2954717585 255
296 iso_pu_bacteria 2954721474 2954727550 255
297 iso_pu_bacteria 2954731030 2954734251 255
298 iso_pu_bacteria 2954740390 2954746445 255
299 iso_pu_bacteria 2954749733 2954753135 255
300 iso_pu_bacteria 2954759201 2954765560 255
301 iso_pu_bacteria 2966598605 2966603730 255
302 iso_pu_bacteria 2990059506 2990063909 255
303 iso_pu_bacteria 3006425503 3006426600 255
304 iso_pu_bacteria 3006486233 3006493152 255
305 iso_pu_bacteria 3006493962 3006495554 255
306 iso_pu_bacteria 8008558824 8008562111 255
307 iso_pu_bacteria 8023623736 8023627497 255
308 iso_pu_bacteria 8025413630 8025414048 255
309 iso_pu_bacteria 8025530807 8025534760 255
310 iso_pu_bacteria 8054160619 8054163678 255
311 iso_pu_bacteria 2808606375 2808919182 256
312 iso_pu_bacteria 2954002825 2954004353 256
313 3300049569 Ga0501032_0005515 Ga0501032_0005515_2084_2971 257
314 3300049571 Ga0501034_0104751 Ga0501034_0104751_986_1873 257
315 3300049574 Ga0501038_0027827 Ga0501038_0027827_3186_4073 257
316 3300049575 Ga0501039_0108569 Ga0501039_0108569_1113_2000 257
317 3300049581 Ga0501047_0017046 Ga0501047_0017046_3637_4524 257
318 3300049822 Ga0501035_0019288 Ga0501035_0019288_1324_2211 257
319 3300049823 Ga0501044_0009976 Ga0501044_0009976_8445_9332 257
320 3300049824 Ga0501045_0241764 Ga0501045_0241764_46_933 257
321 3300001989 JGI24739J22299_10023255 JGI24739J22299_100232552 259
322 3300001990 JGI24737J22298_10004279 JGI24737J22298_100042795 259
323 3300003316 rootH1_10010278 rootH1_100102782 259
324 3300003316 rootH1_10031271 rootH1_100312714 259
325 3300003320 rootH2_10027403 rootH2_1002740316 259
326 3300003320 rootH2_10158663 rootH2_101586632 259
327 3300003322 rootL2_10024691 rootL2_100246913 259
328 3300003322 rootL2_10066964 rootL2_100669642 259
329 3300003323 rootH1_10034984 rootH1_100349842 259
330 3300003323 rootH1_10360870 rootH1_103608701 259
331 3300003578 Ga0006562J51391_1102959 Ga0006562J51391_11029596 259
332 3300003578 Ga0006562J51391_1102960 Ga0006562J51391_11029602 259
333 3300005471 Ga0070698_100248118 Ga0070698_1002481181 259
334 3300005539 Ga0068853_100053625 Ga0068853_1000536254 259
335 3300005548 Ga0070665_100154827 Ga0070665_1001548272 259
336 3300005937 Ga0081455_10036518 Ga0081455_100365184 259
337 3300006038 Ga0075365_10105081 Ga0075365_101050812 259
338 3300006042 Ga0075368_10006078 Ga0075368_100060783 259
339 3300006048 Ga0075363_100002201 Ga0075363_1000022012 259
340 3300006178 Ga0075367_10029300 Ga0075367_100293003 259
341 3300006948 Ga0099826_10034755 Ga0099826_100347554 259
342 3300009036 Ga0105244_10073308 Ga0105244_100733082 259
343 3300009148 Ga0105243_10340006 Ga0105243_103400062 259
344 3300009551 Ga0105238_10215251 Ga0105238_102152512 259
345 3300011119 Ga0105246_10002113 Ga0105246_100021139 259
346 3300013105 Ga0157369_10071398 Ga0157369_100713984 259
347 3300013307 Ga0157372_10151979 Ga0157372_101519794 259
348 3300014497 Ga0182008_10000486 Ga0182008_1000048617 259
349 3300015262 Ga0182007_10000417 Ga0182007_100004178 259
350 3300015265 Ga0182005_1017455 Ga0182005_10174552 259
351 3300015688 Ga0183367_1007 Ga0183367_1007434 259
352 3300025297 Ga0209758_1001981 Ga0209758_100198119 259
353 3300025302 Ga0207426_1026436 Ga0207426_10264361 259
354 3300025302 Ga0207426_1038319 Ga0207426_10383191 259
355 3300025904 Ga0207647_10008916 Ga0207647_100089165 259
356 3300025949 Ga0207667_10459336 Ga0207667_104593362 259
357 3300027666 Ga0209282_1093592 Ga0209282_10935922 259
358 3300027866 Ga0209813_10003206 Ga0209813_100032062 259
359 3300028786 Ga0307517_10018082 Ga0307517_100180826 259
360 3300028794 Ga0307515_10007501 Ga0307515_1000750115 259
361 3300028794 Ga0307515_10084333 Ga0307515_100843332 259
362 3300028794 Ga0307515_10179707 Ga0307515_101797072 259
363 3300030500 Ga0268256_1010041 Ga0268256_10100412 259
364 3300030522 Ga0307512_10000928 Ga0307512_1000092825 259
365 3300030522 Ga0307512_10023281 Ga0307512_100232812 259
366 3300031456 Ga0307513_10047966 Ga0307513_100479665 259
367 3300031616 Ga0307508_10005083 Ga0307508_100050838 259
368 3300031616 Ga0307508_10167308 Ga0307508_101673082 259
369 3300031649 Ga0307514_10025550 Ga0307514_100255503 259
370 3300031649 Ga0307514_10055105 Ga0307514_100551052 259
371 3300031649 Ga0307514_10076253 Ga0307514_100762533 259
372 3300031730 Ga0307516_10001107 Ga0307516_1000110714 259
373 3300031730 Ga0307516_10039828 Ga0307516_100398283 259
374 3300031852 Ga0307410_10193601 Ga0307410_101936012 259
375 3300032002 Ga0307416_100160649 Ga0307416_1001606492 259
376 3300033179 Ga0307507_10044230 Ga0307507_100442303 259
377 3300033180 Ga0307510_10065591 Ga0307510_100655912 259
378 3300037466 Ga0395898_0097281 Ga0395898_0097281_1968_2780 259
379 3300041406 Ga0439439_0010508 Ga0439439_0010508_665_1462 259
380 3300041451 Ga0451791_0640598 Ga0451791_0640598_390_1226 259
381 3300041494 Ga0451837_1241739 Ga0451837_1241739_705_1514 259
382 3300041512 Ga0451853_0711683 Ga0451853_0711683_726_1505 259
383 3300041512 Ga0451853_1228683 Ga0451853_1228683_2552_3340 259
384 3300041999 Ga0439433_0011669 Ga0439433_0011669_393_1190 259
385 3300042002 Ga0439442_011382 Ga0439442_011382_980_1777 259
386 3300042005 Ga0439448_0025107 Ga0439448_0025107_285_1067 259
387 3300042007 Ga0439449_0001336 Ga0439449_0001336_7660_8439 259
388 3300042012 Ga0439455_0000063 Ga0439455_0000063_4915_5694 259
389 3300042014 Ga0439457_004235 Ga0439457_004235_2878_3675 259
390 3300042015 Ga0439462_0009074 Ga0439462_0009074_1013_1810 259
391 3300042138 Ga0450903_000152 Ga0450903_000152_3994_4773 259
392 3300042157 Ga0439458_0004411 Ga0439458_0004411_862_1641 259
393 3300044658 Ga0466972_0026645 Ga0466972_0026645_447_1298 259
394 3300044683 Ga0466965_0004218 Ga0466965_0004218_2866_3717 259
395 3300044683 Ga0466965_0075640 Ga0466965_0075640_37_870 259
396 3300044684 Ga0466966_0008759 Ga0466966_0008759_3728_4579 259
397 3300044684 Ga0466966_0023227 Ga0466966_0023227_1716_2549 259
398 3300044693 Ga0466961_0008025 Ga0466961_0008025_2149_3000 259
399 3300044693 Ga0466961_0014821 Ga0466961_0014821_3671_4504 259
400 3300044694 Ga0466963_0050128 Ga0466963_0050128_872_1723 259
401 3300044719 Ga0466971_0000796 Ga0466971_0000796_8648_9499 259
402 3300044719 Ga0466971_0046873 Ga0466971_0046873_683_1516 259
403 3300044765 Ga0466970_0001789 Ga0466970_0001789_855_1706 259
404 3300044765 Ga0466970_0050535 Ga0466970_0050535_747_1547 259
405 3300044842 Ga0466957_0003220 Ga0466957_0003220_262_1113 259
406 3300045049 Ga0466959_0000221 Ga0466959_0000221_31921_32772 259
407 3300045836 Ga0466958_0003039 Ga0466958_0003039_1173_2024 259
408 3300045976 Ga0466967_0019734 Ga0466967_0019734_455_1237 259
409 3300045976 Ga0466967_0060452 Ga0466967_0060452_2245_3096 259
410 3300046452 Ga0495617_007479 Ga0495617_007479_2201_3028 259
411 3300046453 Ga0495627_031960 Ga0495627_031960_278_1087 259
412 3300046455 Ga0495603_0001034 Ga0495603_0001034_10839_11618 259
413 3300046455 Ga0495603_0007257 Ga0495603_0007257_3493_4302 259
414 3300046455 Ga0495603_0022146 Ga0495603_0022146_2785_3612 259
415 3300046455 Ga0495603_0059891 Ga0495603_0059891_590_1399 259
416 3300046457 Ga0495590_0021229 Ga0495590_0021229_1014_1841 259
417 3300046459 Ga0495629_0009064 Ga0495629_0009064_2721_3500 259
418 3300046459 Ga0495629_0040064 Ga0495629_0040064_1856_2665 259
419 3300046459 Ga0495629_0066017 Ga0495629_0066017_417_1226 259
420 3300046459 Ga0495629_0187888 Ga0495629_0187888_76_906 259
421 3300046460 Ga0495638_0034171 Ga0495638_0034171_1072_1851 259
422 3300046460 Ga0495638_0079725 Ga0495638_0079725_179_1006 259
423 3300046460 Ga0495638_0197834 Ga0495638_0197834_188_1018 259
424 3300046462 Ga0495651_0001608 Ga0495651_0001608_2502_3332 259
425 3300046462 Ga0495651_0008217 Ga0495651_0008217_6033_6863 259
426 3300046463 Ga0495653_0146951 Ga0495653_0146951_563_1507 259
427 3300046463 Ga0495653_0241614 Ga0495653_0241614_211_1041 259
428 3300046473 Ga0495582_0019588 Ga0495582_0019588_558_1388 259
429 3300046473 Ga0495582_0027672 Ga0495582_0027672_652_1461 259
430 3300046476 Ga0495662_0002671 Ga0495662_0002671_606_1436 259
431 3300046476 Ga0495662_0117874 Ga0495662_0117874_424_1233 259
432 3300046477 Ga0495664_0014549 Ga0495664_0014549_1259_2089 259
433 3300046477 Ga0495664_0082658 Ga0495664_0082658_501_1445 259
434 3300046491 Ga0495584_0226430 Ga0495584_0226430_64_891 259
435 3300046492 Ga0495585_0008157 Ga0495585_0008157_5000_5797 259
436 3300046492 Ga0495585_0050229 Ga0495585_0050229_13_792 259
437 3300046492 Ga0495585_0059066 Ga0495585_0059066_570_1397 259
438 3300046499 Ga0495594_0058695 Ga0495594_0058695_391_1218 259
439 3300046500 Ga0495596_0054631 Ga0495596_0054631_275_1102 259
440 3300046501 Ga0495607_0012279 Ga0495607_0012279_2506_3333 259
441 3300046506 Ga0495583_0036426 Ga0495583_0036426_1309_2136 259
442 3300046506 Ga0495583_0099637 Ga0495583_0099637_236_1063 259
443 3300046507 Ga0495606_0006317 Ga0495606_0006317_8927_9754 259
444 3300046511 Ga0495608_0065965 Ga0495608_0065965_367_1197 259
445 3300046513 Ga0495616_0001639 Ga0495616_0001639_4668_5495 259
446 3300046514 Ga0495618_0090649 Ga0495618_0090649_827_1657 259
447 3300046515 Ga0495620_0005733 Ga0495620_0005733_2239_3066 259
448 3300046515 Ga0495620_0010234 Ga0495620_0010234_2828_3655 259
449 3300046515 Ga0495620_0084724 Ga0495620_0084724_59_838 259
450 3300046516 Ga0495628_0038682 Ga0495628_0038682_1047_1877 259
451 3300046516 Ga0495628_0101392 Ga0495628_0101392_1321_2130 259
452 3300046518 Ga0495631_0005423 Ga0495631_0005423_5438_6265 259
453 3300046519 Ga0495632_0020295 Ga0495632_0020295_1142_1969 259
454 3300046522 Ga0495643_0014682 Ga0495643_0014682_1109_1936 259
455 3300046524 Ga0495648_0121731 Ga0495648_0121731_365_1192 259
456 3300046526 Ga0495666_0006627 Ga0495666_0006627_3700_4527 259
457 3300046528 Ga0495642_0065028 Ga0495642_0065028_403_1230 259
458 3300046529 Ga0495652_0031081 Ga0495652_0031081_216_1046 259
459 3300046529 Ga0495652_0033521 Ga0495652_0033521_2895_3725 259
460 3300046530 Ga0495654_0031996 Ga0495654_0031996_1659_2486 259
461 3300046533 Ga0495640_0020160 Ga0495640_0020160_2334_3143 259
462 3300046535 Ga0495586_0005898 Ga0495586_0005898_4440_5270 259
463 3300046536 Ga0495587_0003176 Ga0495587_0003176_9712_10542 259
464 3300046536 Ga0495587_0064828 Ga0495587_0064828_134_946 259
465 3300046538 Ga0495609_0053769 Ga0495609_0053769_572_1399 259
466 3300046542 Ga0495597_0038913 Ga0495597_0038913_275_1102 259
467 3300046543 Ga0495645_0005997 Ga0495645_0005997_6973_7803 259
468 3300046557 Ga0495622_0022481 Ga0495622_0022481_1781_2608 259
469 3300046557 Ga0495622_0072929 Ga0495622_0072929_765_1544 259
470 3300046558 Ga0495633_0009428 Ga0495633_0009428_389_1216 259
471 3300046616 Ga0495668_0192067 Ga0495668_0192067_206_1003 259
472 3300046642 Ga0495634_0003554 Ga0495634_0003554_6841_7671 259
473 3300046660 Ga0495625_0008340 Ga0495625_0008340_6743_7573 259
474 3300046660 Ga0495625_0080941 Ga0495625_0080941_981_1760 259
475 3300046660 Ga0495625_0125391 Ga0495625_0125391_759_1586 259
476 3300046660 Ga0495625_0161807 Ga0495625_0161807_358_1137 259
477 3300046663 Ga0495635_0011810 Ga0495635_0011810_710_1540 259
478 3300046663 Ga0495635_0068843 Ga0495635_0068843_496_1305 259
479 3300046665 Ga0495661_0021331 Ga0495661_0021331_184_1011 259
480 3300046674 Ga0495588_0001321 Ga0495588_0001321_3288_4097 259
481 3300046675 Ga0495657_0007149 Ga0495657_0007149_4718_5548 259
482 3300046675 Ga0495657_0010056 Ga0495657_0010056_1617_2426 259
483 3300046675 Ga0495657_0025849 Ga0495657_0025849_2699_3508 259
484 3300046680 Ga0495646_0001777 Ga0495646_0001777_2642_3472 259
485 3300046680 Ga0495646_0035666 Ga0495646_0035666_345_1175 259
486 3300046689 Ga0495613_0000630 Ga0495613_0000630_11656_12435 259
487 3300046689 Ga0495613_0008303 Ga0495613_0008303_4364_5194 259
488 3300046689 Ga0495613_0037057 Ga0495613_0037057_89_898 259
489 3300046689 Ga0495613_0051323 Ga0495613_0051323_646_1473 259
490 3300046689 Ga0495613_0059808 Ga0495613_0059808_1321_2130 259
491 3300046689 Ga0495613_0061039 Ga0495613_0061039_1921_2751 259
492 3300046690 Ga0495624_0111532 Ga0495624_0111532_223_1035 259
493 3300046692 Ga0495671_0027146 Ga0495671_0027146_309_1139 259
494 3300046694 Ga0495649_0076912 Ga0495649_0076912_536_1363 259
495 3300046694 Ga0495649_0087199 Ga0495649_0087199_634_1461 259
496 3300046794 Ga0495589_0007288 Ga0495589_0007288_734_1513 259
497 3300046794 Ga0495589_0011127 Ga0495589_0011127_1645_2424 259
498 3300046794 Ga0495589_0020988 Ga0495589_0020988_309_1136 259
499 3300046794 Ga0495589_0034816 Ga0495589_0034816_1121_1930 259
500 3300046794 Ga0495589_0035055 Ga0495589_0035055_155_1027 259
501 3300046794 Ga0495589_0040461 Ga0495589_0040461_726_1553 259
502 3300046809 Ga0495600_0059890 Ga0495600_0059890_188_1018 259
503 3300046809 Ga0495600_0301257 Ga0495600_0301257_58_867 259
504 3300046810 Ga0495660_0054424 Ga0495660_0054424_149_976 259
505 3300047317 Ga0495604_0001535 Ga0495604_0001535_7572_8402 259
506 3300047317 Ga0495604_0177205 Ga0495604_0177205_600_1409 259
507 3300047318 Ga0495636_0013558 Ga0495636_0013558_928_1737 259
508 3300047318 Ga0495636_0015527 Ga0495636_0015527_1818_2645 259
509 3300047318 Ga0495636_0145595 Ga0495636_0145595_195_974 259
510 3300047319 Ga0495674_0142144 Ga0495674_0142144_590_1420 259
511 3300047320 Ga0495672_0043311 Ga0495672_0043311_1509_2336 259
512 3300047321 Ga0495676_0001395 Ga0495676_0001395_12876_13655 259
513 3300047321 Ga0495676_0001519 Ga0495676_0001519_8988_9818 259
514 3300047321 Ga0495676_0012861 Ga0495676_0012861_5003_5782 259
515 3300047321 Ga0495676_0028986 Ga0495676_0028986_2868_3665 259
516 3300047321 Ga0495676_0087994 Ga0495676_0087994_723_1535 259
517 3300047322 Ga0495680_0018051 Ga0495680_0018051_1054_1884 259
518 3300047323 Ga0495683_0016965 Ga0495683_0016965_369_1148 259
519 3300047323 Ga0495683_0152249 Ga0495683_0152249_38_865 259
520 3300047443 Ga0495687_002992 Ga0495687_002992_4355_5185 259
521 3300047443 Ga0495687_085233 Ga0495687_085233_247_1074 259
522 3300047444 Ga0495675_0020437 Ga0495675_0020437_1770_2579 259
523 3300047444 Ga0495675_0021152 Ga0495675_0021152_743_1573 259
524 3300047446 Ga0495679_056717 Ga0495679_056717_66_893 259
525 3300047447 Ga0495685_001271 Ga0495685_001271_6475_7347 259
526 3300047447 Ga0495685_002146 Ga0495685_002146_165_944 259
527 3300047447 Ga0495685_003661 Ga0495685_003661_2935_3714 259
528 3300047447 Ga0495685_015803 Ga0495685_015803_1152_1949 259
529 3300047447 Ga0495685_025479 Ga0495685_025479_635_1462 259
530 3300047469 Ga0495673_0072456 Ga0495673_0072456_200_1027 259
531 3300047470 Ga0495681_0003085 Ga0495681_0003085_4243_5073 259
532 3300047470 Ga0495681_0031329 Ga0495681_0031329_884_1711 259
533 3300047471 Ga0495684_0068724 Ga0495684_0068724_1764_2594 259
534 3300047673 Ga0495593_0054248 Ga0495593_0054248_754_1584 259
535 3300047673 Ga0495593_0087270 Ga0495593_0087270_551_1360 259
536 3300048088 Ga0495602_0077346 Ga0495602_0077346_260_1090 259
537 3300048089 Ga0495614_0000131 Ga0495614_0000131_8029_8808 259
538 3300048089 Ga0495614_0003163 Ga0495614_0003163_5803_6633 259
539 3300048089 Ga0495614_0095803 Ga0495614_0095803_101_880 259
540 3300048091 Ga0495626_0009599 Ga0495626_0009599_3928_4755 259
541 3300048911 Ga0496108_0029839 Ga0496108_0029839_3592_4401 259
542 3300048912 Ga0496109_0024924 Ga0496109_0024924_212_1021 259
543 3300049459 Ga0495678_042549 Ga0495678_042549_937_1764 259
544 3300049460 Ga0495682_0066072 Ga0495682_0066072_197_1024 259
545 3300049570 Ga0501033_0028204 Ga0501033_0028204_2963_3769 259
546 3300049571 Ga0501034_0026378 Ga0501034_0026378_1910_2689 259
547 3300049572 Ga0501036_0004543 Ga0501036_0004543_2206_2985 259
548 3300049574 Ga0501038_0003049 Ga0501038_0003049_2230_3027 259
549 3300049580 Ga0501046_0294735 Ga0501046_0294735_235_1014 259
550 3300049585 Ga0501069_0131955 Ga0501069_0131955_130_909 259
551 3300049586 Ga0501070_0103501 Ga0501070_0103501_1417_2196 259
552 3300049586 Ga0501070_0149117 Ga0501070_0149117_1056_1856 259
553 3300049822 Ga0501035_0250687 Ga0501035_0250687_587_1429 259
554 3300049823 Ga0501044_0019316 Ga0501044_0019316_1782_2561 259
555 3300050492 nmdc:mga0yw44_94293_c1 nmdc:mga0yw44_94293_c1_942_1805 259
556 3300050494 nmdc:mga06z11_648_c1 nmdc:mga06z11_648_c1_6933_7715 259
557 3300050495 nmdc:mga04h51_88277_c1 nmdc:mga04h51_88277_c1_162_944 259
558 3300050496 nmdc:mga07m45_38702_c1 nmdc:mga07m45_38702_c1_332_1132 259
559 3300050496 nmdc:mga07m45_88319_c1 nmdc:mga07m45_88319_c1_362_1141 259
560 3300053101 Ga0500553_127374 Ga0500553_127374_17_847 259
561 3300053107 Ga0500560_000251 Ga0500560_000251_373_1203 259
562 3300053111 Ga0500572_007783 Ga0500572_007783_17_847 259
563 3300053149 Ga0500600_0026502 Ga0500600_0026502_190_1017 259
564 3300053149 Ga0500600_0042859 Ga0500600_0042859_556_1335 259
565 3300061719 Ga0466962_0000218 Ga0466962_0000218_9021_9872 259
566 3300061719 Ga0466962_0055925 Ga0466962_0055925_601_1434 259
567 3300061719 Ga0466962_0124577 Ga0466962_0124577_284_1066 259
568 iso_pu_bacteria 2935390628 2935395929 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

156

234

0.91

PF12146

Hydrolase_4

Serine aminopeptidase, S33

16

156

0.88

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

18

142

0.83

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

19

241

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ke6-assembly3.cif.gz_C crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.9576 2 245
4ke6-assembly5.cif.gz_E crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.9576 2 245
4fbl-assembly1.cif.gz_A lips and lipt, two metagenome-derived lipolytic enzymes increase the diversity of known lipase and esterase families 0.9575 2 243
4kea-assembly6.cif.gz_F crystal structure of d196n mutant of monoglyceride lipase from bacillus sp. h257 in space group p212121 0.9563 2 245
4ke6-assembly2.cif.gz_B crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.9561 2 245
ID Description Score Start End Superfamily
4ke6E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9576 2 245 3.40.50.1820
5xksF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9474 2 246 3.40.50.1820
4ke6E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9452 2 245 3.40.50.1820
5xksF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9148 2 246 3.40.50.1820
3hjuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8783 9 247 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5P8K0I6-F1-model_v4 Alpha/beta fold hydrolase 0.9778 1 248 GO:0052689
AF-A0A7Y5XJT9-F1-model_v4 deleted 0.977 1 217
AF-A0A7Y0CTT1-F1-model_v4 Alpha/beta fold hydrolase 0.9769 1 245 GO:0052689
AF-A0A1V2P1G8-F1-model_v4 Esterase 0.9753 1 244 GO:0052689
AF-A0A4D4MN19-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9752 1 188 GO:0016020
GO:0052689

Feature Viewer

pLDDT pTM Quality
86.42 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map