F464663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 568 | 306 | 546 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0040734|Ga0466958_0040734_105_1181 |
| Length | 358 |
| Sequence | MSAGKSAECAIRAPEGTGRGSPDSLSSMFYDDDADLGKLDGKTVAIIGYGSQGHAHALNLKDSGVEVVVGLRADSRSVDKAQAHGLRVLEPADAASLGDVVMMLVPDELHRQVWESGVQDGVAPGNLLMFGHGFSIHYGEIVPPPEVDVALVAPKGPGHLVRRQYLEGSGVPGLVAVEQDASGDALQIALAYAKGIGCTRGGVIETTFKDETETDLFGEQAVLCGGVTELVRAGYETLTDAGYDPRLAYFECLHELKLIVDLMYEKGISGMRYSISNTAEYGDMTRGKRIISDATRQAMKEILGEIQSGAFAREWIAENRAGQESFKRMREEQAGHRVELVGQELRAQMDWIDTEFAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 2 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 3 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 4 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 5 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 6 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 7 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 8 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 9 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 10 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 11 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 12 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 13 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 14 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 15 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 16 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 17 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 18 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 134 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 220 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 226 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 227 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 300 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 303 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 304 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 305 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 306 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.95 |
| Metatranscriptomes | 0.18 |
| Isolates | 3.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.23 |
| Nodule | 0 |
| Rhizoplane | 7.22 |
| Rhizosphere | 85.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1006202 | 3300002076 | Bacteria | 1666 |
| 2 | JGI24751J29686_10000033 | 3300002459 | Bacteria | 87652 |
| 3 | Ga0065704_10096006 | 3300005289 | Bacteria | 2462 |
| 4 | Ga0065712_10002607 | 3300005290 | Bacteria | 7546 |
| 5 | Ga0065712_10085068 | 3300005290 | Bacteria | 2690 |
| 6 | Ga0065715_10003712 | 3300005293 | Bacteria | 4074 |
| 7 | Ga0065715_10032464 | 3300005293 | Bacteria | 1325 |
| 8 | Ga0065715_10172168 | 3300005293 | Bacteria | 1527 |
| 9 | Ga0065707_10131316 | 3300005295 | Bacteria | 1915 |
| 10 | Ga0070658_10021878 | 3300005327 | Bacteria | 5127 |
| 11 | Ga0070676_10130014 | 3300005328 | Bacteria | 1591 |
| 12 | Ga0070683_100026787 | 3300005329 | Bacteria | 5194 |
| 13 | Ga0070683_100030796 | 3300005329 | Bacteria | 4875 |
| 14 | Ga0070683_100092939 | 3300005329 | Bacteria | 2833 |
| 15 | Ga0070690_100020310 | 3300005330 | Bacteria | 4046 |
| 16 | Ga0070690_100066873 | 3300005330 | Bacteria | 2327 |
| 17 | Ga0070690_100121709 | 3300005330 | Bacteria | 1752 |
| 18 | Ga0070670_100000142 | 3300005331 | Bacteria | 67444 |
| 19 | Ga0070670_100055127 | 3300005331 | Bacteria | 3412 |
| 20 | Ga0070670_100120384 | 3300005331 | Bacteria | 2264 |
| 21 | Ga0070670_100306795 | 3300005331 | Bacteria | 1389 |
| 22 | Ga0068869_100005669 | 3300005334 | Bacteria | 7872 |
| 23 | Ga0068869_100009452 | 3300005334 | Bacteria | 6327 |
| 24 | Ga0068869_100045955 | 3300005334 | Bacteria | 3146 |
| 25 | Ga0068869_100176394 | 3300005334 | Bacteria | 1673 |
| 26 | Ga0070666_10024439 | 3300005335 | Bacteria | 3936 |
| 27 | Ga0070666_10032680 | 3300005335 | Bacteria | 3438 |
| 28 | Ga0070680_100002408 | 3300005336 | Bacteria | 13849 |
| 29 | Ga0070680_100011371 | 3300005336 | Bacteria | 6884 |
| 30 | Ga0070680_100088572 | 3300005336 | Bacteria | 2560 |
| 31 | Ga0070682_100009728 | 3300005337 | Bacteria | 5444 |
| 32 | Ga0070682_100046342 | 3300005337 | Bacteria | 2697 |
| 33 | Ga0068868_100020616 | 3300005338 | Bacteria | 4956 |
| 34 | Ga0070660_100023500 | 3300005339 | Bacteria | 4566 |
| 35 | Ga0070660_100103814 | 3300005339 | Bacteria | 2254 |
| 36 | Ga0070660_100173681 | 3300005339 | Bacteria | 1741 |
| 37 | Ga0070689_100086927 | 3300005340 | Bacteria | 2459 |
| 38 | Ga0070689_100380039 | 3300005340 | Bacteria | 1190 |
| 39 | Ga0070687_100040085 | 3300005343 | Bacteria | 2358 |
| 40 | Ga0070692_10012645 | 3300005345 | Bacteria | 3915 |
| 41 | Ga0070668_100061633 | 3300005347 | Bacteria | 2906 |
| 42 | Ga0070669_100001613 | 3300005353 | Bacteria | 16302 |
| 43 | Ga0070675_100043116 | 3300005354 | Bacteria | 3686 |
| 44 | Ga0070671_100001580 | 3300005355 | Bacteria | 17138 |
| 45 | Ga0070671_100001660 | 3300005355 | Bacteria | 16835 |
| 46 | Ga0070671_100035874 | 3300005355 | Bacteria | 4110 |
| 47 | Ga0070671_100078675 | 3300005355 | Bacteria | 2756 |
| 48 | Ga0070674_100004685 | 3300005356 | Bacteria | 7819 |
| 49 | Ga0070673_100038097 | 3300005364 | Bacteria | 3669 |
| 50 | Ga0070673_100151694 | 3300005364 | Bacteria | 1963 |
| 51 | Ga0070673_100161745 | 3300005364 | Bacteria | 1905 |
| 52 | Ga0070688_100007597 | 3300005365 | Bacteria | 5852 |
| 53 | Ga0070659_100002129 | 3300005366 | Bacteria | 14109 |
| 54 | Ga0070659_100024585 | 3300005366 | Bacteria | 4618 |
| 55 | Ga0070659_100121512 | 3300005366 | Bacteria | 2116 |
| 56 | Ga0070667_100082972 | 3300005367 | Bacteria | 2745 |
| 57 | Ga0070667_100233619 | 3300005367 | Bacteria | 1640 |
| 58 | Ga0070709_10090090 | 3300005434 | Bacteria | 2021 |
| 59 | Ga0070710_10002233 | 3300005437 | Bacteria | 9158 |
| 60 | Ga0070710_10124254 | 3300005437 | Bacteria | 1566 |
| 61 | Ga0070701_10007401 | 3300005438 | Bacteria | 4689 |
| 62 | Ga0070701_10101209 | 3300005438 | Bacteria | 1596 |
| 63 | Ga0070711_100051072 | 3300005439 | Bacteria | 2838 |
| 64 | Ga0070705_100116898 | 3300005440 | Bacteria | 1715 |
| 65 | Ga0070700_100004002 | 3300005441 | Bacteria | 7662 |
| 66 | Ga0070700_100028151 | 3300005441 | Bacteria | 3340 |
| 67 | Ga0070700_100042291 | 3300005441 | Bacteria | 2797 |
| 68 | Ga0070694_100014238 | 3300005444 | Bacteria | 4978 |
| 69 | Ga0070678_100013797 | 3300005456 | Bacteria | 5076 |
| 70 | Ga0070662_100075229 | 3300005457 | Bacteria | 2500 |
| 71 | Ga0070681_10000100 | 3300005458 | Bacteria | 63828 |
| 72 | Ga0070681_10009949 | 3300005458 | Bacteria | 9373 |
| 73 | Ga0070681_10082520 | 3300005458 | Bacteria | 3170 |
| 74 | Ga0068867_100024849 | 3300005459 | Bacteria | 4295 |
| 75 | Ga0070685_10075954 | 3300005466 | Bacteria | 2003 |
| 76 | Ga0070707_100004557 | 3300005468 | Bacteria | 12978 |
| 77 | Ga0070707_100123228 | 3300005468 | Bacteria | 2517 |
| 78 | Ga0070707_100319583 | 3300005468 | Bacteria | 1509 |
| 79 | Ga0070698_100019396 | 3300005471 | Bacteria | 7140 |
| 80 | Ga0070698_100026846 | 3300005471 | Bacteria | 5989 |
| 81 | Ga0070699_100006468 | 3300005518 | Bacteria | 10207 |
| 82 | Ga0070699_100015295 | 3300005518 | Bacteria | 6594 |
| 83 | Ga0070679_100000819 | 3300005530 | Bacteria | 26989 |
| 84 | Ga0070679_100219092 | 3300005530 | Bacteria | 1865 |
| 85 | Ga0070679_100300623 | 3300005530 | Bacteria | 1555 |
| 86 | Ga0070684_100027342 | 3300005535 | Bacteria | 4813 |
| 87 | Ga0070684_100143700 | 3300005535 | Bacteria | 2159 |
| 88 | Ga0070684_100290349 | 3300005535 | Bacteria | 1499 |
| 89 | Ga0070697_100060604 | 3300005536 | Bacteria | 3085 |
| 90 | Ga0068853_100010775 | 3300005539 | Bacteria | 7405 |
| 91 | Ga0068853_100031870 | 3300005539 | Bacteria | 4462 |
| 92 | Ga0068853_100521222 | 3300005539 | Bacteria | 1124 |
| 93 | Ga0070672_100018243 | 3300005543 | Bacteria | 5068 |
| 94 | Ga0070672_100250323 | 3300005543 | Bacteria | 1492 |
| 95 | Ga0070686_100012452 | 3300005544 | Bacteria | 4847 |
| 96 | Ga0070695_100212295 | 3300005545 | Bacteria | 1390 |
| 97 | Ga0070696_100048904 | 3300005546 | Bacteria | 2936 |
| 98 | Ga0070693_100075534 | 3300005547 | Bacteria | 1996 |
| 99 | Ga0070665_100001041 | 3300005548 | Bacteria | 34761 |
| 100 | Ga0070704_100113277 | 3300005549 | Bacteria | 2068 |
| 101 | Ga0070704_100432237 | 3300005549 | Bacteria | 1130 |
| 102 | Ga0068855_100195556 | 3300005563 | Bacteria | 2279 |
| 103 | Ga0070664_100011274 | 3300005564 | Bacteria | 7250 |
| 104 | Ga0068857_100022785 | 3300005577 | Bacteria | 5510 |
| 105 | Ga0068854_100026868 | 3300005578 | Bacteria | 3960 |
| 106 | Ga0068854_100154648 | 3300005578 | Bacteria | 1771 |
| 107 | Ga0068854_100173123 | 3300005578 | Bacteria | 1681 |
| 108 | Ga0068856_100019645 | 3300005614 | Bacteria | 6557 |
| 109 | Ga0068856_100041104 | 3300005614 | Bacteria | 4543 |
| 110 | Ga0068856_100056472 | 3300005614 | Bacteria | 3873 |
| 111 | Ga0068856_100066865 | 3300005614 | Bacteria | 3551 |
| 112 | Ga0068856_100376928 | 3300005614 | Bacteria | 1438 |
| 113 | Ga0070702_100012309 | 3300005615 | Bacteria | 4281 |
| 114 | Ga0068852_100240646 | 3300005616 | Bacteria | 1729 |
| 115 | Ga0068859_100020140 | 3300005617 | Bacteria | 6697 |
| 116 | Ga0068859_100026381 | 3300005617 | Bacteria | 5825 |
| 117 | Ga0068859_100261534 | 3300005617 | Bacteria | 1822 |
| 118 | Ga0068864_100010017 | 3300005618 | Bacteria | 7824 |
| 119 | Ga0068864_100037412 | 3300005618 | Bacteria | 4141 |
| 120 | Ga0068864_100067381 | 3300005618 | Bacteria | 3108 |
| 121 | Ga0068864_100190398 | 3300005618 | Bacteria | 1880 |
| 122 | Ga0068864_100210056 | 3300005618 | Bacteria | 1792 |
| 123 | Ga0068866_10010069 | 3300005718 | Bacteria | 4043 |
| 124 | Ga0068861_100196386 | 3300005719 | Bacteria | 1690 |
| 125 | Ga0068851_10092917 | 3300005834 | Bacteria | 1590 |
| 126 | Ga0068863_100000915 | 3300005841 | Bacteria | 29639 |
| 127 | Ga0068863_100037389 | 3300005841 | Bacteria | 4622 |
| 128 | Ga0068858_100027277 | 3300005842 | Bacteria | 5306 |
| 129 | Ga0068858_100067147 | 3300005842 | Bacteria | 3321 |
| 130 | Ga0068858_100261606 | 3300005842 | Bacteria | 1645 |
| 131 | Ga0068860_100006307 | 3300005843 | Bacteria | 11911 |
| 132 | Ga0068860_100050865 | 3300005843 | Bacteria | 3944 |
| 133 | Ga0068860_100087896 | 3300005843 | Bacteria | 2958 |
| 134 | Ga0068860_100108354 | 3300005843 | Bacteria | 2655 |
| 135 | Ga0068860_100453531 | 3300005843 | Bacteria | 1275 |
| 136 | Ga0068862_100052886 | 3300005844 | Bacteria | 3476 |
| 137 | Ga0068862_100333216 | 3300005844 | Bacteria | 1404 |
| 138 | Ga0081455_10080221 | 3300005937 | Bacteria | 2676 |
| 139 | Ga0081538_10005249 | 3300005981 | Bacteria | 11704 |
| 140 | Ga0081538_10019084 | 3300005981 | Bacteria | 5115 |
| 141 | Ga0081538_10039816 | 3300005981 | Bacteria | 3008 |
| 142 | Ga0081539_10000508 | 3300005985 | Bacteria | 80945 |
| 143 | Ga0081539_10002393 | 3300005985 | Bacteria | 26687 |
| 144 | Ga0081539_10009588 | 3300005985 | Bacteria | 8049 |
| 145 | Ga0075364_10098589 | 3300006051 | Bacteria | 1944 |
| 146 | Ga0070712_100028006 | 3300006175 | Bacteria | 3766 |
| 147 | Ga0070712_100042560 | 3300006175 | Bacteria | 3124 |
| 148 | Ga0097621_100008887 | 3300006237 | Bacteria | 7261 |
| 149 | Ga0097621_100026436 | 3300006237 | Bacteria | 4553 |
| 150 | Ga0068871_100019002 | 3300006358 | Bacteria | 5238 |
| 151 | Ga0075428_100087047 | 3300006844 | Bacteria | 3408 |
| 152 | Ga0075428_100271474 | 3300006844 | Bacteria | 1825 |
| 153 | Ga0075430_100019767 | 3300006846 | Bacteria | 5731 |
| 154 | Ga0075430_100162599 | 3300006846 | Bacteria | 1858 |
| 155 | Ga0075433_10042928 | 3300006852 | Bacteria | 3925 |
| 156 | Ga0075429_100052445 | 3300006880 | Bacteria | 3549 |
| 157 | Ga0068865_100009196 | 3300006881 | Bacteria | 6116 |
| 158 | Ga0097620_100020141 | 3300006931 | Bacteria | 6697 |
| 159 | Ga0097620_100026381 | 3300006931 | Bacteria | 5825 |
| 160 | Ga0097620_100261524 | 3300006931 | Bacteria | 1822 |
| 161 | Ga0111539_10004239 | 3300009094 | Bacteria | 18799 |
| 162 | Ga0111539_10005862 | 3300009094 | Bacteria | 15868 |
| 163 | Ga0105245_10031318 | 3300009098 | Bacteria | 4706 |
| 164 | Ga0105247_10000940 | 3300009101 | Bacteria | 21955 |
| 165 | Ga0114129_10002234 | 3300009147 | Bacteria | 26722 |
| 166 | Ga0114129_10014519 | 3300009147 | Bacteria | 11225 |
| 167 | Ga0114129_10452895 | 3300009147 | Bacteria | 1683 |
| 168 | Ga0105243_10014777 | 3300009148 | Bacteria | 5906 |
| 169 | Ga0105243_10029250 | 3300009148 | Bacteria | 4236 |
| 170 | Ga0105243_10180766 | 3300009148 | Bacteria | 1834 |
| 171 | Ga0105241_10070007 | 3300009174 | Bacteria | 2721 |
| 172 | Ga0105242_10025407 | 3300009176 | Bacteria | 4688 |
| 173 | Ga0105242_10060882 | 3300009176 | Bacteria | 3103 |
| 174 | Ga0105248_10029475 | 3300009177 | Bacteria | 6122 |
| 175 | Ga0105248_10076243 | 3300009177 | Bacteria | 3769 |
| 176 | Ga0105248_10121267 | 3300009177 | Bacteria | 2949 |
| 177 | Ga0105248_10247519 | 3300009177 | Bacteria | 2006 |
| 178 | Ga0105237_10098265 | 3300009545 | Bacteria | 2918 |
| 179 | Ga0105237_10233320 | 3300009545 | Bacteria | 1841 |
| 180 | Ga0105238_10013757 | 3300009551 | Bacteria | 8178 |
| 181 | Ga0105249_10095926 | 3300009553 | Bacteria | 2781 |
| 182 | Ga0105239_10042817 | 3300010375 | Bacteria | 4962 |
| 183 | Ga0105239_10077267 | 3300010375 | Bacteria | 3664 |
| 184 | Ga0105246_10066906 | 3300011119 | Bacteria | 2517 |
| 185 | Ga0157373_10040457 | 3300013100 | Bacteria | 3336 |
| 186 | Ga0157371_10245259 | 3300013102 | Bacteria | 1289 |
| 187 | Ga0157370_10084986 | 3300013104 | Bacteria | 2973 |
| 188 | Ga0157370_10278049 | 3300013104 | Bacteria | 1547 |
| 189 | Ga0157369_10020876 | 3300013105 | Bacteria | 7322 |
| 190 | Ga0157369_10087964 | 3300013105 | Bacteria | 3316 |
| 191 | Ga0157369_10236595 | 3300013105 | Bacteria | 1908 |
| 192 | Ga0157369_10390086 | 3300013105 | Bacteria | 1445 |
| 193 | Ga0157374_10004694 | 3300013296 | Bacteria | 11471 |
| 194 | Ga0157378_10021461 | 3300013297 | Bacteria | 5679 |
| 195 | Ga0157378_10061116 | 3300013297 | Bacteria | 3361 |
| 196 | Ga0157378_10201356 | 3300013297 | Bacteria | 1883 |
| 197 | Ga0163162_10026770 | 3300013306 | Bacteria | 5702 |
| 198 | Ga0163162_10080345 | 3300013306 | Bacteria | 3328 |
| 199 | Ga0163162_10426979 | 3300013306 | Bacteria | 1457 |
| 200 | Ga0163162_10498448 | 3300013306 | Bacteria | 1348 |
| 201 | Ga0163162_10505319 | 3300013306 | Bacteria | 1339 |
| 202 | Ga0163162_10590644 | 3300013306 | Bacteria | 1237 |
| 203 | Ga0157372_10035510 | 3300013307 | Bacteria | 5488 |
| 204 | Ga0157372_10359897 | 3300013307 | Bacteria | 1695 |
| 205 | Ga0163163_10000333 | 3300014325 | Bacteria | 45333 |
| 206 | Ga0163163_10015670 | 3300014325 | Bacteria | 7018 |
| 207 | Ga0163163_10024482 | 3300014325 | Bacteria | 5746 |
| 208 | Ga0163163_10054345 | 3300014325 | Bacteria | 3956 |
| 209 | Ga0163163_10090075 | 3300014325 | Bacteria | 3080 |
| 210 | Ga0157380_10005498 | 3300014326 | Bacteria | 8856 |
| 211 | Ga0182008_10063190 | 3300014497 | Bacteria | 1824 |
| 212 | Ga0157377_10030363 | 3300014745 | Bacteria | 2927 |
| 213 | Ga0157379_10055175 | 3300014968 | Bacteria | 3551 |
| 214 | Ga0157376_10004147 | 3300014969 | Bacteria | 10046 |
| 215 | Ga0157376_10120813 | 3300014969 | Bacteria | 2321 |
| 216 | Ga0182007_10012823 | 3300015262 | Bacteria | 3214 |
| 217 | Ga0163161_10010034 | 3300017792 | Bacteria | 6557 |
| 218 | Ga0197907_10908011 | 3300020069 | Bacteria | 1659 |
| 219 | Ga0213873_10045849 | 3300021358 | Bacteria | 1142 |
| 220 | Ga0213874_10007424 | 3300021377 | Bacteria | 2632 |
| 221 | Ga0213874_10018726 | 3300021377 | Bacteria | 1875 |
| 222 | Ga0213876_10003751 | 3300021384 | Bacteria | 8617 |
| 223 | Ga0213876_10039924 | 3300021384 | Bacteria | 2479 |
| 224 | Ga0213876_10048202 | 3300021384 | Bacteria | 2251 |
| 225 | Ga0213876_10058212 | 3300021384 | Bacteria | 2040 |
| 226 | Ga0213875_10046844 | 3300021388 | Bacteria | 2028 |
| 227 | Ga0213871_10029025 | 3300021441 | Bacteria | 1432 |
| 228 | Ga0209148_1000660 | 3300025254 | Bacteria | 29677 |
| 229 | Ga0209233_1005991 | 3300025261 | Bacteria | 3970 |
| 230 | Ga0209455_1001949 | 3300025272 | Bacteria | 8509 |
| 231 | Ga0207697_10004860 | 3300025315 | Bacteria | 6347 |
| 232 | Ga0207692_10078558 | 3300025898 | Bacteria | 1759 |
| 233 | Ga0207692_10110457 | 3300025898 | Bacteria | 1524 |
| 234 | Ga0207710_10001235 | 3300025900 | Bacteria | 12944 |
| 235 | Ga0207688_10002493 | 3300025901 | Bacteria | 9908 |
| 236 | Ga0207688_10022756 | 3300025901 | Bacteria | 3431 |
| 237 | Ga0207688_10103592 | 3300025901 | Bacteria | 1646 |
| 238 | Ga0207680_10009570 | 3300025903 | Bacteria | 4812 |
| 239 | Ga0207680_10162850 | 3300025903 | Bacteria | 1497 |
| 240 | Ga0207680_10185772 | 3300025903 | Bacteria | 1408 |
| 241 | Ga0207647_10035570 | 3300025904 | Bacteria | 3172 |
| 242 | Ga0207699_10060267 | 3300025906 | Bacteria | 2278 |
| 243 | Ga0207645_10142014 | 3300025907 | Bacteria | 1565 |
| 244 | Ga0207643_10035840 | 3300025908 | Bacteria | 2783 |
| 245 | Ga0207643_10051910 | 3300025908 | Bacteria | 2328 |
| 246 | Ga0207654_10132528 | 3300025911 | Bacteria | 1579 |
| 247 | Ga0207707_10000028 | 3300025912 | Bacteria | 167115 |
| 248 | Ga0207707_10018373 | 3300025912 | Bacteria | 6094 |
| 249 | Ga0207707_10025765 | 3300025912 | Bacteria | 5143 |
| 250 | Ga0207707_10310727 | 3300025912 | Bacteria | 1362 |
| 251 | Ga0207695_10233495 | 3300025913 | Bacteria | 1743 |
| 252 | Ga0207671_10093351 | 3300025914 | Bacteria | 2270 |
| 253 | Ga0207693_10000318 | 3300025915 | Bacteria | 44789 |
| 254 | Ga0207693_10014552 | 3300025915 | Bacteria | 6322 |
| 255 | Ga0207693_10052099 | 3300025915 | Bacteria | 3210 |
| 256 | Ga0207663_10000403 | 3300025916 | Bacteria | 18706 |
| 257 | Ga0207663_10140002 | 3300025916 | Bacteria | 1684 |
| 258 | Ga0207660_10176589 | 3300025917 | Bacteria | 1656 |
| 259 | Ga0207662_10212155 | 3300025918 | Bacteria | 1257 |
| 260 | Ga0207657_10129949 | 3300025919 | Bacteria | 2065 |
| 261 | Ga0207657_10176329 | 3300025919 | Bacteria | 1730 |
| 262 | Ga0207649_10125483 | 3300025920 | Bacteria | 1736 |
| 263 | Ga0207652_10001456 | 3300025921 | Bacteria | 20962 |
| 264 | Ga0207652_10192762 | 3300025921 | Bacteria | 1833 |
| 265 | Ga0207652_10340521 | 3300025921 | Bacteria | 1354 |
| 266 | Ga0207646_10002372 | 3300025922 | Bacteria | 22266 |
| 267 | Ga0207646_10107049 | 3300025922 | Bacteria | 2508 |
| 268 | Ga0207681_10021108 | 3300025923 | Bacteria | 4135 |
| 269 | Ga0207694_10007727 | 3300025924 | Bacteria | 8145 |
| 270 | Ga0207694_10027497 | 3300025924 | Bacteria | 4332 |
| 271 | Ga0207650_10000046 | 3300025925 | Bacteria | 178190 |
| 272 | Ga0207650_10076882 | 3300025925 | Bacteria | 2523 |
| 273 | Ga0207650_10233327 | 3300025925 | Bacteria | 1485 |
| 274 | Ga0207659_10039234 | 3300025926 | Bacteria | 3301 |
| 275 | Ga0207659_10340751 | 3300025926 | Bacteria | 1241 |
| 276 | Ga0207700_10144911 | 3300025928 | Bacteria | 1956 |
| 277 | Ga0207664_10108492 | 3300025929 | Bacteria | 2305 |
| 278 | Ga0207644_10006205 | 3300025931 | Bacteria | 7796 |
| 279 | Ga0207644_10051680 | 3300025931 | Bacteria | 2951 |
| 280 | Ga0207644_10056131 | 3300025931 | Bacteria | 2841 |
| 281 | Ga0207690_10015288 | 3300025932 | Bacteria | 4647 |
| 282 | Ga0207690_10092340 | 3300025932 | Bacteria | 2142 |
| 283 | Ga0207706_10069412 | 3300025933 | Bacteria | 3100 |
| 284 | Ga0207686_10032073 | 3300025934 | Bacteria | 3124 |
| 285 | Ga0207686_10037691 | 3300025934 | Bacteria | 2919 |
| 286 | Ga0207709_10008475 | 3300025935 | Bacteria | 5689 |
| 287 | Ga0207670_10058663 | 3300025936 | Bacteria | 2615 |
| 288 | Ga0207670_10251564 | 3300025936 | Bacteria | 1366 |
| 289 | Ga0207704_10127450 | 3300025938 | Bacteria | 1755 |
| 290 | Ga0207665_10087381 | 3300025939 | Bacteria | 2155 |
| 291 | Ga0207665_10269674 | 3300025939 | Bacteria | 1263 |
| 292 | Ga0207691_10002179 | 3300025940 | Bacteria | 19142 |
| 293 | Ga0207691_10118494 | 3300025940 | Bacteria | 2348 |
| 294 | Ga0207691_10154645 | 3300025940 | Bacteria | 2015 |
| 295 | Ga0207711_10005322 | 3300025941 | Bacteria | 10914 |
| 296 | Ga0207711_10011584 | 3300025941 | Bacteria | 7330 |
| 297 | Ga0207711_10067488 | 3300025941 | Bacteria | 3096 |
| 298 | Ga0207711_10217929 | 3300025941 | Bacteria | 1745 |
| 299 | Ga0207689_10009911 | 3300025942 | Bacteria | 8215 |
| 300 | Ga0207689_10036738 | 3300025942 | Bacteria | 4066 |
| 301 | Ga0207689_10042553 | 3300025942 | Bacteria | 3757 |
| 302 | Ga0207689_10079236 | 3300025942 | Bacteria | 2700 |
| 303 | Ga0207689_10117890 | 3300025942 | Bacteria | 2183 |
| 304 | Ga0207661_10005005 | 3300025944 | Bacteria | 9293 |
| 305 | Ga0207679_10094891 | 3300025945 | Bacteria | 2317 |
| 306 | Ga0207679_10120610 | 3300025945 | Bacteria | 2086 |
| 307 | Ga0207679_10123682 | 3300025945 | Bacteria | 2064 |
| 308 | Ga0207679_10188564 | 3300025945 | Bacteria | 1712 |
| 309 | Ga0207651_10144238 | 3300025960 | Bacteria | 1844 |
| 310 | Ga0207651_10253147 | 3300025960 | Bacteria | 1442 |
| 311 | Ga0207658_10055458 | 3300025986 | Bacteria | 2937 |
| 312 | Ga0207639_10027229 | 3300026041 | Bacteria | 4162 |
| 313 | Ga0207708_10001416 | 3300026075 | Bacteria | 17970 |
| 314 | Ga0207708_10004271 | 3300026075 | Bacteria | 10525 |
| 315 | Ga0207708_10016248 | 3300026075 | Bacteria | 5593 |
| 316 | Ga0207708_10026319 | 3300026075 | Bacteria | 4401 |
| 317 | Ga0207708_10044244 | 3300026075 | Bacteria | 3392 |
| 318 | Ga0207702_10090121 | 3300026078 | Bacteria | 2683 |
| 319 | Ga0207702_10104135 | 3300026078 | Bacteria | 2511 |
| 320 | Ga0207702_10158506 | 3300026078 | Bacteria | 2065 |
| 321 | Ga0207702_10186258 | 3300026078 | Bacteria | 1915 |
| 322 | Ga0207641_10114736 | 3300026088 | Bacteria | 2394 |
| 323 | Ga0207641_10412116 | 3300026088 | Bacteria | 1299 |
| 324 | Ga0207648_10019959 | 3300026089 | Bacteria | 6047 |
| 325 | Ga0207676_10006578 | 3300026095 | Bacteria | 8216 |
| 326 | Ga0207676_10231081 | 3300026095 | Bacteria | 1653 |
| 327 | Ga0207676_10282923 | 3300026095 | Bacteria | 1506 |
| 328 | Ga0207674_10002025 | 3300026116 | Bacteria | 25725 |
| 329 | Ga0207674_10368376 | 3300026116 | Bacteria | 1389 |
| 330 | Ga0207675_100006381 | 3300026118 | Bacteria | 11176 |
| 331 | Ga0207675_100020009 | 3300026118 | Bacteria | 6245 |
| 332 | Ga0207675_100119053 | 3300026118 | Bacteria | 2498 |
| 333 | Ga0207683_10036121 | 3300026121 | Bacteria | 4300 |
| 334 | Ga0207683_10440666 | 3300026121 | Bacteria | 1200 |
| 335 | Ga0207698_10029437 | 3300026142 | Bacteria | 3933 |
| 336 | Ga0207698_10363066 | 3300026142 | Bacteria | 1372 |
| 337 | Ga0207428_10009788 | 3300027907 | Bacteria | 8588 |
| 338 | Ga0207428_10127532 | 3300027907 | Bacteria | 1948 |
| 339 | Ga0268266_10133736 | 3300028379 | Bacteria | 2220 |
| 340 | Ga0268266_10165811 | 3300028379 | Bacteria | 2001 |
| 341 | Ga0268265_10047868 | 3300028380 | Bacteria | 3206 |
| 342 | Ga0268265_10191454 | 3300028380 | Bacteria | 1767 |
| 343 | Ga0268264_10062848 | 3300028381 | Bacteria | 3119 |
| 344 | Ga0268264_10140613 | 3300028381 | Bacteria | 2152 |
| 345 | Ga0265319_1002151 | 3300028563 | Bacteria | 11022 |
| 346 | Ga0265319_1004443 | 3300028563 | Bacteria | 6940 |
| 347 | Ga0265334_10016024 | 3300028573 | Bacteria | 3104 |
| 348 | Ga0265318_10033209 | 3300028577 | Bacteria | 1993 |
| 349 | Ga0265338_10012127 | 3300028800 | Bacteria | 9847 |
| 350 | Ga0265338_10058930 | 3300028800 | Bacteria | 3385 |
| 351 | Ga0265320_10046312 | 3300031240 | Bacteria | 2132 |
| 352 | Ga0265325_10107172 | 3300031241 | Bacteria | 1362 |
| 353 | Ga0265340_10010465 | 3300031247 | Bacteria | 4959 |
| 354 | Ga0265339_10030796 | 3300031249 | Bacteria | 3036 |
| 355 | Ga0265331_10046674 | 3300031250 | Bacteria | 2087 |
| 356 | Ga0265327_10004348 | 3300031251 | Bacteria | 12610 |
| 357 | Ga0265327_10034325 | 3300031251 | Bacteria | 2816 |
| 358 | Ga0316579_10011676 | 3300031691 | Bacteria | 3739 |
| 359 | Ga0265342_10023274 | 3300031712 | Bacteria | 3924 |
| 360 | Ga0316576_10112307 | 3300031727 | Bacteria | 2043 |
| 361 | Ga0307407_10296380 | 3300031903 | Bacteria | 1126 |
| 362 | Ga0307416_100014583 | 3300032002 | Bacteria | 5394 |
| 363 | Ga0307415_100019592 | 3300032126 | Bacteria | 4111 |
| 364 | Ga0307415_100390001 | 3300032126 | Bacteria | 1185 |
| 365 | Ga0316574_0051177 | 3300035398 | Bacteria | 2574 |
| 366 | Ga0373933_0008354 | 3300035724 | Bacteria | 5653 |
| 367 | Ga0373937_0008559 | 3300036401 | Bacteria | 8888 |
| 368 | Ga0373937_0033200 | 3300036401 | Bacteria | 4685 |
| 369 | Ga0373937_0208189 | 3300036401 | Bacteria | 1840 |
| 370 | Ga0373937_0212098 | 3300036401 | Bacteria | 1822 |
| 371 | Ga0395898_0102765 | 3300037466 | Bacteria | 2743 |
| 372 | Ga0436364_0030065 | 3300037853 | Bacteria | 1351 |
| 373 | Ga0436364_0237688 | 3300037853 | Bacteria | 9977 |
| 374 | Ga0436364_0271519 | 3300037853 | Bacteria | 1467 |
| 375 | Ga0436364_0445774 | 3300037853 | Bacteria | 40627 |
| 376 | Ga0436364_0595302 | 3300037853 | Bacteria | 2359 |
| 377 | Ga0436364_1048038 | 3300037853 | Bacteria | 14083 |
| 378 | Ga0395901_0145720 | 3300038443 | Bacteria | 2489 |
| 379 | Ga0242419_002532 | 3300038698 | Bacteria | 1191 |
| 380 | Ga0242420_001887 | 3300038996 | Bacteria | 2902 |
| 381 | Ga0242420_003553 | 3300038996 | Bacteria | 2307 |
| 382 | Ga0436365_0282749 | 3300039437 | Bacteria | 2122 |
| 383 | Ga0436365_0538543 | 3300039437 | Bacteria | 3132 |
| 384 | Ga0436365_0575287 | 3300039437 | Bacteria | 3871 |
| 385 | Ga0436365_0934847 | 3300039437 | Bacteria | 10390 |
| 386 | Ga0436365_1561332 | 3300039437 | Bacteria | 6168 |
| 387 | Ga0436365_1623746 | 3300039437 | Bacteria | 4860 |
| 388 | Ga0436360_0073838 | 3300039438 | Bacteria | 1627 |
| 389 | Ga0436363_0379843 | 3300039450 | Bacteria | 1257 |
| 390 | Ga0436363_0537558 | 3300039450 | Bacteria | 1108 |
| 391 | Ga0436363_0705637 | 3300039450 | Bacteria | 3584 |
| 392 | Ga0436363_1147919 | 3300039450 | Bacteria | 11712 |
| 393 | Ga0436363_1339971 | 3300039450 | Bacteria | 7742 |
| 394 | Ga0436363_1410693 | 3300039450 | Bacteria | 1513 |
| 395 | Ga0436362_0767539 | 3300039453 | Bacteria | 2302 |
| 396 | Ga0451839_0056850 | 3300041496 | Bacteria | 1368 |
| 397 | Ga0439431_0024046 | 3300041997 | Bacteria | 1480 |
| 398 | Ga0439440_0018808 | 3300042993 | Bacteria | 1534 |
| 399 | Ga0466969_0013288 | 3300044656 | Bacteria | 4336 |
| 400 | Ga0466969_0081421 | 3300044656 | Bacteria | 1545 |
| 401 | Ga0466969_0081977 | 3300044656 | Bacteria | 1538 |
| 402 | Ga0466966_0030397 | 3300044684 | Bacteria | 3508 |
| 403 | Ga0466966_0040752 | 3300044684 | Bacteria | 2988 |
| 404 | Ga0466966_0099452 | 3300044684 | Bacteria | 1800 |
| 405 | Ga0466966_0118135 | 3300044684 | Bacteria | 1631 |
| 406 | Ga0466966_0211094 | 3300044684 | Bacteria | 1173 |
| 407 | Ga0466961_0011934 | 3300044693 | Bacteria | 5554 |
| 408 | Ga0466961_0246568 | 3300044693 | Bacteria | 1097 |
| 409 | Ga0466963_0008066 | 3300044694 | Bacteria | 6305 |
| 410 | Ga0466963_0014264 | 3300044694 | Bacteria | 4896 |
| 411 | Ga0466963_0019687 | 3300044694 | Bacteria | 4237 |
| 412 | Ga0466963_0024625 | 3300044694 | Bacteria | 3831 |
| 413 | Ga0466963_0044903 | 3300044694 | Bacteria | 2908 |
| 414 | Ga0466963_0048790 | 3300044694 | Bacteria | 2799 |
| 415 | Ga0466963_0123698 | 3300044694 | Bacteria | 1782 |
| 416 | Ga0466971_0040339 | 3300044719 | Bacteria | 2097 |
| 417 | Ga0466971_0120746 | 3300044719 | Bacteria | 1213 |
| 418 | Ga0466968_0009794 | 3300044735 | Bacteria | 3699 |
| 419 | Ga0466968_0088914 | 3300044735 | Bacteria | 1366 |
| 420 | Ga0466970_0018802 | 3300044765 | Bacteria | 3580 |
| 421 | Ga0466970_0081375 | 3300044765 | Bacteria | 1751 |
| 422 | Ga0466957_0025625 | 3300044842 | Bacteria | 3496 |
| 423 | Ga0466957_0077681 | 3300044842 | Bacteria | 2063 |
| 424 | Ga0466960_0043431 | 3300044901 | Bacteria | 2138 |
| 425 | Ga0466960_0114287 | 3300044901 | Bacteria | 1406 |
| 426 | Ga0466959_0002972 | 3300045049 | Bacteria | 10946 |
| 427 | Ga0466959_0003676 | 3300045049 | Bacteria | 10116 |
| 428 | Ga0466959_0004705 | 3300045049 | Bacteria | 9191 |
| 429 | Ga0466959_0019337 | 3300045049 | Bacteria | 5009 |
| 430 | Ga0466959_0083963 | 3300045049 | Bacteria | 2293 |
| 431 | Ga0466959_0131995 | 3300045049 | Bacteria | 1770 |
| 432 | Ga0466959_0159258 | 3300045049 | Bacteria | 1588 |
| 433 | Ga0466959_0166424 | 3300045049 | Bacteria | 1548 |
| 434 | Ga0466959_0204496 | 3300045049 | Bacteria | 1374 |
| 435 | Ga0466958_0001781 | 3300045836 | Bacteria | 10445 |
| 436 | Ga0466958_0004223 | 3300045836 | Bacteria | 7556 |
| 437 | Ga0466958_0006079 | 3300045836 | Bacteria | 6544 |
| 438 | Ga0466958_0010518 | 3300045836 | Bacteria | 5183 |
| 439 | Ga0466958_0040734 | 3300045836 | Bacteria | 2792 |
| 440 | Ga0466958_0100117 | 3300045836 | Bacteria | 1801 |
| 441 | Ga0466958_0239431 | 3300045836 | Bacteria | 1159 |
| 442 | Ga0466967_0000087 | 3300045976 | Bacteria | 34051 |
| 443 | Ga0466967_0006761 | 3300045976 | Bacteria | 8165 |
| 444 | Ga0466967_0007780 | 3300045976 | Bacteria | 7780 |
| 445 | Ga0466967_0008112 | 3300045976 | Bacteria | 7661 |
| 446 | Ga0466967_0024302 | 3300045976 | Bacteria | 4980 |
| 447 | Ga0466967_0124338 | 3300045976 | Bacteria | 2388 |
| 448 | Ga0466967_0343679 | 3300045976 | Bacteria | 1443 |
| 449 | Ga0495629_0086921 | 3300046459 | Bacteria | 2181 |
| 450 | Ga0495651_0019189 | 3300046462 | Bacteria | 5297 |
| 451 | Ga0495653_0043766 | 3300046463 | Bacteria | 3478 |
| 452 | Ga0495650_0000398 | 3300046471 | Bacteria | 72672 |
| 453 | Ga0495580_0108013 | 3300046472 | Bacteria | 1932 |
| 454 | Ga0495664_0087972 | 3300046477 | Bacteria | 1867 |
| 455 | Ga0495606_0078434 | 3300046507 | Bacteria | 2060 |
| 456 | Ga0495608_0019074 | 3300046511 | Bacteria | 4727 |
| 457 | Ga0495630_0123999 | 3300046517 | Bacteria | 1960 |
| 458 | Ga0495630_0146197 | 3300046517 | Bacteria | 1798 |
| 459 | Ga0495652_0057374 | 3300046529 | Bacteria | 3302 |
| 460 | Ga0495587_0069140 | 3300046536 | Bacteria | 2056 |
| 461 | Ga0495667_0023983 | 3300046559 | Bacteria | 4108 |
| 462 | Ga0495667_0024495 | 3300046559 | Bacteria | 4064 |
| 463 | Ga0495634_0088572 | 3300046642 | Bacteria | 2013 |
| 464 | Ga0495635_0053247 | 3300046663 | Bacteria | 2788 |
| 465 | Ga0495657_0047966 | 3300046675 | Bacteria | 2884 |
| 466 | Ga0495657_0081516 | 3300046675 | Bacteria | 2092 |
| 467 | Ga0495646_0009781 | 3300046680 | Bacteria | 6092 |
| 468 | Ga0495647_0008638 | 3300046681 | Bacteria | 3428 |
| 469 | Ga0495658_0073798 | 3300046683 | Bacteria | 1987 |
| 470 | Ga0495604_0165329 | 3300047317 | Bacteria | 1560 |
| 471 | Ga0495674_0298699 | 3300047319 | Bacteria | 1316 |
| 472 | Ga0495672_0000875 | 3300047320 | Bacteria | 31630 |
| 473 | Ga0495680_0026856 | 3300047322 | Bacteria | 4740 |
| 474 | Ga0495680_0039124 | 3300047322 | Bacteria | 3785 |
| 475 | Ga0495680_0091922 | 3300047322 | Bacteria | 2274 |
| 476 | Ga0495684_0076611 | 3300047471 | Bacteria | 2540 |
| 477 | Ga0495686_0002217 | 3300047472 | Bacteria | 18851 |
| 478 | Ga0495686_0050119 | 3300047472 | Bacteria | 2624 |
| 479 | Ga0495593_0102753 | 3300047673 | Bacteria | 1465 |
| 480 | Ga0495602_0006880 | 3300048088 | Bacteria | 11952 |
| 481 | Ga0496100_0006518 | 3300048903 | Bacteria | 6368 |
| 482 | Ga0496100_0067336 | 3300048903 | Bacteria | 2378 |
| 483 | Ga0496101_0046537 | 3300048904 | Bacteria | 3112 |
| 484 | Ga0496101_0078933 | 3300048904 | Bacteria | 2429 |
| 485 | Ga0496102_0095306 | 3300048905 | Bacteria | 2758 |
| 486 | Ga0496102_0141548 | 3300048905 | Bacteria | 2256 |
| 487 | Ga0496104_0008846 | 3300048907 | Bacteria | 8952 |
| 488 | Ga0496104_0036380 | 3300048907 | Bacteria | 4602 |
| 489 | Ga0496104_0054491 | 3300048907 | Bacteria | 3780 |
| 490 | Ga0496104_0517086 | 3300048907 | Bacteria | 1105 |
| 491 | Ga0496105_0012536 | 3300048908 | Bacteria | 6713 |
| 492 | Ga0496106_0008472 | 3300048909 | Bacteria | 7608 |
| 493 | Ga0496106_0147147 | 3300048909 | Bacteria | 1856 |
| 494 | Ga0496106_0178938 | 3300048909 | Bacteria | 1683 |
| 495 | Ga0496107_0058504 | 3300048910 | Bacteria | 2787 |
| 496 | Ga0496108_0019043 | 3300048911 | Bacteria | 5631 |
| 497 | Ga0496108_0053454 | 3300048911 | Bacteria | 3387 |
| 498 | Ga0496108_0112658 | 3300048911 | Bacteria | 2328 |
| 499 | Ga0496108_0435165 | 3300048911 | Bacteria | 1146 |
| 500 | Ga0496108_0475052 | 3300048911 | Bacteria | 1092 |
| 501 | Ga0496109_0048270 | 3300048912 | Bacteria | 3873 |
| 502 | Ga0496109_0191724 | 3300048912 | Bacteria | 1921 |
| 503 | Ga0496110_0054374 | 3300048913 | Bacteria | 3521 |
| 504 | Ga0496110_0315758 | 3300048913 | Bacteria | 1423 |
| 505 | Ga0496111_0069275 | 3300048914 | Bacteria | 2565 |
| 506 | Ga0496112_0007267 | 3300048915 | Bacteria | 9817 |
| 507 | Ga0496112_0010807 | 3300048915 | Bacteria | 8304 |
| 508 | Ga0496112_0034919 | 3300048915 | Bacteria | 4893 |
| 509 | Ga0496112_0057601 | 3300048915 | Bacteria | 3826 |
| 510 | Ga0496112_0072452 | 3300048915 | Bacteria | 3406 |
| 511 | Ga0496112_0081070 | 3300048915 | Bacteria | 3209 |
| 512 | Ga0496112_0106042 | 3300048915 | Bacteria | 2780 |
| 513 | Ga0496112_0251503 | 3300048915 | Bacteria | 1718 |
| 514 | Ga0496113_0027748 | 3300048916 | Bacteria | 4062 |
| 515 | Ga0496113_0125312 | 3300048916 | Bacteria | 2011 |
| 516 | Ga0496113_0161262 | 3300048916 | Bacteria | 1773 |
| 517 | Ga0496114_0054971 | 3300048917 | Bacteria | 3320 |
| 518 | Ga0496115_0000241 | 3300048918 | Bacteria | 49730 |
| 519 | Ga0496115_0172453 | 3300048918 | Bacteria | 1789 |
| 520 | Ga0496119_0063017 | 3300048922 | Bacteria | 2207 |
| 521 | Ga0496121_0020435 | 3300048924 | Bacteria | 6556 |
| 522 | Ga0501033_0000050 | 3300049570 | Bacteria | 111819 |
| 523 | Ga0501034_0017887 | 3300049571 | Bacteria | 7270 |
| 524 | Ga0501034_0037246 | 3300049571 | Bacteria | 4925 |
| 525 | Ga0501070_0073273 | 3300049586 | Bacteria | 2833 |
| 526 | Ga0501072_0226796 | 3300049588 | Bacteria | 1488 |
| 527 | Ga0501073_0087655 | 3300049589 | Bacteria | 2164 |
| 528 | Ga0501083_0058171 | 3300049744 | Bacteria | 2587 |
| 529 | nmdc:mga00v17_133220_c1 | 3300050491 | Bacteria | 1589 |
| 530 | nmdc:mga05p37_275865_c1 | 3300050507 | Bacteria | 2007 |
| 531 | nmdc:mga05p37_31200_c1 | 3300050507 | Bacteria | 6509 |
| 532 | nmdc:mga05p37_84672_c1 | 3300050507 | Bacteria | 3906 |
| 533 | nmdc:mga09592_47713_c1 | 3300050508 | Bacteria | 3610 |
| 534 | nmdc:mga0qj67_66473_c1 | 3300050509 | Bacteria | 2872 |
| 535 | nmdc:mga06r32_165414_c1 | 3300050510 | Bacteria | 2195 |
| 536 | nmdc:mga08y16_97731_c1 | 3300050511 | Bacteria | 3058 |
| 537 | nmdc:mga0n895_304026_c1 | 3300050512 | Bacteria | 1617 |
| 538 | nmdc:mga0a205_12842_c1 | 3300050515 | Bacteria | 7769 |
| 539 | nmdc:mga0a205_24376_c1 | 3300050515 | Bacteria | 5753 |
| 540 | Ga0495601_0031787 | 3300053077 | Bacteria | 3282 |
| 541 | Ga0495619_0005235 | 3300053085 | Bacteria | 8220 |
| 542 | Ga0495619_0010545 | 3300053085 | Bacteria | 5814 |
| 543 | Ga0500562_003616 | 3300053108 | Bacteria | 3880 |
| 544 | Ga0500634_0000015 | 3300053161 | Bacteria | 113039 |
| 545 | Ga0501084_0252668 | 3300054114 | Bacteria | 1488 |
| 546 | Ga0466962_0015826 | 3300061719 | Bacteria | 3639 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10058930 | Ga0265338_100589303 | 289 |
| 2 | 3300049571 | Ga0501034_0037246 | Ga0501034_0037246_3686_4675 | 291 |
| 3 | 3300048915 | Ga0496112_0010807 | Ga0496112_0010807_455_1444 | 293 |
| 4 | 3300044693 | Ga0466961_0246568 | Ga0466961_0246568_85_1086 | 294 |
| 5 | 3300044694 | Ga0466963_0008066 | Ga0466963_0008066_1769_2770 | 294 |
| 6 | 3300045049 | Ga0466959_0083963 | Ga0466959_0083963_1247_2248 | 294 |
| 7 | 3300045836 | Ga0466958_0006079 | Ga0466958_0006079_1965_2966 | 294 |
| 8 | 3300045976 | Ga0466967_0024302 | Ga0466967_0024302_1926_2927 | 294 |
| 9 | 3300005331 | Ga0070670_100055127 | Ga0070670_1000551272 | 295 |
| 10 | 3300013104 | Ga0157370_10278049 | Ga0157370_102780492 | 295 |
| 11 | 3300013105 | Ga0157369_10020876 | Ga0157369_100208766 | 295 |
| 12 | 3300025925 | Ga0207650_10233327 | Ga0207650_102333272 | 295 |
| 13 | 3300038698 | Ga0242419_002532 | Ga0242419_002532_39_926 | 295 |
| 14 | 3300005434 | Ga0070709_10090090 | Ga0070709_100900902 | 297 |
| 15 | 3300014497 | Ga0182008_10063190 | Ga0182008_100631902 | 297 |
| 16 | 3300015262 | Ga0182007_10012823 | Ga0182007_100128232 | 297 |
| 17 | 3300025906 | Ga0207699_10060267 | Ga0207699_100602672 | 297 |
| 18 | 3300047319 | Ga0495674_0298699 | Ga0495674_0298699_194_1195 | 297 |
| 19 | 3300048915 | Ga0496112_0081070 | Ga0496112_0081070_1507_2508 | 297 |
| 20 | 3300013105 | Ga0157369_10390086 | Ga0157369_103900861 | 298 |
| 21 | 3300044694 | Ga0466963_0024625 | Ga0466963_0024625_791_1816 | 298 |
| 22 | 3300045976 | Ga0466967_0006761 | Ga0466967_0006761_1742_2767 | 298 |
| 23 | 3300049571 | Ga0501034_0017887 | Ga0501034_0017887_517_1542 | 298 |
| 24 | 3300049586 | Ga0501070_0073273 | Ga0501070_0073273_1513_2538 | 298 |
| 25 | 3300049589 | Ga0501073_0087655 | Ga0501073_0087655_285_1310 | 298 |
| 26 | 3300054114 | Ga0501084_0252668 | Ga0501084_0252668_436_1446 | 298 |
| 27 | 3300005468 | Ga0070707_100319583 | Ga0070707_1003195832 | 299 |
| 28 | 3300005614 | Ga0068856_100376928 | Ga0068856_1003769282 | 299 |
| 29 | 3300026078 | Ga0207702_10186258 | Ga0207702_101862583 | 299 |
| 30 | 3300045976 | Ga0466967_0000087 | Ga0466967_0000087_2316_3335 | 299 |
| 31 | 3300048909 | Ga0496106_0008472 | Ga0496106_0008472_1236_2267 | 299 |
| 32 | 3300048912 | Ga0496109_0191724 | Ga0496109_0191724_220_1251 | 299 |
| 33 | 3300028563 | Ga0265319_1002151 | Ga0265319_10021517 | 300 |
| 34 | 3300028573 | Ga0265334_10016024 | Ga0265334_100160243 | 300 |
| 35 | 3300028800 | Ga0265338_10012127 | Ga0265338_100121277 | 300 |
| 36 | 3300031240 | Ga0265320_10046312 | Ga0265320_100463123 | 300 |
| 37 | 3300031241 | Ga0265325_10107172 | Ga0265325_101071722 | 300 |
| 38 | 3300031247 | Ga0265340_10010465 | Ga0265340_100104655 | 300 |
| 39 | 3300031249 | Ga0265339_10030796 | Ga0265339_100307962 | 300 |
| 40 | 3300031250 | Ga0265331_10046674 | Ga0265331_100466741 | 300 |
| 41 | 3300031712 | Ga0265342_10023274 | Ga0265342_100232743 | 300 |
| 42 | 3300031903 | Ga0307407_10296380 | Ga0307407_102963801 | 300 |
| 43 | 3300005471 | Ga0070698_100019396 | Ga0070698_1000193965 | 301 |
| 44 | 3300045049 | Ga0466959_0159258 | Ga0466959_0159258_209_1162 | 301 |
| 45 | 3300046459 | Ga0495629_0086921 | Ga0495629_0086921_530_1546 | 301 |
| 46 | 3300046517 | Ga0495630_0123999 | Ga0495630_0123999_176_1192 | 301 |
| 47 | 3300046559 | Ga0495667_0024495 | Ga0495667_0024495_108_1124 | 301 |
| 48 | 3300046642 | Ga0495634_0088572 | Ga0495634_0088572_128_1144 | 301 |
| 49 | 3300046675 | Ga0495657_0081516 | Ga0495657_0081516_577_1593 | 301 |
| 50 | 3300046683 | Ga0495658_0073798 | Ga0495658_0073798_246_1262 | 301 |
| 51 | 3300047322 | Ga0495680_0039124 | Ga0495680_0039124_1441_2457 | 301 |
| 52 | 3300053085 | Ga0495619_0005235 | Ga0495619_0005235_3308_4324 | 301 |
| 53 | 3300005985 | Ga0081539_10009588 | Ga0081539_100095882 | 303 |
| 54 | 3300013104 | Ga0157370_10084986 | Ga0157370_100849861 | 303 |
| 55 | 3300049588 | Ga0501072_0226796 | Ga0501072_0226796_64_1023 | 303 |
| 56 | 3300044694 | Ga0466963_0123698 | Ga0466963_0123698_294_1319 | 304 |
| 57 | 3300005335 | Ga0070666_10024439 | Ga0070666_100244392 | 305 |
| 58 | 3300005355 | Ga0070671_100001660 | Ga0070671_1000016609 | 305 |
| 59 | 3300005367 | Ga0070667_100082972 | Ga0070667_1000829722 | 305 |
| 60 | 3300005548 | Ga0070665_100001041 | Ga0070665_10000104122 | 305 |
| 61 | 3300005618 | Ga0068864_100037412 | Ga0068864_1000374123 | 305 |
| 62 | 3300005841 | Ga0068863_100000915 | Ga0068863_10000091517 | 305 |
| 63 | 3300009177 | Ga0105248_10029475 | Ga0105248_100294754 | 305 |
| 64 | 3300013296 | Ga0157374_10004694 | Ga0157374_100046944 | 305 |
| 65 | 3300014325 | Ga0163163_10054345 | Ga0163163_100543452 | 305 |
| 66 | 3300021384 | Ga0213876_10003751 | Ga0213876_100037517 | 305 |
| 67 | 3300025903 | Ga0207680_10009570 | Ga0207680_100095702 | 305 |
| 68 | 3300025931 | Ga0207644_10006205 | Ga0207644_100062055 | 305 |
| 69 | 3300025941 | Ga0207711_10005322 | Ga0207711_100053228 | 305 |
| 70 | 3300026095 | Ga0207676_10231081 | Ga0207676_102310812 | 305 |
| 71 | 3300028379 | Ga0268266_10165811 | Ga0268266_101658112 | 305 |
| 72 | 3300028563 | Ga0265319_1004443 | Ga0265319_10044433 | 305 |
| 73 | 3300046507 | Ga0495606_0078434 | Ga0495606_0078434_411_1436 | 305 |
| 74 | 3300048907 | Ga0496104_0517086 | Ga0496104_0517086_67_1092 | 305 |
| 75 | 3300048911 | Ga0496108_0053454 | Ga0496108_0053454_55_1044 | 305 |
| 76 | 3300048911 | Ga0496108_0475052 | Ga0496108_0475052_20_1045 | 305 |
| 77 | 3300048915 | Ga0496112_0057601 | Ga0496112_0057601_1740_2765 | 305 |
| 78 | 3300048905 | Ga0496102_0141548 | Ga0496102_0141548_319_1308 | 306 |
| 79 | 3300048907 | Ga0496104_0008846 | Ga0496104_0008846_1805_2794 | 306 |
| 80 | 3300048915 | Ga0496112_0106042 | Ga0496112_0106042_875_1864 | 306 |
| 81 | 3300048915 | Ga0496112_0007267 | Ga0496112_0007267_3430_4419 | 307 |
| 82 | 3300047320 | Ga0495672_0000875 | Ga0495672_0000875_11140_12165 | 308 |
| 83 | 3300014968 | Ga0157379_10055175 | Ga0157379_100551752 | 309 |
| 84 | 3300038443 | Ga0395901_0145720 | Ga0395901_0145720_1488_2477 | 309 |
| 85 | 3300045049 | Ga0466959_0131995 | Ga0466959_0131995_87_1079 | 309 |
| 86 | 3300046471 | Ga0495650_0000398 | Ga0495650_0000398_32223_33212 | 309 |
| 87 | 3300048922 | Ga0496119_0063017 | Ga0496119_0063017_121_1110 | 309 |
| 88 | 3300005339 | Ga0070660_100023500 | Ga0070660_1000235004 | 310 |
| 89 | 3300005530 | Ga0070679_100219092 | Ga0070679_1002190922 | 310 |
| 90 | 3300025921 | Ga0207652_10192762 | Ga0207652_101927622 | 310 |
| 91 | 3300048924 | Ga0496121_0020435 | Ga0496121_0020435_4346_5338 | 310 |
| 92 | 3300005329 | Ga0070683_100030796 | Ga0070683_1000307963 | 311 |
| 93 | 3300005336 | Ga0070680_100088572 | Ga0070680_1000885723 | 311 |
| 94 | 3300005337 | Ga0070682_100009728 | Ga0070682_1000097285 | 311 |
| 95 | 3300005354 | Ga0070675_100043116 | Ga0070675_1000431163 | 311 |
| 96 | 3300005355 | Ga0070671_100078675 | Ga0070671_1000786752 | 311 |
| 97 | 3300005441 | Ga0070700_100004002 | Ga0070700_1000040024 | 311 |
| 98 | 3300005456 | Ga0070678_100013797 | Ga0070678_1000137972 | 311 |
| 99 | 3300005535 | Ga0070684_100027342 | Ga0070684_1000273425 | 311 |
| 100 | 3300005614 | Ga0068856_100056472 | Ga0068856_1000564723 | 311 |
| 101 | 3300006175 | Ga0070712_100028006 | Ga0070712_1000280063 | 311 |
| 102 | 3300009545 | Ga0105237_10098265 | Ga0105237_100982653 | 311 |
| 103 | 3300010375 | Ga0105239_10042817 | Ga0105239_100428173 | 311 |
| 104 | 3300013102 | Ga0157371_10245259 | Ga0157371_102452592 | 311 |
| 105 | 3300013105 | Ga0157369_10236595 | Ga0157369_102365952 | 311 |
| 106 | 3300013306 | Ga0163162_10505319 | Ga0163162_105053192 | 311 |
| 107 | 3300013307 | Ga0157372_10035510 | Ga0157372_100355104 | 311 |
| 108 | 3300025898 | Ga0207692_10110457 | Ga0207692_101104571 | 311 |
| 109 | 3300025901 | Ga0207688_10002493 | Ga0207688_100024934 | 311 |
| 110 | 3300025914 | Ga0207671_10093351 | Ga0207671_100933512 | 311 |
| 111 | 3300025915 | Ga0207693_10014552 | Ga0207693_100145524 | 311 |
| 112 | 3300025926 | Ga0207659_10039234 | Ga0207659_100392342 | 311 |
| 113 | 3300025945 | Ga0207679_10094891 | Ga0207679_100948912 | 311 |
| 114 | 3300025945 | Ga0207679_10120610 | Ga0207679_101206101 | 311 |
| 115 | 3300025960 | Ga0207651_10144238 | Ga0207651_101442382 | 311 |
| 116 | 3300026075 | Ga0207708_10001416 | Ga0207708_1000141610 | 311 |
| 117 | 3300026078 | Ga0207702_10158506 | Ga0207702_101585062 | 311 |
| 118 | 3300026121 | Ga0207683_10036121 | Ga0207683_100361213 | 311 |
| 119 | 3300026142 | Ga0207698_10029437 | Ga0207698_100294373 | 311 |
| 120 | 3300048903 | Ga0496100_0067336 | Ga0496100_0067336_564_1553 | 311 |
| 121 | 3300048904 | Ga0496101_0078933 | Ga0496101_0078933_154_1143 | 311 |
| 122 | 3300048905 | Ga0496102_0095306 | Ga0496102_0095306_944_1933 | 311 |
| 123 | 3300048908 | Ga0496105_0012536 | Ga0496105_0012536_2639_3628 | 311 |
| 124 | 3300048909 | Ga0496106_0147147 | Ga0496106_0147147_592_1581 | 311 |
| 125 | 3300048910 | Ga0496107_0058504 | Ga0496107_0058504_1348_2337 | 311 |
| 126 | 3300048911 | Ga0496108_0019043 | Ga0496108_0019043_905_1894 | 311 |
| 127 | 3300048912 | Ga0496109_0048270 | Ga0496109_0048270_1266_2255 | 311 |
| 128 | 3300048913 | Ga0496110_0054374 | Ga0496110_0054374_1825_2814 | 311 |
| 129 | 3300048915 | Ga0496112_0034919 | Ga0496112_0034919_2091_3080 | 311 |
| 130 | 3300048916 | Ga0496113_0027748 | Ga0496113_0027748_2247_3236 | 311 |
| 131 | 3300014969 | Ga0157376_10120813 | Ga0157376_101208132 | 313 |
| 132 | 3300005439 | Ga0070711_100051072 | Ga0070711_1000510722 | 314 |
| 133 | 3300005981 | Ga0081538_10005249 | Ga0081538_100052494 | 314 |
| 134 | 3300006175 | Ga0070712_100042560 | Ga0070712_1000425603 | 314 |
| 135 | 3300025915 | Ga0207693_10052099 | Ga0207693_100520992 | 314 |
| 136 | 3300025916 | Ga0207663_10000403 | Ga0207663_100004035 | 314 |
| 137 | 3300025939 | Ga0207665_10269674 | Ga0207665_102696742 | 314 |
| 138 | 3300025940 | Ga0207691_10154645 | Ga0207691_101546452 | 314 |
| 139 | 3300031251 | Ga0265327_10004348 | Ga0265327_100043483 | 314 |
| 140 | 3300048903 | Ga0496100_0006518 | Ga0496100_0006518_3505_4494 | 314 |
| 141 | 3300048918 | Ga0496115_0000241 | Ga0496115_0000241_42456_43445 | 314 |
| 142 | 3300005981 | Ga0081538_10039816 | Ga0081538_100398164 | 315 |
| 143 | 3300032002 | Ga0307416_100014583 | Ga0307416_1000145833 | 315 |
| 144 | 3300032126 | Ga0307415_100019592 | Ga0307415_1000195922 | 315 |
| 145 | 3300044684 | Ga0466966_0118135 | Ga0466966_0118135_370_1365 | 315 |
| 146 | 3300044735 | Ga0466968_0009794 | Ga0466968_0009794_1729_2727 | 315 |
| 147 | 3300044901 | Ga0466960_0043431 | Ga0466960_0043431_770_1774 | 315 |
| 148 | 3300045049 | Ga0466959_0166424 | Ga0466959_0166424_402_1397 | 315 |
| 149 | 3300045976 | Ga0466967_0343679 | Ga0466967_0343679_144_1148 | 315 |
| 150 | 3300025261 | Ga0209233_1005991 | Ga0209233_10059914 | 316 |
| 151 | 3300044901 | Ga0466960_0114287 | Ga0466960_0114287_23_1030 | 316 |
| 152 | 3300047472 | Ga0495686_0002217 | Ga0495686_0002217_3685_4707 | 316 |
| 153 | 3300048915 | Ga0496112_0072452 | Ga0496112_0072452_1442_2446 | 316 |
| 154 | 3300005329 | Ga0070683_100092939 | Ga0070683_1000929393 | 317 |
| 155 | 3300025929 | Ga0207664_10108492 | Ga0207664_101084922 | 317 |
| 156 | 3300026075 | Ga0207708_10016248 | Ga0207708_100162487 | 317 |
| 157 | 3300039450 | Ga0436363_0379843 | Ga0436363_0379843_40_1029 | 317 |
| 158 | 3300042993 | Ga0439440_0018808 | Ga0439440_0018808_148_1137 | 317 |
| 159 | 3300044656 | Ga0466969_0081977 | Ga0466969_0081977_487_1479 | 317 |
| 160 | 3300044684 | Ga0466966_0099452 | Ga0466966_0099452_56_1048 | 317 |
| 161 | 3300045049 | Ga0466959_0004705 | Ga0466959_0004705_5959_6951 | 317 |
| 162 | 3300045049 | Ga0466959_0204496 | Ga0466959_0204496_15_1010 | 317 |
| 163 | 3300045836 | Ga0466958_0100117 | Ga0466958_0100117_365_1357 | 317 |
| 164 | 3300005339 | Ga0070660_100103814 | Ga0070660_1001038143 | 318 |
| 165 | 3300005535 | Ga0070684_100290349 | Ga0070684_1002903492 | 318 |
| 166 | 3300005614 | Ga0068856_100041104 | Ga0068856_1000411043 | 318 |
| 167 | 3300005981 | Ga0081538_10019084 | Ga0081538_100190846 | 318 |
| 168 | 3300021358 | Ga0213873_10045849 | Ga0213873_100458491 | 318 |
| 169 | 3300021377 | Ga0213874_10007424 | Ga0213874_100074243 | 318 |
| 170 | 3300021377 | Ga0213874_10018726 | Ga0213874_100187262 | 318 |
| 171 | 3300021384 | Ga0213876_10039924 | Ga0213876_100399243 | 318 |
| 172 | 3300021384 | Ga0213876_10048202 | Ga0213876_100482022 | 318 |
| 173 | 3300021384 | Ga0213876_10058212 | Ga0213876_100582122 | 318 |
| 174 | 3300021441 | Ga0213871_10029025 | Ga0213871_100290252 | 318 |
| 175 | 3300026078 | Ga0207702_10090121 | Ga0207702_100901212 | 318 |
| 176 | 3300032126 | Ga0307415_100390001 | Ga0307415_1003900011 | 318 |
| 177 | 3300037853 | Ga0436364_0030065 | Ga0436364_0030065_123_1115 | 318 |
| 178 | 3300037853 | Ga0436364_0595302 | Ga0436364_0595302_211_1206 | 318 |
| 179 | 3300037853 | Ga0436364_1048038 | Ga0436364_1048038_1380_2375 | 318 |
| 180 | 3300039437 | Ga0436365_0282749 | Ga0436365_0282749_623_1615 | 318 |
| 181 | 3300039437 | Ga0436365_0575287 | Ga0436365_0575287_392_1387 | 318 |
| 182 | 3300039437 | Ga0436365_0934847 | Ga0436365_0934847_3512_4507 | 318 |
| 183 | 3300039437 | Ga0436365_1561332 | Ga0436365_1561332_531_1526 | 318 |
| 184 | 3300039437 | Ga0436365_1623746 | Ga0436365_1623746_868_1863 | 318 |
| 185 | 3300039438 | Ga0436360_0073838 | Ga0436360_0073838_304_1299 | 318 |
| 186 | 3300039450 | Ga0436363_1147919 | Ga0436363_1147919_9080_10075 | 318 |
| 187 | 3300039453 | Ga0436362_0767539 | Ga0436362_0767539_333_1328 | 318 |
| 188 | 3300044656 | Ga0466969_0081421 | Ga0466969_0081421_321_1316 | 318 |
| 189 | 3300044684 | Ga0466966_0030397 | Ga0466966_0030397_1367_2362 | 318 |
| 190 | 3300044684 | Ga0466966_0040752 | Ga0466966_0040752_305_1300 | 318 |
| 191 | 3300044684 | Ga0466966_0211094 | Ga0466966_0211094_13_1008 | 318 |
| 192 | 3300044693 | Ga0466961_0011934 | Ga0466961_0011934_2931_3926 | 318 |
| 193 | 3300044694 | Ga0466963_0044903 | Ga0466963_0044903_213_1208 | 318 |
| 194 | 3300044694 | Ga0466963_0048790 | Ga0466963_0048790_1255_2250 | 318 |
| 195 | 3300044719 | Ga0466971_0040339 | Ga0466971_0040339_876_1871 | 318 |
| 196 | 3300044719 | Ga0466971_0120746 | Ga0466971_0120746_81_1076 | 318 |
| 197 | 3300044735 | Ga0466968_0088914 | Ga0466968_0088914_40_1035 | 318 |
| 198 | 3300044765 | Ga0466970_0081375 | Ga0466970_0081375_95_1090 | 318 |
| 199 | 3300044842 | Ga0466957_0025625 | Ga0466957_0025625_13_1008 | 318 |
| 200 | 3300044842 | Ga0466957_0077681 | Ga0466957_0077681_304_1299 | 318 |
| 201 | 3300045049 | Ga0466959_0003676 | Ga0466959_0003676_1704_2699 | 318 |
| 202 | 3300045049 | Ga0466959_0019337 | Ga0466959_0019337_849_1844 | 318 |
| 203 | 3300045836 | Ga0466958_0001781 | Ga0466958_0001781_2996_3991 | 318 |
| 204 | 3300045836 | Ga0466958_0004223 | Ga0466958_0004223_1579_2574 | 318 |
| 205 | 3300045836 | Ga0466958_0010518 | Ga0466958_0010518_2007_3002 | 318 |
| 206 | 3300045836 | Ga0466958_0239431 | Ga0466958_0239431_100_1095 | 318 |
| 207 | 3300045976 | Ga0466967_0007780 | Ga0466967_0007780_5264_6259 | 318 |
| 208 | 3300046681 | Ga0495647_0008638 | Ga0495647_0008638_2390_3379 | 318 |
| 209 | 3300047471 | Ga0495684_0076611 | Ga0495684_0076611_1369_2358 | 318 |
| 210 | 3300061719 | Ga0466962_0015826 | Ga0466962_0015826_621_1616 | 318 |
| 211 | 3300005563 | Ga0068855_100195556 | Ga0068855_1001955562 | 319 |
| 212 | 3300005578 | Ga0068854_100154648 | Ga0068854_1001546482 | 319 |
| 213 | 3300005616 | Ga0068852_100240646 | Ga0068852_1002406462 | 319 |
| 214 | 3300025901 | Ga0207688_10103592 | Ga0207688_101035922 | 319 |
| 215 | 3300039450 | Ga0436363_0537558 | Ga0436363_0537558_79_1074 | 319 |
| 216 | 3300039450 | Ga0436363_1410693 | Ga0436363_1410693_94_1089 | 319 |
| 217 | 3300037853 | Ga0436364_0237688 | Ga0436364_0237688_28_1062 | 320 |
| 218 | 3300005347 | Ga0070668_100061633 | Ga0070668_1000616332 | 321 |
| 219 | 3300005356 | Ga0070674_100004685 | Ga0070674_1000046856 | 321 |
| 220 | 3300005364 | Ga0070673_100161745 | Ga0070673_1001617453 | 321 |
| 221 | 3300005543 | Ga0070672_100250323 | Ga0070672_1002503232 | 321 |
| 222 | 3300005842 | Ga0068858_100027277 | Ga0068858_1000272774 | 321 |
| 223 | 3300005843 | Ga0068860_100006307 | Ga0068860_1000063076 | 321 |
| 224 | 3300005843 | Ga0068860_100453531 | Ga0068860_1004535312 | 321 |
| 225 | 3300013306 | Ga0163162_10080345 | Ga0163162_100803453 | 321 |
| 226 | 3300025940 | Ga0207691_10118494 | Ga0207691_101184942 | 321 |
| 227 | 3300026142 | Ga0207698_10363066 | Ga0207698_103630662 | 321 |
| 228 | 3300005366 | Ga0070659_100002129 | Ga0070659_1000021299 | 322 |
| 229 | 3300005530 | Ga0070679_100300623 | Ga0070679_1003006231 | 322 |
| 230 | 3300005614 | Ga0068856_100066865 | Ga0068856_1000668654 | 322 |
| 231 | 3300013105 | Ga0157369_10087964 | Ga0157369_100879643 | 322 |
| 232 | 3300020069 | Ga0197907_10908011 | Ga0197907_109080112 | 322 |
| 233 | 3300025912 | Ga0207707_10310727 | Ga0207707_103107271 | 322 |
| 234 | 3300025919 | Ga0207657_10129949 | Ga0207657_101299492 | 322 |
| 235 | 3300025921 | Ga0207652_10340521 | Ga0207652_103405212 | 322 |
| 236 | 3300026078 | Ga0207702_10104135 | Ga0207702_101041351 | 322 |
| 237 | 3300036401 | Ga0373937_0008559 | Ga0373937_0008559_3989_5008 | 322 |
| 238 | 3300037466 | Ga0395898_0102765 | Ga0395898_0102765_1202_2221 | 322 |
| 239 | 3300045976 | Ga0466967_0124338 | Ga0466967_0124338_630_1649 | 322 |
| 240 | 3300049744 | Ga0501083_0058171 | Ga0501083_0058171_1077_2096 | 322 |
| 241 | 3300005289 | Ga0065704_10096006 | Ga0065704_100960062 | 323 |
| 242 | 3300005290 | Ga0065712_10002607 | Ga0065712_100026073 | 323 |
| 243 | 3300005293 | Ga0065715_10032464 | Ga0065715_100324642 | 323 |
| 244 | 3300005295 | Ga0065707_10131316 | Ga0065707_101313162 | 323 |
| 245 | 3300005328 | Ga0070676_10130014 | Ga0070676_101300142 | 323 |
| 246 | 3300005329 | Ga0070683_100026787 | Ga0070683_1000267874 | 323 |
| 247 | 3300005330 | Ga0070690_100020310 | Ga0070690_1000203102 | 323 |
| 248 | 3300005330 | Ga0070690_100121709 | Ga0070690_1001217092 | 323 |
| 249 | 3300005334 | Ga0068869_100005669 | Ga0068869_1000056693 | 323 |
| 250 | 3300005334 | Ga0068869_100009452 | Ga0068869_1000094522 | 323 |
| 251 | 3300005334 | Ga0068869_100045955 | Ga0068869_1000459552 | 323 |
| 252 | 3300005335 | Ga0070666_10032680 | Ga0070666_100326802 | 323 |
| 253 | 3300005336 | Ga0070680_100002408 | Ga0070680_1000024087 | 323 |
| 254 | 3300005338 | Ga0068868_100020616 | Ga0068868_1000206162 | 323 |
| 255 | 3300005340 | Ga0070689_100086927 | Ga0070689_1000869272 | 323 |
| 256 | 3300005343 | Ga0070687_100040085 | Ga0070687_1000400852 | 323 |
| 257 | 3300005353 | Ga0070669_100001613 | Ga0070669_1000016136 | 323 |
| 258 | 3300005355 | Ga0070671_100001580 | Ga0070671_1000015806 | 323 |
| 259 | 3300005355 | Ga0070671_100035874 | Ga0070671_1000358743 | 323 |
| 260 | 3300005364 | Ga0070673_100038097 | Ga0070673_1000380973 | 323 |
| 261 | 3300005365 | Ga0070688_100007597 | Ga0070688_1000075975 | 323 |
| 262 | 3300005367 | Ga0070667_100233619 | Ga0070667_1002336192 | 323 |
| 263 | 3300005438 | Ga0070701_10007401 | Ga0070701_100074013 | 323 |
| 264 | 3300005440 | Ga0070705_100116898 | Ga0070705_1001168982 | 323 |
| 265 | 3300005441 | Ga0070700_100028151 | Ga0070700_1000281513 | 323 |
| 266 | 3300005444 | Ga0070694_100014238 | Ga0070694_1000142383 | 323 |
| 267 | 3300005458 | Ga0070681_10000100 | Ga0070681_1000010015 | 323 |
| 268 | 3300005459 | Ga0068867_100024849 | Ga0068867_1000248491 | 323 |
| 269 | 3300005466 | Ga0070685_10075954 | Ga0070685_100759542 | 323 |
| 270 | 3300005468 | Ga0070707_100123228 | Ga0070707_1001232283 | 323 |
| 271 | 3300005530 | Ga0070679_100000819 | Ga0070679_10000081910 | 323 |
| 272 | 3300005536 | Ga0070697_100060604 | Ga0070697_1000606043 | 323 |
| 273 | 3300005539 | Ga0068853_100031870 | Ga0068853_1000318704 | 323 |
| 274 | 3300005543 | Ga0070672_100018243 | Ga0070672_1000182433 | 323 |
| 275 | 3300005544 | Ga0070686_100012452 | Ga0070686_1000124524 | 323 |
| 276 | 3300005545 | Ga0070695_100212295 | Ga0070695_1002122951 | 323 |
| 277 | 3300005546 | Ga0070696_100048904 | Ga0070696_1000489042 | 323 |
| 278 | 3300005547 | Ga0070693_100075534 | Ga0070693_1000755342 | 323 |
| 279 | 3300005614 | Ga0068856_100019645 | Ga0068856_1000196453 | 323 |
| 280 | 3300005615 | Ga0070702_100012309 | Ga0070702_1000123093 | 323 |
| 281 | 3300005618 | Ga0068864_100010017 | Ga0068864_1000100176 | 323 |
| 282 | 3300005618 | Ga0068864_100067381 | Ga0068864_1000673812 | 323 |
| 283 | 3300005718 | Ga0068866_10010069 | Ga0068866_100100692 | 323 |
| 284 | 3300005719 | Ga0068861_100196386 | Ga0068861_1001963862 | 323 |
| 285 | 3300005834 | Ga0068851_10092917 | Ga0068851_100929171 | 323 |
| 286 | 3300005841 | Ga0068863_100037389 | Ga0068863_1000373892 | 323 |
| 287 | 3300005842 | Ga0068858_100067147 | Ga0068858_1000671472 | 323 |
| 288 | 3300005844 | Ga0068862_100052886 | Ga0068862_1000528863 | 323 |
| 289 | 3300006237 | Ga0097621_100008887 | Ga0097621_1000088873 | 323 |
| 290 | 3300006237 | Ga0097621_100026436 | Ga0097621_1000264362 | 323 |
| 291 | 3300006358 | Ga0068871_100019002 | Ga0068871_1000190023 | 323 |
| 292 | 3300006844 | Ga0075428_100087047 | Ga0075428_1000870472 | 323 |
| 293 | 3300006844 | Ga0075428_100271474 | Ga0075428_1002714742 | 323 |
| 294 | 3300006852 | Ga0075433_10042928 | Ga0075433_100429282 | 323 |
| 295 | 3300006880 | Ga0075429_100052445 | Ga0075429_1000524452 | 323 |
| 296 | 3300006881 | Ga0068865_100009196 | Ga0068865_1000091964 | 323 |
| 297 | 3300009098 | Ga0105245_10031318 | Ga0105245_100313183 | 323 |
| 298 | 3300009147 | Ga0114129_10014519 | Ga0114129_100145195 | 323 |
| 299 | 3300009148 | Ga0105243_10014777 | Ga0105243_100147774 | 323 |
| 300 | 3300009148 | Ga0105243_10180766 | Ga0105243_101807662 | 323 |
| 301 | 3300009174 | Ga0105241_10070007 | Ga0105241_100700072 | 323 |
| 302 | 3300009176 | Ga0105242_10025407 | Ga0105242_100254072 | 323 |
| 303 | 3300009177 | Ga0105248_10121267 | Ga0105248_101212672 | 323 |
| 304 | 3300009177 | Ga0105248_10247519 | Ga0105248_102475192 | 323 |
| 305 | 3300009553 | Ga0105249_10095926 | Ga0105249_100959263 | 323 |
| 306 | 3300010375 | Ga0105239_10077267 | Ga0105239_100772672 | 323 |
| 307 | 3300011119 | Ga0105246_10066906 | Ga0105246_100669063 | 323 |
| 308 | 3300013297 | Ga0157378_10021461 | Ga0157378_100214612 | 323 |
| 309 | 3300013297 | Ga0157378_10061116 | Ga0157378_100611163 | 323 |
| 310 | 3300013297 | Ga0157378_10201356 | Ga0157378_102013562 | 323 |
| 311 | 3300013306 | Ga0163162_10498448 | Ga0163162_104984482 | 323 |
| 312 | 3300013306 | Ga0163162_10590644 | Ga0163162_105906441 | 323 |
| 313 | 3300014325 | Ga0163163_10015670 | Ga0163163_100156705 | 323 |
| 314 | 3300014325 | Ga0163163_10024482 | Ga0163163_100244824 | 323 |
| 315 | 3300014326 | Ga0157380_10005498 | Ga0157380_100054982 | 323 |
| 316 | 3300014745 | Ga0157377_10030363 | Ga0157377_100303632 | 323 |
| 317 | 3300014969 | Ga0157376_10004147 | Ga0157376_100041472 | 323 |
| 318 | 3300017792 | Ga0163161_10010034 | Ga0163161_100100343 | 323 |
| 319 | 3300025254 | Ga0209148_1000660 | Ga0209148_100066023 | 323 |
| 320 | 3300025272 | Ga0209455_1001949 | Ga0209455_10019496 | 323 |
| 321 | 3300025315 | Ga0207697_10004860 | Ga0207697_100048604 | 323 |
| 322 | 3300025901 | Ga0207688_10022756 | Ga0207688_100227563 | 323 |
| 323 | 3300025903 | Ga0207680_10162850 | Ga0207680_101628502 | 323 |
| 324 | 3300025903 | Ga0207680_10185772 | Ga0207680_101857722 | 323 |
| 325 | 3300025907 | Ga0207645_10142014 | Ga0207645_101420142 | 323 |
| 326 | 3300025911 | Ga0207654_10132528 | Ga0207654_101325282 | 323 |
| 327 | 3300025912 | Ga0207707_10000028 | Ga0207707_1000002814 | 323 |
| 328 | 3300025918 | Ga0207662_10212155 | Ga0207662_102121552 | 323 |
| 329 | 3300025921 | Ga0207652_10001456 | Ga0207652_1000145613 | 323 |
| 330 | 3300025922 | Ga0207646_10107049 | Ga0207646_101070492 | 323 |
| 331 | 3300025923 | Ga0207681_10021108 | Ga0207681_100211083 | 323 |
| 332 | 3300025926 | Ga0207659_10340751 | Ga0207659_103407512 | 323 |
| 333 | 3300025931 | Ga0207644_10051680 | Ga0207644_100516802 | 323 |
| 334 | 3300025931 | Ga0207644_10056131 | Ga0207644_100561312 | 323 |
| 335 | 3300025933 | Ga0207706_10069412 | Ga0207706_100694122 | 323 |
| 336 | 3300025934 | Ga0207686_10037691 | Ga0207686_100376912 | 323 |
| 337 | 3300025936 | Ga0207670_10058663 | Ga0207670_100586632 | 323 |
| 338 | 3300025938 | Ga0207704_10127450 | Ga0207704_101274502 | 323 |
| 339 | 3300025940 | Ga0207691_10002179 | Ga0207691_100021792 | 323 |
| 340 | 3300025941 | Ga0207711_10011584 | Ga0207711_100115847 | 323 |
| 341 | 3300025941 | Ga0207711_10067488 | Ga0207711_100674882 | 323 |
| 342 | 3300025942 | Ga0207689_10009911 | Ga0207689_100099117 | 323 |
| 343 | 3300025942 | Ga0207689_10036738 | Ga0207689_100367383 | 323 |
| 344 | 3300025942 | Ga0207689_10042553 | Ga0207689_100425532 | 323 |
| 345 | 3300025942 | Ga0207689_10117890 | Ga0207689_101178902 | 323 |
| 346 | 3300025944 | Ga0207661_10005005 | Ga0207661_100050053 | 323 |
| 347 | 3300025945 | Ga0207679_10123682 | Ga0207679_101236822 | 323 |
| 348 | 3300025986 | Ga0207658_10055458 | Ga0207658_100554581 | 323 |
| 349 | 3300026075 | Ga0207708_10004271 | Ga0207708_100042713 | 323 |
| 350 | 3300026088 | Ga0207641_10412116 | Ga0207641_104121161 | 323 |
| 351 | 3300026095 | Ga0207676_10006578 | Ga0207676_100065782 | 323 |
| 352 | 3300026095 | Ga0207676_10282923 | Ga0207676_102829231 | 323 |
| 353 | 3300026118 | Ga0207675_100020009 | Ga0207675_1000200092 | 323 |
| 354 | 3300026121 | Ga0207683_10440666 | Ga0207683_104406662 | 323 |
| 355 | 3300028379 | Ga0268266_10133736 | Ga0268266_101337362 | 323 |
| 356 | 3300028380 | Ga0268265_10047868 | Ga0268265_100478682 | 323 |
| 357 | 3300028381 | Ga0268264_10140613 | Ga0268264_101406133 | 323 |
| 358 | 3300036401 | Ga0373937_0208189 | Ga0373937_0208189_535_1551 | 323 |
| 359 | 3300038996 | Ga0242420_003553 | Ga0242420_003553_432_1448 | 323 |
| 360 | 3300046472 | Ga0495580_0108013 | Ga0495580_0108013_167_1183 | 323 |
| 361 | 3300048907 | Ga0496104_0054491 | Ga0496104_0054491_2432_3448 | 323 |
| 362 | 3300048909 | Ga0496106_0178938 | Ga0496106_0178938_75_1091 | 323 |
| 363 | 3300048911 | Ga0496108_0112658 | Ga0496108_0112658_748_1764 | 323 |
| 364 | 3300050507 | nmdc:mga05p37_84672_c1 | nmdc:mga05p37_84672_c1_1773_2789 | 323 |
| 365 | 3300050508 | nmdc:mga09592_47713_c1 | nmdc:mga09592_47713_c1_2038_3054 | 323 |
| 366 | 3300050512 | nmdc:mga0n895_304026_c1 | nmdc:mga0n895_304026_c1_19_1035 | 323 |
| 367 | 3300050515 | nmdc:mga0a205_12842_c1 | nmdc:mga0a205_12842_c1_3522_4538 | 323 |
| 368 | 3300050515 | nmdc:mga0a205_24376_c1 | nmdc:mga0a205_24376_c1_1227_2243 | 323 |
| 369 | 3300009147 | Ga0114129_10002234 | Ga0114129_1000223423 | 324 |
| 370 | 3300050507 | nmdc:mga05p37_31200_c1 | nmdc:mga05p37_31200_c1_3205_4221 | 324 |
| 371 | 3300005330 | Ga0070690_100066873 | Ga0070690_1000668733 | 325 |
| 372 | 3300005438 | Ga0070701_10101209 | Ga0070701_101012091 | 325 |
| 373 | 3300005518 | Ga0070699_100006468 | Ga0070699_1000064688 | 325 |
| 374 | 3300005518 | Ga0070699_100015295 | Ga0070699_1000152952 | 325 |
| 375 | 3300013306 | Ga0163162_10026770 | Ga0163162_100267705 | 325 |
| 376 | 3300025912 | Ga0207707_10025765 | Ga0207707_100257654 | 325 |
| 377 | 3300041997 | Ga0439431_0024046 | Ga0439431_0024046_19_996 | 325 |
| 378 | iso_pu_bacteria | 2831905167 | 2831906551 | 325 |
| 379 | iso_pu_bacteria | 2548877040 | 2550904854 | 326 |
| 380 | iso_pu_bacteria | 2571042143 | 2571527341 | 326 |
| 381 | iso_pu_bacteria | 2576861424 | 2578335874 | 326 |
| 382 | iso_pu_bacteria | 2600255286 | 2601639586 | 326 |
| 383 | iso_pu_bacteria | 2728368933 | 2728532355 | 326 |
| 384 | iso_pu_bacteria | 2881636855 | 2881640782 | 326 |
| 385 | iso_pu_bacteria | 2888578766 | 2888583685 | 326 |
| 386 | iso_pu_bacteria | 2904113452 | 2904119730 | 326 |
| 387 | iso_pu_bacteria | 2907202186 | 2907204518 | 326 |
| 388 | iso_pu_bacteria | 2968558590 | 2968561057 | 326 |
| 389 | iso_pu_bacteria | 2971511577 | 2971514746 | 326 |
| 390 | iso_pu_bacteria | 2980176882 | 2980180854 | 326 |
| 391 | iso_pu_bacteria | 2988225383 | 2988228715 | 326 |
| 392 | iso_pu_bacteria | 2996632988 | 2996636179 | 326 |
| 393 | iso_pu_bacteria | 8054465665 | 8054466751 | 326 |
| 394 | iso_pu_bacteria | 8057733483 | 8057734472 | 326 |
| 395 | 3300005458 | Ga0070681_10082520 | Ga0070681_100825202 | 327 |
| 396 | 3300031251 | Ga0265327_10034325 | Ga0265327_100343253 | 327 |
| 397 | 3300031727 | Ga0316576_10112307 | Ga0316576_101123073 | 327 |
| 398 | 3300048911 | Ga0496108_0435165 | Ga0496108_0435165_96_1100 | 327 |
| 399 | 3300005331 | Ga0070670_100120384 | Ga0070670_1001203841 | 328 |
| 400 | 3300005336 | Ga0070680_100011371 | Ga0070680_1000113716 | 328 |
| 401 | 3300005339 | Ga0070660_100173681 | Ga0070660_1001736811 | 328 |
| 402 | 3300005340 | Ga0070689_100380039 | Ga0070689_1003800391 | 328 |
| 403 | 3300005364 | Ga0070673_100151694 | Ga0070673_1001516943 | 328 |
| 404 | 3300005366 | Ga0070659_100024585 | Ga0070659_1000245854 | 328 |
| 405 | 3300005457 | Ga0070662_100075229 | Ga0070662_1000752292 | 328 |
| 406 | 3300005458 | Ga0070681_10009949 | Ga0070681_100099492 | 328 |
| 407 | 3300005535 | Ga0070684_100143700 | Ga0070684_1001437002 | 328 |
| 408 | 3300005539 | Ga0068853_100010775 | Ga0068853_1000107755 | 328 |
| 409 | 3300005564 | Ga0070664_100011274 | Ga0070664_1000112743 | 328 |
| 410 | 3300005577 | Ga0068857_100022785 | Ga0068857_1000227853 | 328 |
| 411 | 3300013100 | Ga0157373_10040457 | Ga0157373_100404573 | 328 |
| 412 | 3300014325 | Ga0163163_10090075 | Ga0163163_100900752 | 328 |
| 413 | 3300025912 | Ga0207707_10018373 | Ga0207707_100183735 | 328 |
| 414 | 3300025917 | Ga0207660_10176589 | Ga0207660_101765891 | 328 |
| 415 | 3300025919 | Ga0207657_10176329 | Ga0207657_101763292 | 328 |
| 416 | 3300025920 | Ga0207649_10125483 | Ga0207649_101254832 | 328 |
| 417 | 3300025932 | Ga0207690_10015288 | Ga0207690_100152883 | 328 |
| 418 | 3300025936 | Ga0207670_10251564 | Ga0207670_102515641 | 328 |
| 419 | 3300025945 | Ga0207679_10188564 | Ga0207679_101885642 | 328 |
| 420 | 3300026041 | Ga0207639_10027229 | Ga0207639_100272292 | 328 |
| 421 | 3300026116 | Ga0207674_10002025 | Ga0207674_1000202510 | 328 |
| 422 | 3300005437 | Ga0070710_10124254 | Ga0070710_101242541 | 329 |
| 423 | 3300005937 | Ga0081455_10080221 | Ga0081455_100802212 | 329 |
| 424 | 3300025898 | Ga0207692_10078558 | Ga0207692_100785582 | 329 |
| 425 | 3300005437 | Ga0070710_10002233 | Ga0070710_100022334 | 330 |
| 426 | 3300009094 | Ga0111539_10005862 | Ga0111539_1000586211 | 330 |
| 427 | 3300021388 | Ga0213875_10046844 | Ga0213875_100468441 | 330 |
| 428 | 3300025915 | Ga0207693_10000318 | Ga0207693_1000031822 | 330 |
| 429 | 3300025916 | Ga0207663_10140002 | Ga0207663_101400022 | 330 |
| 430 | 3300025928 | Ga0207700_10144911 | Ga0207700_101449112 | 330 |
| 431 | 3300027907 | Ga0207428_10127532 | Ga0207428_101275322 | 330 |
| 432 | 3300035724 | Ga0373933_0008354 | Ga0373933_0008354_17_1012 | 330 |
| 433 | 3300036401 | Ga0373937_0033200 | Ga0373937_0033200_3326_4321 | 330 |
| 434 | 3300036401 | Ga0373937_0212098 | Ga0373937_0212098_74_1072 | 330 |
| 435 | 3300037853 | Ga0436364_0271519 | Ga0436364_0271519_151_1146 | 330 |
| 436 | 3300037853 | Ga0436364_0445774 | Ga0436364_0445774_2713_3708 | 330 |
| 437 | 3300039437 | Ga0436365_0538543 | Ga0436365_0538543_795_1790 | 330 |
| 438 | 3300039450 | Ga0436363_0705637 | Ga0436363_0705637_66_1061 | 330 |
| 439 | 3300039450 | Ga0436363_1339971 | Ga0436363_1339971_4489_5484 | 330 |
| 440 | 3300044656 | Ga0466969_0013288 | Ga0466969_0013288_2269_3264 | 330 |
| 441 | 3300044694 | Ga0466963_0014264 | Ga0466963_0014264_559_1554 | 330 |
| 442 | 3300044694 | Ga0466963_0019687 | Ga0466963_0019687_1861_2856 | 330 |
| 443 | 3300044765 | Ga0466970_0018802 | Ga0466970_0018802_1865_2860 | 330 |
| 444 | 3300045049 | Ga0466959_0002972 | Ga0466959_0002972_1732_2727 | 330 |
| 445 | 3300045976 | Ga0466967_0008112 | Ga0466967_0008112_3015_4010 | 330 |
| 446 | 3300046462 | Ga0495651_0019189 | Ga0495651_0019189_3030_4025 | 330 |
| 447 | 3300046463 | Ga0495653_0043766 | Ga0495653_0043766_1323_2318 | 330 |
| 448 | 3300046477 | Ga0495664_0087972 | Ga0495664_0087972_164_1159 | 330 |
| 449 | 3300046511 | Ga0495608_0019074 | Ga0495608_0019074_1302_2297 | 330 |
| 450 | 3300046517 | Ga0495630_0146197 | Ga0495630_0146197_423_1418 | 330 |
| 451 | 3300046529 | Ga0495652_0057374 | Ga0495652_0057374_1906_2901 | 330 |
| 452 | 3300046536 | Ga0495587_0069140 | Ga0495587_0069140_908_1903 | 330 |
| 453 | 3300046559 | Ga0495667_0023983 | Ga0495667_0023983_2037_3032 | 330 |
| 454 | 3300046663 | Ga0495635_0053247 | Ga0495635_0053247_251_1246 | 330 |
| 455 | 3300046675 | Ga0495657_0047966 | Ga0495657_0047966_553_1548 | 330 |
| 456 | 3300046680 | Ga0495646_0009781 | Ga0495646_0009781_4655_5650 | 330 |
| 457 | 3300047317 | Ga0495604_0165329 | Ga0495604_0165329_421_1416 | 330 |
| 458 | 3300047322 | Ga0495680_0026856 | Ga0495680_0026856_3227_4222 | 330 |
| 459 | 3300047472 | Ga0495686_0050119 | Ga0495686_0050119_334_1332 | 330 |
| 460 | 3300047673 | Ga0495593_0102753 | Ga0495593_0102753_392_1387 | 330 |
| 461 | 3300048088 | Ga0495602_0006880 | Ga0495602_0006880_9542_10537 | 330 |
| 462 | 3300048904 | Ga0496101_0046537 | Ga0496101_0046537_1339_2334 | 330 |
| 463 | 3300048907 | Ga0496104_0036380 | Ga0496104_0036380_2494_3489 | 330 |
| 464 | 3300048913 | Ga0496110_0315758 | Ga0496110_0315758_397_1392 | 330 |
| 465 | 3300048914 | Ga0496111_0069275 | Ga0496111_0069275_1230_2225 | 330 |
| 466 | 3300048916 | Ga0496113_0125312 | Ga0496113_0125312_26_1021 | 330 |
| 467 | 3300048917 | Ga0496114_0054971 | Ga0496114_0054971_425_1420 | 330 |
| 468 | 3300048918 | Ga0496115_0172453 | Ga0496115_0172453_397_1392 | 330 |
| 469 | 3300050511 | nmdc:mga08y16_97731_c1 | nmdc:mga08y16_97731_c1_907_1923 | 330 |
| 470 | 3300053077 | Ga0495601_0031787 | Ga0495601_0031787_1624_2619 | 330 |
| 471 | 3300053085 | Ga0495619_0010545 | Ga0495619_0010545_4247_5242 | 330 |
| 472 | 3300005366 | Ga0070659_100121512 | Ga0070659_1001215122 | 331 |
| 473 | 3300009148 | Ga0105243_10029250 | Ga0105243_100292503 | 331 |
| 474 | 3300025932 | Ga0207690_10092340 | Ga0207690_100923402 | 331 |
| 475 | 3300025935 | Ga0207709_10008475 | Ga0207709_100084753 | 331 |
| 476 | 3300026089 | Ga0207648_10019959 | Ga0207648_100199595 | 331 |
| 477 | 3300050491 | nmdc:mga00v17_133220_c1 | nmdc:mga00v17_133220_c1_543_1544 | 331 |
| 478 | 3300005842 | Ga0068858_100261606 | Ga0068858_1002616062 | 332 |
| 479 | 3300025941 | Ga0207711_10217929 | Ga0207711_102179292 | 332 |
| 480 | 3300031691 | Ga0316579_10011676 | Ga0316579_100116763 | 332 |
| 481 | 3300035398 | Ga0316574_0051177 | Ga0316574_0051177_832_1830 | 332 |
| 482 | 3300045836 | Ga0466958_0040734 | Ga0466958_0040734_105_1181 | 332 |
| 483 | 3300048916 | Ga0496113_0161262 | Ga0496113_0161262_16_1032 | 332 |
| 484 | 3300005331 | Ga0070670_100306795 | Ga0070670_1003067952 | 334 |
| 485 | 3300025925 | Ga0207650_10076882 | Ga0207650_100768822 | 334 |
| 486 | iso_pu_bacteria | 2558860983 | 2561468977 | 334 |
| 487 | iso_pu_bacteria | 2909399089 | 2909399500 | 334 |
| 488 | iso_pu_bacteria | 2917554339 | 2917557230 | 334 |
| 489 | iso_pu_bacteria | 641228493 | 641333991 | 334 |
| 490 | iso_pu_bacteria | 643348555 | 643391308 | 334 |
| 491 | 3300005549 | Ga0070704_100432237 | Ga0070704_1004322371 | 336 |
| 492 | 3300005985 | Ga0081539_10000508 | Ga0081539_100005087 | 336 |
| 493 | 3300025939 | Ga0207665_10087381 | Ga0207665_100873812 | 337 |
| 494 | 3300002076 | JGI24749J21850_1006202 | JGI24749J21850_10062022 | 338 |
| 495 | 3300002459 | JGI24751J29686_10000033 | JGI24751J29686_1000003352 | 338 |
| 496 | 3300005290 | Ga0065712_10085068 | Ga0065712_100850682 | 338 |
| 497 | 3300005293 | Ga0065715_10003712 | Ga0065715_100037123 | 338 |
| 498 | 3300005293 | Ga0065715_10172168 | Ga0065715_101721681 | 338 |
| 499 | 3300005327 | Ga0070658_10021878 | Ga0070658_100218784 | 338 |
| 500 | 3300005331 | Ga0070670_100000142 | Ga0070670_10000014212 | 338 |
| 501 | 3300005334 | Ga0068869_100176394 | Ga0068869_1001763941 | 338 |
| 502 | 3300005337 | Ga0070682_100046342 | Ga0070682_1000463422 | 338 |
| 503 | 3300005345 | Ga0070692_10012645 | Ga0070692_100126453 | 338 |
| 504 | 3300005441 | Ga0070700_100042291 | Ga0070700_1000422911 | 338 |
| 505 | 3300005468 | Ga0070707_100004557 | Ga0070707_1000045572 | 338 |
| 506 | 3300005471 | Ga0070698_100026846 | Ga0070698_1000268462 | 338 |
| 507 | 3300005539 | Ga0068853_100521222 | Ga0068853_1005212221 | 338 |
| 508 | 3300005549 | Ga0070704_100113277 | Ga0070704_1001132771 | 338 |
| 509 | 3300005578 | Ga0068854_100026868 | Ga0068854_1000268683 | 338 |
| 510 | 3300005578 | Ga0068854_100173123 | Ga0068854_1001731232 | 338 |
| 511 | 3300005617 | Ga0068859_100020140 | Ga0068859_1000201405 | 338 |
| 512 | 3300005617 | Ga0068859_100026381 | Ga0068859_1000263812 | 338 |
| 513 | 3300005617 | Ga0068859_100261534 | Ga0068859_1002615342 | 338 |
| 514 | 3300005618 | Ga0068864_100190398 | Ga0068864_1001903982 | 338 |
| 515 | 3300005618 | Ga0068864_100210056 | Ga0068864_1002100562 | 338 |
| 516 | 3300005843 | Ga0068860_100050865 | Ga0068860_1000508654 | 338 |
| 517 | 3300005843 | Ga0068860_100087896 | Ga0068860_1000878962 | 338 |
| 518 | 3300005843 | Ga0068860_100108354 | Ga0068860_1001083541 | 338 |
| 519 | 3300005844 | Ga0068862_100333216 | Ga0068862_1003332162 | 338 |
| 520 | 3300005985 | Ga0081539_10002393 | Ga0081539_1000239323 | 338 |
| 521 | 3300006051 | Ga0075364_10098589 | Ga0075364_100985892 | 338 |
| 522 | 3300006846 | Ga0075430_100019767 | Ga0075430_1000197675 | 338 |
| 523 | 3300006846 | Ga0075430_100162599 | Ga0075430_1001625992 | 338 |
| 524 | 3300006931 | Ga0097620_100020141 | Ga0097620_1000201415 | 338 |
| 525 | 3300006931 | Ga0097620_100026381 | Ga0097620_1000263814 | 338 |
| 526 | 3300006931 | Ga0097620_100261524 | Ga0097620_1002615242 | 338 |
| 527 | 3300009094 | Ga0111539_10004239 | Ga0111539_1000423911 | 338 |
| 528 | 3300009101 | Ga0105247_10000940 | Ga0105247_1000094012 | 338 |
| 529 | 3300009147 | Ga0114129_10452895 | Ga0114129_104528952 | 338 |
| 530 | 3300009176 | Ga0105242_10060882 | Ga0105242_100608822 | 338 |
| 531 | 3300009177 | Ga0105248_10076243 | Ga0105248_100762432 | 338 |
| 532 | 3300009545 | Ga0105237_10233320 | Ga0105237_102333202 | 338 |
| 533 | 3300009551 | Ga0105238_10013757 | Ga0105238_100137575 | 338 |
| 534 | 3300013306 | Ga0163162_10426979 | Ga0163162_104269791 | 338 |
| 535 | 3300013307 | Ga0157372_10359897 | Ga0157372_103598972 | 338 |
| 536 | 3300014325 | Ga0163163_10000333 | Ga0163163_100003337 | 338 |
| 537 | 3300025900 | Ga0207710_10001235 | Ga0207710_1000123512 | 338 |
| 538 | 3300025904 | Ga0207647_10035570 | Ga0207647_100355703 | 338 |
| 539 | 3300025908 | Ga0207643_10035840 | Ga0207643_100358403 | 338 |
| 540 | 3300025908 | Ga0207643_10051910 | Ga0207643_100519102 | 338 |
| 541 | 3300025913 | Ga0207695_10233495 | Ga0207695_102334952 | 338 |
| 542 | 3300025922 | Ga0207646_10002372 | Ga0207646_100023723 | 338 |
| 543 | 3300025924 | Ga0207694_10007727 | Ga0207694_100077273 | 338 |
| 544 | 3300025924 | Ga0207694_10027497 | Ga0207694_100274973 | 338 |
| 545 | 3300025925 | Ga0207650_10000046 | Ga0207650_1000004650 | 338 |
| 546 | 3300025934 | Ga0207686_10032073 | Ga0207686_100320732 | 338 |
| 547 | 3300025942 | Ga0207689_10079236 | Ga0207689_100792362 | 338 |
| 548 | 3300025960 | Ga0207651_10253147 | Ga0207651_102531471 | 338 |
| 549 | 3300026075 | Ga0207708_10026319 | Ga0207708_100263193 | 338 |
| 550 | 3300026075 | Ga0207708_10044244 | Ga0207708_100442442 | 338 |
| 551 | 3300026088 | Ga0207641_10114736 | Ga0207641_101147362 | 338 |
| 552 | 3300026116 | Ga0207674_10368376 | Ga0207674_103683761 | 338 |
| 553 | 3300026118 | Ga0207675_100006381 | Ga0207675_1000063813 | 338 |
| 554 | 3300026118 | Ga0207675_100119053 | Ga0207675_1001190532 | 338 |
| 555 | 3300027907 | Ga0207428_10009788 | Ga0207428_100097883 | 338 |
| 556 | 3300028380 | Ga0268265_10191454 | Ga0268265_101914541 | 338 |
| 557 | 3300028381 | Ga0268264_10062848 | Ga0268264_100628482 | 338 |
| 558 | 3300028577 | Ga0265318_10033209 | Ga0265318_100332092 | 338 |
| 559 | 3300038996 | Ga0242420_001887 | Ga0242420_001887_1396_2412 | 338 |
| 560 | 3300041496 | Ga0451839_0056850 | Ga0451839_0056850_253_1311 | 338 |
| 561 | 3300047322 | Ga0495680_0091922 | Ga0495680_0091922_46_1116 | 338 |
| 562 | 3300048915 | Ga0496112_0251503 | Ga0496112_0251503_326_1342 | 338 |
| 563 | 3300049570 | Ga0501033_0000050 | Ga0501033_0000050_47717_48736 | 338 |
| 564 | 3300050507 | nmdc:mga05p37_275865_c1 | nmdc:mga05p37_275865_c1_25_1041 | 338 |
| 565 | 3300050509 | nmdc:mga0qj67_66473_c1 | nmdc:mga0qj67_66473_c1_1367_2383 | 338 |
| 566 | 3300050510 | nmdc:mga06r32_165414_c1 | nmdc:mga06r32_165414_c1_143_1159 | 338 |
| 567 | 3300053108 | Ga0500562_003616 | Ga0500562_003616_2327_3508 | 338 |
| 568 | 3300053161 | Ga0500634_0000015 | Ga0500634_0000015_91037_92056 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6l2i-assembly1.cif.gz_B | ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_wt | 0.985 | 1 | 323 |
| 8ep7-assembly1.cif.gz_A-2 | crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with nadp | 0.9838 | 2 | 323 |
| 5yeq-assembly1.cif.gz_B | the structure of sac-kari protein | 0.9821 | 1 | 324 |
| 6l2k-assembly1.cif.gz_B | ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_r49e | 0.9803 | 1 | 325 |
| 6l2i-assembly1.cif.gz_B | ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_wt | 0.979 | 1 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKJ7_1_183_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9948 | 1 | 181 | 3.40.50.720 |
| 4xdyB02 | Special;Helix non-globular;ProC C-terminal domain-like fold; | 0.9867 | 182 | 322 | 6.10.240.10 |
| 4xdyA02 | Special;Helix non-globular;ProC C-terminal domain-like fold; | 0.986 | 182 | 322 | 6.10.240.10 |
| af_P9WKJ7_184_337_6.10.240.10 | Special;Helix non-globular;ProC C-terminal domain-like fold; | 0.9853 | 182 | 327 | 6.10.240.10 |
| 4xiyA02 | Special;Helix non-globular;ProC C-terminal domain-like fold; | 0.9852 | 182 | 327 | 6.10.240.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1B4K2-F1-model_v4 | deleted | 0.9995 | 14 | 93 |
|
| AF-A0A3D4NM10-F1-model_v4 | Ketol-acid reductoisomerase (EC 1.1.1.86) | 0.9969 | 106 | 194 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0016853 GO:0046872 |
| AF-A0A6V8P8H2-F1-model_v4 | Ketol-acid reductoisomerase | 0.9968 | 102 | 195 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0016853 |
| AF-W1XVF2-F1-model_v4 | Ketol-acid reductoisomerase | 0.9963 | 107 | 196 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0016853 |
| AF-A0A7C5RA88-F1-model_v4 | Ketol-acid reductoisomerase (EC 1.1.1.86) | 0.9961 | 1 | 198 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar