F464663

General Info

Members Datasets Scaffolds Average Seq Length
568 306 546 323

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0040734|Ga0466958_0040734_105_1181
Length 358
Sequence MSAGKSAECAIRAPEGTGRGSPDSLSSMFYDDDADLGKLDGKTVAIIGYGSQGHAHALNLKDSGVEVVVGLRADSRSVDKAQAHGLRVLEPADAASLGDVVMMLVPDELHRQVWESGVQDGVAPGNLLMFGHGFSIHYGEIVPPPEVDVALVAPKGPGHLVRRQYLEGSGVPGLVAVEQDASGDALQIALAYAKGIGCTRGGVIETTFKDETETDLFGEQAVLCGGVTELVRAGYETLTDAGYDPRLAYFECLHELKLIVDLMYEKGISGMRYSISNTAEYGDMTRGKRIISDATRQAMKEILGEIQSGAFAREWIAENRAGQESFKRMREEQAGHRVELVGQELRAQMDWIDTEFAE

Samples

Sample ID Description Type Environment
1 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
2 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
3 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
4 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
5 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
6 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
7 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
8 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
9 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
10 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
11 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
12 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
13 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
14 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
15 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
16 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
17 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
18 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
198 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
199 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
220 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
300 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
304 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
305 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
306 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 0.18
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 7.22
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1006202 3300002076 Bacteria 1666
2 JGI24751J29686_10000033 3300002459 Bacteria 87652
3 Ga0065704_10096006 3300005289 Bacteria 2462
4 Ga0065712_10002607 3300005290 Bacteria 7546
5 Ga0065712_10085068 3300005290 Bacteria 2690
6 Ga0065715_10003712 3300005293 Bacteria 4074
7 Ga0065715_10032464 3300005293 Bacteria 1325
8 Ga0065715_10172168 3300005293 Bacteria 1527
9 Ga0065707_10131316 3300005295 Bacteria 1915
10 Ga0070658_10021878 3300005327 Bacteria 5127
11 Ga0070676_10130014 3300005328 Bacteria 1591
12 Ga0070683_100026787 3300005329 Bacteria 5194
13 Ga0070683_100030796 3300005329 Bacteria 4875
14 Ga0070683_100092939 3300005329 Bacteria 2833
15 Ga0070690_100020310 3300005330 Bacteria 4046
16 Ga0070690_100066873 3300005330 Bacteria 2327
17 Ga0070690_100121709 3300005330 Bacteria 1752
18 Ga0070670_100000142 3300005331 Bacteria 67444
19 Ga0070670_100055127 3300005331 Bacteria 3412
20 Ga0070670_100120384 3300005331 Bacteria 2264
21 Ga0070670_100306795 3300005331 Bacteria 1389
22 Ga0068869_100005669 3300005334 Bacteria 7872
23 Ga0068869_100009452 3300005334 Bacteria 6327
24 Ga0068869_100045955 3300005334 Bacteria 3146
25 Ga0068869_100176394 3300005334 Bacteria 1673
26 Ga0070666_10024439 3300005335 Bacteria 3936
27 Ga0070666_10032680 3300005335 Bacteria 3438
28 Ga0070680_100002408 3300005336 Bacteria 13849
29 Ga0070680_100011371 3300005336 Bacteria 6884
30 Ga0070680_100088572 3300005336 Bacteria 2560
31 Ga0070682_100009728 3300005337 Bacteria 5444
32 Ga0070682_100046342 3300005337 Bacteria 2697
33 Ga0068868_100020616 3300005338 Bacteria 4956
34 Ga0070660_100023500 3300005339 Bacteria 4566
35 Ga0070660_100103814 3300005339 Bacteria 2254
36 Ga0070660_100173681 3300005339 Bacteria 1741
37 Ga0070689_100086927 3300005340 Bacteria 2459
38 Ga0070689_100380039 3300005340 Bacteria 1190
39 Ga0070687_100040085 3300005343 Bacteria 2358
40 Ga0070692_10012645 3300005345 Bacteria 3915
41 Ga0070668_100061633 3300005347 Bacteria 2906
42 Ga0070669_100001613 3300005353 Bacteria 16302
43 Ga0070675_100043116 3300005354 Bacteria 3686
44 Ga0070671_100001580 3300005355 Bacteria 17138
45 Ga0070671_100001660 3300005355 Bacteria 16835
46 Ga0070671_100035874 3300005355 Bacteria 4110
47 Ga0070671_100078675 3300005355 Bacteria 2756
48 Ga0070674_100004685 3300005356 Bacteria 7819
49 Ga0070673_100038097 3300005364 Bacteria 3669
50 Ga0070673_100151694 3300005364 Bacteria 1963
51 Ga0070673_100161745 3300005364 Bacteria 1905
52 Ga0070688_100007597 3300005365 Bacteria 5852
53 Ga0070659_100002129 3300005366 Bacteria 14109
54 Ga0070659_100024585 3300005366 Bacteria 4618
55 Ga0070659_100121512 3300005366 Bacteria 2116
56 Ga0070667_100082972 3300005367 Bacteria 2745
57 Ga0070667_100233619 3300005367 Bacteria 1640
58 Ga0070709_10090090 3300005434 Bacteria 2021
59 Ga0070710_10002233 3300005437 Bacteria 9158
60 Ga0070710_10124254 3300005437 Bacteria 1566
61 Ga0070701_10007401 3300005438 Bacteria 4689
62 Ga0070701_10101209 3300005438 Bacteria 1596
63 Ga0070711_100051072 3300005439 Bacteria 2838
64 Ga0070705_100116898 3300005440 Bacteria 1715
65 Ga0070700_100004002 3300005441 Bacteria 7662
66 Ga0070700_100028151 3300005441 Bacteria 3340
67 Ga0070700_100042291 3300005441 Bacteria 2797
68 Ga0070694_100014238 3300005444 Bacteria 4978
69 Ga0070678_100013797 3300005456 Bacteria 5076
70 Ga0070662_100075229 3300005457 Bacteria 2500
71 Ga0070681_10000100 3300005458 Bacteria 63828
72 Ga0070681_10009949 3300005458 Bacteria 9373
73 Ga0070681_10082520 3300005458 Bacteria 3170
74 Ga0068867_100024849 3300005459 Bacteria 4295
75 Ga0070685_10075954 3300005466 Bacteria 2003
76 Ga0070707_100004557 3300005468 Bacteria 12978
77 Ga0070707_100123228 3300005468 Bacteria 2517
78 Ga0070707_100319583 3300005468 Bacteria 1509
79 Ga0070698_100019396 3300005471 Bacteria 7140
80 Ga0070698_100026846 3300005471 Bacteria 5989
81 Ga0070699_100006468 3300005518 Bacteria 10207
82 Ga0070699_100015295 3300005518 Bacteria 6594
83 Ga0070679_100000819 3300005530 Bacteria 26989
84 Ga0070679_100219092 3300005530 Bacteria 1865
85 Ga0070679_100300623 3300005530 Bacteria 1555
86 Ga0070684_100027342 3300005535 Bacteria 4813
87 Ga0070684_100143700 3300005535 Bacteria 2159
88 Ga0070684_100290349 3300005535 Bacteria 1499
89 Ga0070697_100060604 3300005536 Bacteria 3085
90 Ga0068853_100010775 3300005539 Bacteria 7405
91 Ga0068853_100031870 3300005539 Bacteria 4462
92 Ga0068853_100521222 3300005539 Bacteria 1124
93 Ga0070672_100018243 3300005543 Bacteria 5068
94 Ga0070672_100250323 3300005543 Bacteria 1492
95 Ga0070686_100012452 3300005544 Bacteria 4847
96 Ga0070695_100212295 3300005545 Bacteria 1390
97 Ga0070696_100048904 3300005546 Bacteria 2936
98 Ga0070693_100075534 3300005547 Bacteria 1996
99 Ga0070665_100001041 3300005548 Bacteria 34761
100 Ga0070704_100113277 3300005549 Bacteria 2068
101 Ga0070704_100432237 3300005549 Bacteria 1130
102 Ga0068855_100195556 3300005563 Bacteria 2279
103 Ga0070664_100011274 3300005564 Bacteria 7250
104 Ga0068857_100022785 3300005577 Bacteria 5510
105 Ga0068854_100026868 3300005578 Bacteria 3960
106 Ga0068854_100154648 3300005578 Bacteria 1771
107 Ga0068854_100173123 3300005578 Bacteria 1681
108 Ga0068856_100019645 3300005614 Bacteria 6557
109 Ga0068856_100041104 3300005614 Bacteria 4543
110 Ga0068856_100056472 3300005614 Bacteria 3873
111 Ga0068856_100066865 3300005614 Bacteria 3551
112 Ga0068856_100376928 3300005614 Bacteria 1438
113 Ga0070702_100012309 3300005615 Bacteria 4281
114 Ga0068852_100240646 3300005616 Bacteria 1729
115 Ga0068859_100020140 3300005617 Bacteria 6697
116 Ga0068859_100026381 3300005617 Bacteria 5825
117 Ga0068859_100261534 3300005617 Bacteria 1822
118 Ga0068864_100010017 3300005618 Bacteria 7824
119 Ga0068864_100037412 3300005618 Bacteria 4141
120 Ga0068864_100067381 3300005618 Bacteria 3108
121 Ga0068864_100190398 3300005618 Bacteria 1880
122 Ga0068864_100210056 3300005618 Bacteria 1792
123 Ga0068866_10010069 3300005718 Bacteria 4043
124 Ga0068861_100196386 3300005719 Bacteria 1690
125 Ga0068851_10092917 3300005834 Bacteria 1590
126 Ga0068863_100000915 3300005841 Bacteria 29639
127 Ga0068863_100037389 3300005841 Bacteria 4622
128 Ga0068858_100027277 3300005842 Bacteria 5306
129 Ga0068858_100067147 3300005842 Bacteria 3321
130 Ga0068858_100261606 3300005842 Bacteria 1645
131 Ga0068860_100006307 3300005843 Bacteria 11911
132 Ga0068860_100050865 3300005843 Bacteria 3944
133 Ga0068860_100087896 3300005843 Bacteria 2958
134 Ga0068860_100108354 3300005843 Bacteria 2655
135 Ga0068860_100453531 3300005843 Bacteria 1275
136 Ga0068862_100052886 3300005844 Bacteria 3476
137 Ga0068862_100333216 3300005844 Bacteria 1404
138 Ga0081455_10080221 3300005937 Bacteria 2676
139 Ga0081538_10005249 3300005981 Bacteria 11704
140 Ga0081538_10019084 3300005981 Bacteria 5115
141 Ga0081538_10039816 3300005981 Bacteria 3008
142 Ga0081539_10000508 3300005985 Bacteria 80945
143 Ga0081539_10002393 3300005985 Bacteria 26687
144 Ga0081539_10009588 3300005985 Bacteria 8049
145 Ga0075364_10098589 3300006051 Bacteria 1944
146 Ga0070712_100028006 3300006175 Bacteria 3766
147 Ga0070712_100042560 3300006175 Bacteria 3124
148 Ga0097621_100008887 3300006237 Bacteria 7261
149 Ga0097621_100026436 3300006237 Bacteria 4553
150 Ga0068871_100019002 3300006358 Bacteria 5238
151 Ga0075428_100087047 3300006844 Bacteria 3408
152 Ga0075428_100271474 3300006844 Bacteria 1825
153 Ga0075430_100019767 3300006846 Bacteria 5731
154 Ga0075430_100162599 3300006846 Bacteria 1858
155 Ga0075433_10042928 3300006852 Bacteria 3925
156 Ga0075429_100052445 3300006880 Bacteria 3549
157 Ga0068865_100009196 3300006881 Bacteria 6116
158 Ga0097620_100020141 3300006931 Bacteria 6697
159 Ga0097620_100026381 3300006931 Bacteria 5825
160 Ga0097620_100261524 3300006931 Bacteria 1822
161 Ga0111539_10004239 3300009094 Bacteria 18799
162 Ga0111539_10005862 3300009094 Bacteria 15868
163 Ga0105245_10031318 3300009098 Bacteria 4706
164 Ga0105247_10000940 3300009101 Bacteria 21955
165 Ga0114129_10002234 3300009147 Bacteria 26722
166 Ga0114129_10014519 3300009147 Bacteria 11225
167 Ga0114129_10452895 3300009147 Bacteria 1683
168 Ga0105243_10014777 3300009148 Bacteria 5906
169 Ga0105243_10029250 3300009148 Bacteria 4236
170 Ga0105243_10180766 3300009148 Bacteria 1834
171 Ga0105241_10070007 3300009174 Bacteria 2721
172 Ga0105242_10025407 3300009176 Bacteria 4688
173 Ga0105242_10060882 3300009176 Bacteria 3103
174 Ga0105248_10029475 3300009177 Bacteria 6122
175 Ga0105248_10076243 3300009177 Bacteria 3769
176 Ga0105248_10121267 3300009177 Bacteria 2949
177 Ga0105248_10247519 3300009177 Bacteria 2006
178 Ga0105237_10098265 3300009545 Bacteria 2918
179 Ga0105237_10233320 3300009545 Bacteria 1841
180 Ga0105238_10013757 3300009551 Bacteria 8178
181 Ga0105249_10095926 3300009553 Bacteria 2781
182 Ga0105239_10042817 3300010375 Bacteria 4962
183 Ga0105239_10077267 3300010375 Bacteria 3664
184 Ga0105246_10066906 3300011119 Bacteria 2517
185 Ga0157373_10040457 3300013100 Bacteria 3336
186 Ga0157371_10245259 3300013102 Bacteria 1289
187 Ga0157370_10084986 3300013104 Bacteria 2973
188 Ga0157370_10278049 3300013104 Bacteria 1547
189 Ga0157369_10020876 3300013105 Bacteria 7322
190 Ga0157369_10087964 3300013105 Bacteria 3316
191 Ga0157369_10236595 3300013105 Bacteria 1908
192 Ga0157369_10390086 3300013105 Bacteria 1445
193 Ga0157374_10004694 3300013296 Bacteria 11471
194 Ga0157378_10021461 3300013297 Bacteria 5679
195 Ga0157378_10061116 3300013297 Bacteria 3361
196 Ga0157378_10201356 3300013297 Bacteria 1883
197 Ga0163162_10026770 3300013306 Bacteria 5702
198 Ga0163162_10080345 3300013306 Bacteria 3328
199 Ga0163162_10426979 3300013306 Bacteria 1457
200 Ga0163162_10498448 3300013306 Bacteria 1348
201 Ga0163162_10505319 3300013306 Bacteria 1339
202 Ga0163162_10590644 3300013306 Bacteria 1237
203 Ga0157372_10035510 3300013307 Bacteria 5488
204 Ga0157372_10359897 3300013307 Bacteria 1695
205 Ga0163163_10000333 3300014325 Bacteria 45333
206 Ga0163163_10015670 3300014325 Bacteria 7018
207 Ga0163163_10024482 3300014325 Bacteria 5746
208 Ga0163163_10054345 3300014325 Bacteria 3956
209 Ga0163163_10090075 3300014325 Bacteria 3080
210 Ga0157380_10005498 3300014326 Bacteria 8856
211 Ga0182008_10063190 3300014497 Bacteria 1824
212 Ga0157377_10030363 3300014745 Bacteria 2927
213 Ga0157379_10055175 3300014968 Bacteria 3551
214 Ga0157376_10004147 3300014969 Bacteria 10046
215 Ga0157376_10120813 3300014969 Bacteria 2321
216 Ga0182007_10012823 3300015262 Bacteria 3214
217 Ga0163161_10010034 3300017792 Bacteria 6557
218 Ga0197907_10908011 3300020069 Bacteria 1659
219 Ga0213873_10045849 3300021358 Bacteria 1142
220 Ga0213874_10007424 3300021377 Bacteria 2632
221 Ga0213874_10018726 3300021377 Bacteria 1875
222 Ga0213876_10003751 3300021384 Bacteria 8617
223 Ga0213876_10039924 3300021384 Bacteria 2479
224 Ga0213876_10048202 3300021384 Bacteria 2251
225 Ga0213876_10058212 3300021384 Bacteria 2040
226 Ga0213875_10046844 3300021388 Bacteria 2028
227 Ga0213871_10029025 3300021441 Bacteria 1432
228 Ga0209148_1000660 3300025254 Bacteria 29677
229 Ga0209233_1005991 3300025261 Bacteria 3970
230 Ga0209455_1001949 3300025272 Bacteria 8509
231 Ga0207697_10004860 3300025315 Bacteria 6347
232 Ga0207692_10078558 3300025898 Bacteria 1759
233 Ga0207692_10110457 3300025898 Bacteria 1524
234 Ga0207710_10001235 3300025900 Bacteria 12944
235 Ga0207688_10002493 3300025901 Bacteria 9908
236 Ga0207688_10022756 3300025901 Bacteria 3431
237 Ga0207688_10103592 3300025901 Bacteria 1646
238 Ga0207680_10009570 3300025903 Bacteria 4812
239 Ga0207680_10162850 3300025903 Bacteria 1497
240 Ga0207680_10185772 3300025903 Bacteria 1408
241 Ga0207647_10035570 3300025904 Bacteria 3172
242 Ga0207699_10060267 3300025906 Bacteria 2278
243 Ga0207645_10142014 3300025907 Bacteria 1565
244 Ga0207643_10035840 3300025908 Bacteria 2783
245 Ga0207643_10051910 3300025908 Bacteria 2328
246 Ga0207654_10132528 3300025911 Bacteria 1579
247 Ga0207707_10000028 3300025912 Bacteria 167115
248 Ga0207707_10018373 3300025912 Bacteria 6094
249 Ga0207707_10025765 3300025912 Bacteria 5143
250 Ga0207707_10310727 3300025912 Bacteria 1362
251 Ga0207695_10233495 3300025913 Bacteria 1743
252 Ga0207671_10093351 3300025914 Bacteria 2270
253 Ga0207693_10000318 3300025915 Bacteria 44789
254 Ga0207693_10014552 3300025915 Bacteria 6322
255 Ga0207693_10052099 3300025915 Bacteria 3210
256 Ga0207663_10000403 3300025916 Bacteria 18706
257 Ga0207663_10140002 3300025916 Bacteria 1684
258 Ga0207660_10176589 3300025917 Bacteria 1656
259 Ga0207662_10212155 3300025918 Bacteria 1257
260 Ga0207657_10129949 3300025919 Bacteria 2065
261 Ga0207657_10176329 3300025919 Bacteria 1730
262 Ga0207649_10125483 3300025920 Bacteria 1736
263 Ga0207652_10001456 3300025921 Bacteria 20962
264 Ga0207652_10192762 3300025921 Bacteria 1833
265 Ga0207652_10340521 3300025921 Bacteria 1354
266 Ga0207646_10002372 3300025922 Bacteria 22266
267 Ga0207646_10107049 3300025922 Bacteria 2508
268 Ga0207681_10021108 3300025923 Bacteria 4135
269 Ga0207694_10007727 3300025924 Bacteria 8145
270 Ga0207694_10027497 3300025924 Bacteria 4332
271 Ga0207650_10000046 3300025925 Bacteria 178190
272 Ga0207650_10076882 3300025925 Bacteria 2523
273 Ga0207650_10233327 3300025925 Bacteria 1485
274 Ga0207659_10039234 3300025926 Bacteria 3301
275 Ga0207659_10340751 3300025926 Bacteria 1241
276 Ga0207700_10144911 3300025928 Bacteria 1956
277 Ga0207664_10108492 3300025929 Bacteria 2305
278 Ga0207644_10006205 3300025931 Bacteria 7796
279 Ga0207644_10051680 3300025931 Bacteria 2951
280 Ga0207644_10056131 3300025931 Bacteria 2841
281 Ga0207690_10015288 3300025932 Bacteria 4647
282 Ga0207690_10092340 3300025932 Bacteria 2142
283 Ga0207706_10069412 3300025933 Bacteria 3100
284 Ga0207686_10032073 3300025934 Bacteria 3124
285 Ga0207686_10037691 3300025934 Bacteria 2919
286 Ga0207709_10008475 3300025935 Bacteria 5689
287 Ga0207670_10058663 3300025936 Bacteria 2615
288 Ga0207670_10251564 3300025936 Bacteria 1366
289 Ga0207704_10127450 3300025938 Bacteria 1755
290 Ga0207665_10087381 3300025939 Bacteria 2155
291 Ga0207665_10269674 3300025939 Bacteria 1263
292 Ga0207691_10002179 3300025940 Bacteria 19142
293 Ga0207691_10118494 3300025940 Bacteria 2348
294 Ga0207691_10154645 3300025940 Bacteria 2015
295 Ga0207711_10005322 3300025941 Bacteria 10914
296 Ga0207711_10011584 3300025941 Bacteria 7330
297 Ga0207711_10067488 3300025941 Bacteria 3096
298 Ga0207711_10217929 3300025941 Bacteria 1745
299 Ga0207689_10009911 3300025942 Bacteria 8215
300 Ga0207689_10036738 3300025942 Bacteria 4066
301 Ga0207689_10042553 3300025942 Bacteria 3757
302 Ga0207689_10079236 3300025942 Bacteria 2700
303 Ga0207689_10117890 3300025942 Bacteria 2183
304 Ga0207661_10005005 3300025944 Bacteria 9293
305 Ga0207679_10094891 3300025945 Bacteria 2317
306 Ga0207679_10120610 3300025945 Bacteria 2086
307 Ga0207679_10123682 3300025945 Bacteria 2064
308 Ga0207679_10188564 3300025945 Bacteria 1712
309 Ga0207651_10144238 3300025960 Bacteria 1844
310 Ga0207651_10253147 3300025960 Bacteria 1442
311 Ga0207658_10055458 3300025986 Bacteria 2937
312 Ga0207639_10027229 3300026041 Bacteria 4162
313 Ga0207708_10001416 3300026075 Bacteria 17970
314 Ga0207708_10004271 3300026075 Bacteria 10525
315 Ga0207708_10016248 3300026075 Bacteria 5593
316 Ga0207708_10026319 3300026075 Bacteria 4401
317 Ga0207708_10044244 3300026075 Bacteria 3392
318 Ga0207702_10090121 3300026078 Bacteria 2683
319 Ga0207702_10104135 3300026078 Bacteria 2511
320 Ga0207702_10158506 3300026078 Bacteria 2065
321 Ga0207702_10186258 3300026078 Bacteria 1915
322 Ga0207641_10114736 3300026088 Bacteria 2394
323 Ga0207641_10412116 3300026088 Bacteria 1299
324 Ga0207648_10019959 3300026089 Bacteria 6047
325 Ga0207676_10006578 3300026095 Bacteria 8216
326 Ga0207676_10231081 3300026095 Bacteria 1653
327 Ga0207676_10282923 3300026095 Bacteria 1506
328 Ga0207674_10002025 3300026116 Bacteria 25725
329 Ga0207674_10368376 3300026116 Bacteria 1389
330 Ga0207675_100006381 3300026118 Bacteria 11176
331 Ga0207675_100020009 3300026118 Bacteria 6245
332 Ga0207675_100119053 3300026118 Bacteria 2498
333 Ga0207683_10036121 3300026121 Bacteria 4300
334 Ga0207683_10440666 3300026121 Bacteria 1200
335 Ga0207698_10029437 3300026142 Bacteria 3933
336 Ga0207698_10363066 3300026142 Bacteria 1372
337 Ga0207428_10009788 3300027907 Bacteria 8588
338 Ga0207428_10127532 3300027907 Bacteria 1948
339 Ga0268266_10133736 3300028379 Bacteria 2220
340 Ga0268266_10165811 3300028379 Bacteria 2001
341 Ga0268265_10047868 3300028380 Bacteria 3206
342 Ga0268265_10191454 3300028380 Bacteria 1767
343 Ga0268264_10062848 3300028381 Bacteria 3119
344 Ga0268264_10140613 3300028381 Bacteria 2152
345 Ga0265319_1002151 3300028563 Bacteria 11022
346 Ga0265319_1004443 3300028563 Bacteria 6940
347 Ga0265334_10016024 3300028573 Bacteria 3104
348 Ga0265318_10033209 3300028577 Bacteria 1993
349 Ga0265338_10012127 3300028800 Bacteria 9847
350 Ga0265338_10058930 3300028800 Bacteria 3385
351 Ga0265320_10046312 3300031240 Bacteria 2132
352 Ga0265325_10107172 3300031241 Bacteria 1362
353 Ga0265340_10010465 3300031247 Bacteria 4959
354 Ga0265339_10030796 3300031249 Bacteria 3036
355 Ga0265331_10046674 3300031250 Bacteria 2087
356 Ga0265327_10004348 3300031251 Bacteria 12610
357 Ga0265327_10034325 3300031251 Bacteria 2816
358 Ga0316579_10011676 3300031691 Bacteria 3739
359 Ga0265342_10023274 3300031712 Bacteria 3924
360 Ga0316576_10112307 3300031727 Bacteria 2043
361 Ga0307407_10296380 3300031903 Bacteria 1126
362 Ga0307416_100014583 3300032002 Bacteria 5394
363 Ga0307415_100019592 3300032126 Bacteria 4111
364 Ga0307415_100390001 3300032126 Bacteria 1185
365 Ga0316574_0051177 3300035398 Bacteria 2574
366 Ga0373933_0008354 3300035724 Bacteria 5653
367 Ga0373937_0008559 3300036401 Bacteria 8888
368 Ga0373937_0033200 3300036401 Bacteria 4685
369 Ga0373937_0208189 3300036401 Bacteria 1840
370 Ga0373937_0212098 3300036401 Bacteria 1822
371 Ga0395898_0102765 3300037466 Bacteria 2743
372 Ga0436364_0030065 3300037853 Bacteria 1351
373 Ga0436364_0237688 3300037853 Bacteria 9977
374 Ga0436364_0271519 3300037853 Bacteria 1467
375 Ga0436364_0445774 3300037853 Bacteria 40627
376 Ga0436364_0595302 3300037853 Bacteria 2359
377 Ga0436364_1048038 3300037853 Bacteria 14083
378 Ga0395901_0145720 3300038443 Bacteria 2489
379 Ga0242419_002532 3300038698 Bacteria 1191
380 Ga0242420_001887 3300038996 Bacteria 2902
381 Ga0242420_003553 3300038996 Bacteria 2307
382 Ga0436365_0282749 3300039437 Bacteria 2122
383 Ga0436365_0538543 3300039437 Bacteria 3132
384 Ga0436365_0575287 3300039437 Bacteria 3871
385 Ga0436365_0934847 3300039437 Bacteria 10390
386 Ga0436365_1561332 3300039437 Bacteria 6168
387 Ga0436365_1623746 3300039437 Bacteria 4860
388 Ga0436360_0073838 3300039438 Bacteria 1627
389 Ga0436363_0379843 3300039450 Bacteria 1257
390 Ga0436363_0537558 3300039450 Bacteria 1108
391 Ga0436363_0705637 3300039450 Bacteria 3584
392 Ga0436363_1147919 3300039450 Bacteria 11712
393 Ga0436363_1339971 3300039450 Bacteria 7742
394 Ga0436363_1410693 3300039450 Bacteria 1513
395 Ga0436362_0767539 3300039453 Bacteria 2302
396 Ga0451839_0056850 3300041496 Bacteria 1368
397 Ga0439431_0024046 3300041997 Bacteria 1480
398 Ga0439440_0018808 3300042993 Bacteria 1534
399 Ga0466969_0013288 3300044656 Bacteria 4336
400 Ga0466969_0081421 3300044656 Bacteria 1545
401 Ga0466969_0081977 3300044656 Bacteria 1538
402 Ga0466966_0030397 3300044684 Bacteria 3508
403 Ga0466966_0040752 3300044684 Bacteria 2988
404 Ga0466966_0099452 3300044684 Bacteria 1800
405 Ga0466966_0118135 3300044684 Bacteria 1631
406 Ga0466966_0211094 3300044684 Bacteria 1173
407 Ga0466961_0011934 3300044693 Bacteria 5554
408 Ga0466961_0246568 3300044693 Bacteria 1097
409 Ga0466963_0008066 3300044694 Bacteria 6305
410 Ga0466963_0014264 3300044694 Bacteria 4896
411 Ga0466963_0019687 3300044694 Bacteria 4237
412 Ga0466963_0024625 3300044694 Bacteria 3831
413 Ga0466963_0044903 3300044694 Bacteria 2908
414 Ga0466963_0048790 3300044694 Bacteria 2799
415 Ga0466963_0123698 3300044694 Bacteria 1782
416 Ga0466971_0040339 3300044719 Bacteria 2097
417 Ga0466971_0120746 3300044719 Bacteria 1213
418 Ga0466968_0009794 3300044735 Bacteria 3699
419 Ga0466968_0088914 3300044735 Bacteria 1366
420 Ga0466970_0018802 3300044765 Bacteria 3580
421 Ga0466970_0081375 3300044765 Bacteria 1751
422 Ga0466957_0025625 3300044842 Bacteria 3496
423 Ga0466957_0077681 3300044842 Bacteria 2063
424 Ga0466960_0043431 3300044901 Bacteria 2138
425 Ga0466960_0114287 3300044901 Bacteria 1406
426 Ga0466959_0002972 3300045049 Bacteria 10946
427 Ga0466959_0003676 3300045049 Bacteria 10116
428 Ga0466959_0004705 3300045049 Bacteria 9191
429 Ga0466959_0019337 3300045049 Bacteria 5009
430 Ga0466959_0083963 3300045049 Bacteria 2293
431 Ga0466959_0131995 3300045049 Bacteria 1770
432 Ga0466959_0159258 3300045049 Bacteria 1588
433 Ga0466959_0166424 3300045049 Bacteria 1548
434 Ga0466959_0204496 3300045049 Bacteria 1374
435 Ga0466958_0001781 3300045836 Bacteria 10445
436 Ga0466958_0004223 3300045836 Bacteria 7556
437 Ga0466958_0006079 3300045836 Bacteria 6544
438 Ga0466958_0010518 3300045836 Bacteria 5183
439 Ga0466958_0040734 3300045836 Bacteria 2792
440 Ga0466958_0100117 3300045836 Bacteria 1801
441 Ga0466958_0239431 3300045836 Bacteria 1159
442 Ga0466967_0000087 3300045976 Bacteria 34051
443 Ga0466967_0006761 3300045976 Bacteria 8165
444 Ga0466967_0007780 3300045976 Bacteria 7780
445 Ga0466967_0008112 3300045976 Bacteria 7661
446 Ga0466967_0024302 3300045976 Bacteria 4980
447 Ga0466967_0124338 3300045976 Bacteria 2388
448 Ga0466967_0343679 3300045976 Bacteria 1443
449 Ga0495629_0086921 3300046459 Bacteria 2181
450 Ga0495651_0019189 3300046462 Bacteria 5297
451 Ga0495653_0043766 3300046463 Bacteria 3478
452 Ga0495650_0000398 3300046471 Bacteria 72672
453 Ga0495580_0108013 3300046472 Bacteria 1932
454 Ga0495664_0087972 3300046477 Bacteria 1867
455 Ga0495606_0078434 3300046507 Bacteria 2060
456 Ga0495608_0019074 3300046511 Bacteria 4727
457 Ga0495630_0123999 3300046517 Bacteria 1960
458 Ga0495630_0146197 3300046517 Bacteria 1798
459 Ga0495652_0057374 3300046529 Bacteria 3302
460 Ga0495587_0069140 3300046536 Bacteria 2056
461 Ga0495667_0023983 3300046559 Bacteria 4108
462 Ga0495667_0024495 3300046559 Bacteria 4064
463 Ga0495634_0088572 3300046642 Bacteria 2013
464 Ga0495635_0053247 3300046663 Bacteria 2788
465 Ga0495657_0047966 3300046675 Bacteria 2884
466 Ga0495657_0081516 3300046675 Bacteria 2092
467 Ga0495646_0009781 3300046680 Bacteria 6092
468 Ga0495647_0008638 3300046681 Bacteria 3428
469 Ga0495658_0073798 3300046683 Bacteria 1987
470 Ga0495604_0165329 3300047317 Bacteria 1560
471 Ga0495674_0298699 3300047319 Bacteria 1316
472 Ga0495672_0000875 3300047320 Bacteria 31630
473 Ga0495680_0026856 3300047322 Bacteria 4740
474 Ga0495680_0039124 3300047322 Bacteria 3785
475 Ga0495680_0091922 3300047322 Bacteria 2274
476 Ga0495684_0076611 3300047471 Bacteria 2540
477 Ga0495686_0002217 3300047472 Bacteria 18851
478 Ga0495686_0050119 3300047472 Bacteria 2624
479 Ga0495593_0102753 3300047673 Bacteria 1465
480 Ga0495602_0006880 3300048088 Bacteria 11952
481 Ga0496100_0006518 3300048903 Bacteria 6368
482 Ga0496100_0067336 3300048903 Bacteria 2378
483 Ga0496101_0046537 3300048904 Bacteria 3112
484 Ga0496101_0078933 3300048904 Bacteria 2429
485 Ga0496102_0095306 3300048905 Bacteria 2758
486 Ga0496102_0141548 3300048905 Bacteria 2256
487 Ga0496104_0008846 3300048907 Bacteria 8952
488 Ga0496104_0036380 3300048907 Bacteria 4602
489 Ga0496104_0054491 3300048907 Bacteria 3780
490 Ga0496104_0517086 3300048907 Bacteria 1105
491 Ga0496105_0012536 3300048908 Bacteria 6713
492 Ga0496106_0008472 3300048909 Bacteria 7608
493 Ga0496106_0147147 3300048909 Bacteria 1856
494 Ga0496106_0178938 3300048909 Bacteria 1683
495 Ga0496107_0058504 3300048910 Bacteria 2787
496 Ga0496108_0019043 3300048911 Bacteria 5631
497 Ga0496108_0053454 3300048911 Bacteria 3387
498 Ga0496108_0112658 3300048911 Bacteria 2328
499 Ga0496108_0435165 3300048911 Bacteria 1146
500 Ga0496108_0475052 3300048911 Bacteria 1092
501 Ga0496109_0048270 3300048912 Bacteria 3873
502 Ga0496109_0191724 3300048912 Bacteria 1921
503 Ga0496110_0054374 3300048913 Bacteria 3521
504 Ga0496110_0315758 3300048913 Bacteria 1423
505 Ga0496111_0069275 3300048914 Bacteria 2565
506 Ga0496112_0007267 3300048915 Bacteria 9817
507 Ga0496112_0010807 3300048915 Bacteria 8304
508 Ga0496112_0034919 3300048915 Bacteria 4893
509 Ga0496112_0057601 3300048915 Bacteria 3826
510 Ga0496112_0072452 3300048915 Bacteria 3406
511 Ga0496112_0081070 3300048915 Bacteria 3209
512 Ga0496112_0106042 3300048915 Bacteria 2780
513 Ga0496112_0251503 3300048915 Bacteria 1718
514 Ga0496113_0027748 3300048916 Bacteria 4062
515 Ga0496113_0125312 3300048916 Bacteria 2011
516 Ga0496113_0161262 3300048916 Bacteria 1773
517 Ga0496114_0054971 3300048917 Bacteria 3320
518 Ga0496115_0000241 3300048918 Bacteria 49730
519 Ga0496115_0172453 3300048918 Bacteria 1789
520 Ga0496119_0063017 3300048922 Bacteria 2207
521 Ga0496121_0020435 3300048924 Bacteria 6556
522 Ga0501033_0000050 3300049570 Bacteria 111819
523 Ga0501034_0017887 3300049571 Bacteria 7270
524 Ga0501034_0037246 3300049571 Bacteria 4925
525 Ga0501070_0073273 3300049586 Bacteria 2833
526 Ga0501072_0226796 3300049588 Bacteria 1488
527 Ga0501073_0087655 3300049589 Bacteria 2164
528 Ga0501083_0058171 3300049744 Bacteria 2587
529 nmdc:mga00v17_133220_c1 3300050491 Bacteria 1589
530 nmdc:mga05p37_275865_c1 3300050507 Bacteria 2007
531 nmdc:mga05p37_31200_c1 3300050507 Bacteria 6509
532 nmdc:mga05p37_84672_c1 3300050507 Bacteria 3906
533 nmdc:mga09592_47713_c1 3300050508 Bacteria 3610
534 nmdc:mga0qj67_66473_c1 3300050509 Bacteria 2872
535 nmdc:mga06r32_165414_c1 3300050510 Bacteria 2195
536 nmdc:mga08y16_97731_c1 3300050511 Bacteria 3058
537 nmdc:mga0n895_304026_c1 3300050512 Bacteria 1617
538 nmdc:mga0a205_12842_c1 3300050515 Bacteria 7769
539 nmdc:mga0a205_24376_c1 3300050515 Bacteria 5753
540 Ga0495601_0031787 3300053077 Bacteria 3282
541 Ga0495619_0005235 3300053085 Bacteria 8220
542 Ga0495619_0010545 3300053085 Bacteria 5814
543 Ga0500562_003616 3300053108 Bacteria 3880
544 Ga0500634_0000015 3300053161 Bacteria 113039
545 Ga0501084_0252668 3300054114 Bacteria 1488
546 Ga0466962_0015826 3300061719 Bacteria 3639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10058930 Ga0265338_100589303 289
2 3300049571 Ga0501034_0037246 Ga0501034_0037246_3686_4675 291
3 3300048915 Ga0496112_0010807 Ga0496112_0010807_455_1444 293
4 3300044693 Ga0466961_0246568 Ga0466961_0246568_85_1086 294
5 3300044694 Ga0466963_0008066 Ga0466963_0008066_1769_2770 294
6 3300045049 Ga0466959_0083963 Ga0466959_0083963_1247_2248 294
7 3300045836 Ga0466958_0006079 Ga0466958_0006079_1965_2966 294
8 3300045976 Ga0466967_0024302 Ga0466967_0024302_1926_2927 294
9 3300005331 Ga0070670_100055127 Ga0070670_1000551272 295
10 3300013104 Ga0157370_10278049 Ga0157370_102780492 295
11 3300013105 Ga0157369_10020876 Ga0157369_100208766 295
12 3300025925 Ga0207650_10233327 Ga0207650_102333272 295
13 3300038698 Ga0242419_002532 Ga0242419_002532_39_926 295
14 3300005434 Ga0070709_10090090 Ga0070709_100900902 297
15 3300014497 Ga0182008_10063190 Ga0182008_100631902 297
16 3300015262 Ga0182007_10012823 Ga0182007_100128232 297
17 3300025906 Ga0207699_10060267 Ga0207699_100602672 297
18 3300047319 Ga0495674_0298699 Ga0495674_0298699_194_1195 297
19 3300048915 Ga0496112_0081070 Ga0496112_0081070_1507_2508 297
20 3300013105 Ga0157369_10390086 Ga0157369_103900861 298
21 3300044694 Ga0466963_0024625 Ga0466963_0024625_791_1816 298
22 3300045976 Ga0466967_0006761 Ga0466967_0006761_1742_2767 298
23 3300049571 Ga0501034_0017887 Ga0501034_0017887_517_1542 298
24 3300049586 Ga0501070_0073273 Ga0501070_0073273_1513_2538 298
25 3300049589 Ga0501073_0087655 Ga0501073_0087655_285_1310 298
26 3300054114 Ga0501084_0252668 Ga0501084_0252668_436_1446 298
27 3300005468 Ga0070707_100319583 Ga0070707_1003195832 299
28 3300005614 Ga0068856_100376928 Ga0068856_1003769282 299
29 3300026078 Ga0207702_10186258 Ga0207702_101862583 299
30 3300045976 Ga0466967_0000087 Ga0466967_0000087_2316_3335 299
31 3300048909 Ga0496106_0008472 Ga0496106_0008472_1236_2267 299
32 3300048912 Ga0496109_0191724 Ga0496109_0191724_220_1251 299
33 3300028563 Ga0265319_1002151 Ga0265319_10021517 300
34 3300028573 Ga0265334_10016024 Ga0265334_100160243 300
35 3300028800 Ga0265338_10012127 Ga0265338_100121277 300
36 3300031240 Ga0265320_10046312 Ga0265320_100463123 300
37 3300031241 Ga0265325_10107172 Ga0265325_101071722 300
38 3300031247 Ga0265340_10010465 Ga0265340_100104655 300
39 3300031249 Ga0265339_10030796 Ga0265339_100307962 300
40 3300031250 Ga0265331_10046674 Ga0265331_100466741 300
41 3300031712 Ga0265342_10023274 Ga0265342_100232743 300
42 3300031903 Ga0307407_10296380 Ga0307407_102963801 300
43 3300005471 Ga0070698_100019396 Ga0070698_1000193965 301
44 3300045049 Ga0466959_0159258 Ga0466959_0159258_209_1162 301
45 3300046459 Ga0495629_0086921 Ga0495629_0086921_530_1546 301
46 3300046517 Ga0495630_0123999 Ga0495630_0123999_176_1192 301
47 3300046559 Ga0495667_0024495 Ga0495667_0024495_108_1124 301
48 3300046642 Ga0495634_0088572 Ga0495634_0088572_128_1144 301
49 3300046675 Ga0495657_0081516 Ga0495657_0081516_577_1593 301
50 3300046683 Ga0495658_0073798 Ga0495658_0073798_246_1262 301
51 3300047322 Ga0495680_0039124 Ga0495680_0039124_1441_2457 301
52 3300053085 Ga0495619_0005235 Ga0495619_0005235_3308_4324 301
53 3300005985 Ga0081539_10009588 Ga0081539_100095882 303
54 3300013104 Ga0157370_10084986 Ga0157370_100849861 303
55 3300049588 Ga0501072_0226796 Ga0501072_0226796_64_1023 303
56 3300044694 Ga0466963_0123698 Ga0466963_0123698_294_1319 304
57 3300005335 Ga0070666_10024439 Ga0070666_100244392 305
58 3300005355 Ga0070671_100001660 Ga0070671_1000016609 305
59 3300005367 Ga0070667_100082972 Ga0070667_1000829722 305
60 3300005548 Ga0070665_100001041 Ga0070665_10000104122 305
61 3300005618 Ga0068864_100037412 Ga0068864_1000374123 305
62 3300005841 Ga0068863_100000915 Ga0068863_10000091517 305
63 3300009177 Ga0105248_10029475 Ga0105248_100294754 305
64 3300013296 Ga0157374_10004694 Ga0157374_100046944 305
65 3300014325 Ga0163163_10054345 Ga0163163_100543452 305
66 3300021384 Ga0213876_10003751 Ga0213876_100037517 305
67 3300025903 Ga0207680_10009570 Ga0207680_100095702 305
68 3300025931 Ga0207644_10006205 Ga0207644_100062055 305
69 3300025941 Ga0207711_10005322 Ga0207711_100053228 305
70 3300026095 Ga0207676_10231081 Ga0207676_102310812 305
71 3300028379 Ga0268266_10165811 Ga0268266_101658112 305
72 3300028563 Ga0265319_1004443 Ga0265319_10044433 305
73 3300046507 Ga0495606_0078434 Ga0495606_0078434_411_1436 305
74 3300048907 Ga0496104_0517086 Ga0496104_0517086_67_1092 305
75 3300048911 Ga0496108_0053454 Ga0496108_0053454_55_1044 305
76 3300048911 Ga0496108_0475052 Ga0496108_0475052_20_1045 305
77 3300048915 Ga0496112_0057601 Ga0496112_0057601_1740_2765 305
78 3300048905 Ga0496102_0141548 Ga0496102_0141548_319_1308 306
79 3300048907 Ga0496104_0008846 Ga0496104_0008846_1805_2794 306
80 3300048915 Ga0496112_0106042 Ga0496112_0106042_875_1864 306
81 3300048915 Ga0496112_0007267 Ga0496112_0007267_3430_4419 307
82 3300047320 Ga0495672_0000875 Ga0495672_0000875_11140_12165 308
83 3300014968 Ga0157379_10055175 Ga0157379_100551752 309
84 3300038443 Ga0395901_0145720 Ga0395901_0145720_1488_2477 309
85 3300045049 Ga0466959_0131995 Ga0466959_0131995_87_1079 309
86 3300046471 Ga0495650_0000398 Ga0495650_0000398_32223_33212 309
87 3300048922 Ga0496119_0063017 Ga0496119_0063017_121_1110 309
88 3300005339 Ga0070660_100023500 Ga0070660_1000235004 310
89 3300005530 Ga0070679_100219092 Ga0070679_1002190922 310
90 3300025921 Ga0207652_10192762 Ga0207652_101927622 310
91 3300048924 Ga0496121_0020435 Ga0496121_0020435_4346_5338 310
92 3300005329 Ga0070683_100030796 Ga0070683_1000307963 311
93 3300005336 Ga0070680_100088572 Ga0070680_1000885723 311
94 3300005337 Ga0070682_100009728 Ga0070682_1000097285 311
95 3300005354 Ga0070675_100043116 Ga0070675_1000431163 311
96 3300005355 Ga0070671_100078675 Ga0070671_1000786752 311
97 3300005441 Ga0070700_100004002 Ga0070700_1000040024 311
98 3300005456 Ga0070678_100013797 Ga0070678_1000137972 311
99 3300005535 Ga0070684_100027342 Ga0070684_1000273425 311
100 3300005614 Ga0068856_100056472 Ga0068856_1000564723 311
101 3300006175 Ga0070712_100028006 Ga0070712_1000280063 311
102 3300009545 Ga0105237_10098265 Ga0105237_100982653 311
103 3300010375 Ga0105239_10042817 Ga0105239_100428173 311
104 3300013102 Ga0157371_10245259 Ga0157371_102452592 311
105 3300013105 Ga0157369_10236595 Ga0157369_102365952 311
106 3300013306 Ga0163162_10505319 Ga0163162_105053192 311
107 3300013307 Ga0157372_10035510 Ga0157372_100355104 311
108 3300025898 Ga0207692_10110457 Ga0207692_101104571 311
109 3300025901 Ga0207688_10002493 Ga0207688_100024934 311
110 3300025914 Ga0207671_10093351 Ga0207671_100933512 311
111 3300025915 Ga0207693_10014552 Ga0207693_100145524 311
112 3300025926 Ga0207659_10039234 Ga0207659_100392342 311
113 3300025945 Ga0207679_10094891 Ga0207679_100948912 311
114 3300025945 Ga0207679_10120610 Ga0207679_101206101 311
115 3300025960 Ga0207651_10144238 Ga0207651_101442382 311
116 3300026075 Ga0207708_10001416 Ga0207708_1000141610 311
117 3300026078 Ga0207702_10158506 Ga0207702_101585062 311
118 3300026121 Ga0207683_10036121 Ga0207683_100361213 311
119 3300026142 Ga0207698_10029437 Ga0207698_100294373 311
120 3300048903 Ga0496100_0067336 Ga0496100_0067336_564_1553 311
121 3300048904 Ga0496101_0078933 Ga0496101_0078933_154_1143 311
122 3300048905 Ga0496102_0095306 Ga0496102_0095306_944_1933 311
123 3300048908 Ga0496105_0012536 Ga0496105_0012536_2639_3628 311
124 3300048909 Ga0496106_0147147 Ga0496106_0147147_592_1581 311
125 3300048910 Ga0496107_0058504 Ga0496107_0058504_1348_2337 311
126 3300048911 Ga0496108_0019043 Ga0496108_0019043_905_1894 311
127 3300048912 Ga0496109_0048270 Ga0496109_0048270_1266_2255 311
128 3300048913 Ga0496110_0054374 Ga0496110_0054374_1825_2814 311
129 3300048915 Ga0496112_0034919 Ga0496112_0034919_2091_3080 311
130 3300048916 Ga0496113_0027748 Ga0496113_0027748_2247_3236 311
131 3300014969 Ga0157376_10120813 Ga0157376_101208132 313
132 3300005439 Ga0070711_100051072 Ga0070711_1000510722 314
133 3300005981 Ga0081538_10005249 Ga0081538_100052494 314
134 3300006175 Ga0070712_100042560 Ga0070712_1000425603 314
135 3300025915 Ga0207693_10052099 Ga0207693_100520992 314
136 3300025916 Ga0207663_10000403 Ga0207663_100004035 314
137 3300025939 Ga0207665_10269674 Ga0207665_102696742 314
138 3300025940 Ga0207691_10154645 Ga0207691_101546452 314
139 3300031251 Ga0265327_10004348 Ga0265327_100043483 314
140 3300048903 Ga0496100_0006518 Ga0496100_0006518_3505_4494 314
141 3300048918 Ga0496115_0000241 Ga0496115_0000241_42456_43445 314
142 3300005981 Ga0081538_10039816 Ga0081538_100398164 315
143 3300032002 Ga0307416_100014583 Ga0307416_1000145833 315
144 3300032126 Ga0307415_100019592 Ga0307415_1000195922 315
145 3300044684 Ga0466966_0118135 Ga0466966_0118135_370_1365 315
146 3300044735 Ga0466968_0009794 Ga0466968_0009794_1729_2727 315
147 3300044901 Ga0466960_0043431 Ga0466960_0043431_770_1774 315
148 3300045049 Ga0466959_0166424 Ga0466959_0166424_402_1397 315
149 3300045976 Ga0466967_0343679 Ga0466967_0343679_144_1148 315
150 3300025261 Ga0209233_1005991 Ga0209233_10059914 316
151 3300044901 Ga0466960_0114287 Ga0466960_0114287_23_1030 316
152 3300047472 Ga0495686_0002217 Ga0495686_0002217_3685_4707 316
153 3300048915 Ga0496112_0072452 Ga0496112_0072452_1442_2446 316
154 3300005329 Ga0070683_100092939 Ga0070683_1000929393 317
155 3300025929 Ga0207664_10108492 Ga0207664_101084922 317
156 3300026075 Ga0207708_10016248 Ga0207708_100162487 317
157 3300039450 Ga0436363_0379843 Ga0436363_0379843_40_1029 317
158 3300042993 Ga0439440_0018808 Ga0439440_0018808_148_1137 317
159 3300044656 Ga0466969_0081977 Ga0466969_0081977_487_1479 317
160 3300044684 Ga0466966_0099452 Ga0466966_0099452_56_1048 317
161 3300045049 Ga0466959_0004705 Ga0466959_0004705_5959_6951 317
162 3300045049 Ga0466959_0204496 Ga0466959_0204496_15_1010 317
163 3300045836 Ga0466958_0100117 Ga0466958_0100117_365_1357 317
164 3300005339 Ga0070660_100103814 Ga0070660_1001038143 318
165 3300005535 Ga0070684_100290349 Ga0070684_1002903492 318
166 3300005614 Ga0068856_100041104 Ga0068856_1000411043 318
167 3300005981 Ga0081538_10019084 Ga0081538_100190846 318
168 3300021358 Ga0213873_10045849 Ga0213873_100458491 318
169 3300021377 Ga0213874_10007424 Ga0213874_100074243 318
170 3300021377 Ga0213874_10018726 Ga0213874_100187262 318
171 3300021384 Ga0213876_10039924 Ga0213876_100399243 318
172 3300021384 Ga0213876_10048202 Ga0213876_100482022 318
173 3300021384 Ga0213876_10058212 Ga0213876_100582122 318
174 3300021441 Ga0213871_10029025 Ga0213871_100290252 318
175 3300026078 Ga0207702_10090121 Ga0207702_100901212 318
176 3300032126 Ga0307415_100390001 Ga0307415_1003900011 318
177 3300037853 Ga0436364_0030065 Ga0436364_0030065_123_1115 318
178 3300037853 Ga0436364_0595302 Ga0436364_0595302_211_1206 318
179 3300037853 Ga0436364_1048038 Ga0436364_1048038_1380_2375 318
180 3300039437 Ga0436365_0282749 Ga0436365_0282749_623_1615 318
181 3300039437 Ga0436365_0575287 Ga0436365_0575287_392_1387 318
182 3300039437 Ga0436365_0934847 Ga0436365_0934847_3512_4507 318
183 3300039437 Ga0436365_1561332 Ga0436365_1561332_531_1526 318
184 3300039437 Ga0436365_1623746 Ga0436365_1623746_868_1863 318
185 3300039438 Ga0436360_0073838 Ga0436360_0073838_304_1299 318
186 3300039450 Ga0436363_1147919 Ga0436363_1147919_9080_10075 318
187 3300039453 Ga0436362_0767539 Ga0436362_0767539_333_1328 318
188 3300044656 Ga0466969_0081421 Ga0466969_0081421_321_1316 318
189 3300044684 Ga0466966_0030397 Ga0466966_0030397_1367_2362 318
190 3300044684 Ga0466966_0040752 Ga0466966_0040752_305_1300 318
191 3300044684 Ga0466966_0211094 Ga0466966_0211094_13_1008 318
192 3300044693 Ga0466961_0011934 Ga0466961_0011934_2931_3926 318
193 3300044694 Ga0466963_0044903 Ga0466963_0044903_213_1208 318
194 3300044694 Ga0466963_0048790 Ga0466963_0048790_1255_2250 318
195 3300044719 Ga0466971_0040339 Ga0466971_0040339_876_1871 318
196 3300044719 Ga0466971_0120746 Ga0466971_0120746_81_1076 318
197 3300044735 Ga0466968_0088914 Ga0466968_0088914_40_1035 318
198 3300044765 Ga0466970_0081375 Ga0466970_0081375_95_1090 318
199 3300044842 Ga0466957_0025625 Ga0466957_0025625_13_1008 318
200 3300044842 Ga0466957_0077681 Ga0466957_0077681_304_1299 318
201 3300045049 Ga0466959_0003676 Ga0466959_0003676_1704_2699 318
202 3300045049 Ga0466959_0019337 Ga0466959_0019337_849_1844 318
203 3300045836 Ga0466958_0001781 Ga0466958_0001781_2996_3991 318
204 3300045836 Ga0466958_0004223 Ga0466958_0004223_1579_2574 318
205 3300045836 Ga0466958_0010518 Ga0466958_0010518_2007_3002 318
206 3300045836 Ga0466958_0239431 Ga0466958_0239431_100_1095 318
207 3300045976 Ga0466967_0007780 Ga0466967_0007780_5264_6259 318
208 3300046681 Ga0495647_0008638 Ga0495647_0008638_2390_3379 318
209 3300047471 Ga0495684_0076611 Ga0495684_0076611_1369_2358 318
210 3300061719 Ga0466962_0015826 Ga0466962_0015826_621_1616 318
211 3300005563 Ga0068855_100195556 Ga0068855_1001955562 319
212 3300005578 Ga0068854_100154648 Ga0068854_1001546482 319
213 3300005616 Ga0068852_100240646 Ga0068852_1002406462 319
214 3300025901 Ga0207688_10103592 Ga0207688_101035922 319
215 3300039450 Ga0436363_0537558 Ga0436363_0537558_79_1074 319
216 3300039450 Ga0436363_1410693 Ga0436363_1410693_94_1089 319
217 3300037853 Ga0436364_0237688 Ga0436364_0237688_28_1062 320
218 3300005347 Ga0070668_100061633 Ga0070668_1000616332 321
219 3300005356 Ga0070674_100004685 Ga0070674_1000046856 321
220 3300005364 Ga0070673_100161745 Ga0070673_1001617453 321
221 3300005543 Ga0070672_100250323 Ga0070672_1002503232 321
222 3300005842 Ga0068858_100027277 Ga0068858_1000272774 321
223 3300005843 Ga0068860_100006307 Ga0068860_1000063076 321
224 3300005843 Ga0068860_100453531 Ga0068860_1004535312 321
225 3300013306 Ga0163162_10080345 Ga0163162_100803453 321
226 3300025940 Ga0207691_10118494 Ga0207691_101184942 321
227 3300026142 Ga0207698_10363066 Ga0207698_103630662 321
228 3300005366 Ga0070659_100002129 Ga0070659_1000021299 322
229 3300005530 Ga0070679_100300623 Ga0070679_1003006231 322
230 3300005614 Ga0068856_100066865 Ga0068856_1000668654 322
231 3300013105 Ga0157369_10087964 Ga0157369_100879643 322
232 3300020069 Ga0197907_10908011 Ga0197907_109080112 322
233 3300025912 Ga0207707_10310727 Ga0207707_103107271 322
234 3300025919 Ga0207657_10129949 Ga0207657_101299492 322
235 3300025921 Ga0207652_10340521 Ga0207652_103405212 322
236 3300026078 Ga0207702_10104135 Ga0207702_101041351 322
237 3300036401 Ga0373937_0008559 Ga0373937_0008559_3989_5008 322
238 3300037466 Ga0395898_0102765 Ga0395898_0102765_1202_2221 322
239 3300045976 Ga0466967_0124338 Ga0466967_0124338_630_1649 322
240 3300049744 Ga0501083_0058171 Ga0501083_0058171_1077_2096 322
241 3300005289 Ga0065704_10096006 Ga0065704_100960062 323
242 3300005290 Ga0065712_10002607 Ga0065712_100026073 323
243 3300005293 Ga0065715_10032464 Ga0065715_100324642 323
244 3300005295 Ga0065707_10131316 Ga0065707_101313162 323
245 3300005328 Ga0070676_10130014 Ga0070676_101300142 323
246 3300005329 Ga0070683_100026787 Ga0070683_1000267874 323
247 3300005330 Ga0070690_100020310 Ga0070690_1000203102 323
248 3300005330 Ga0070690_100121709 Ga0070690_1001217092 323
249 3300005334 Ga0068869_100005669 Ga0068869_1000056693 323
250 3300005334 Ga0068869_100009452 Ga0068869_1000094522 323
251 3300005334 Ga0068869_100045955 Ga0068869_1000459552 323
252 3300005335 Ga0070666_10032680 Ga0070666_100326802 323
253 3300005336 Ga0070680_100002408 Ga0070680_1000024087 323
254 3300005338 Ga0068868_100020616 Ga0068868_1000206162 323
255 3300005340 Ga0070689_100086927 Ga0070689_1000869272 323
256 3300005343 Ga0070687_100040085 Ga0070687_1000400852 323
257 3300005353 Ga0070669_100001613 Ga0070669_1000016136 323
258 3300005355 Ga0070671_100001580 Ga0070671_1000015806 323
259 3300005355 Ga0070671_100035874 Ga0070671_1000358743 323
260 3300005364 Ga0070673_100038097 Ga0070673_1000380973 323
261 3300005365 Ga0070688_100007597 Ga0070688_1000075975 323
262 3300005367 Ga0070667_100233619 Ga0070667_1002336192 323
263 3300005438 Ga0070701_10007401 Ga0070701_100074013 323
264 3300005440 Ga0070705_100116898 Ga0070705_1001168982 323
265 3300005441 Ga0070700_100028151 Ga0070700_1000281513 323
266 3300005444 Ga0070694_100014238 Ga0070694_1000142383 323
267 3300005458 Ga0070681_10000100 Ga0070681_1000010015 323
268 3300005459 Ga0068867_100024849 Ga0068867_1000248491 323
269 3300005466 Ga0070685_10075954 Ga0070685_100759542 323
270 3300005468 Ga0070707_100123228 Ga0070707_1001232283 323
271 3300005530 Ga0070679_100000819 Ga0070679_10000081910 323
272 3300005536 Ga0070697_100060604 Ga0070697_1000606043 323
273 3300005539 Ga0068853_100031870 Ga0068853_1000318704 323
274 3300005543 Ga0070672_100018243 Ga0070672_1000182433 323
275 3300005544 Ga0070686_100012452 Ga0070686_1000124524 323
276 3300005545 Ga0070695_100212295 Ga0070695_1002122951 323
277 3300005546 Ga0070696_100048904 Ga0070696_1000489042 323
278 3300005547 Ga0070693_100075534 Ga0070693_1000755342 323
279 3300005614 Ga0068856_100019645 Ga0068856_1000196453 323
280 3300005615 Ga0070702_100012309 Ga0070702_1000123093 323
281 3300005618 Ga0068864_100010017 Ga0068864_1000100176 323
282 3300005618 Ga0068864_100067381 Ga0068864_1000673812 323
283 3300005718 Ga0068866_10010069 Ga0068866_100100692 323
284 3300005719 Ga0068861_100196386 Ga0068861_1001963862 323
285 3300005834 Ga0068851_10092917 Ga0068851_100929171 323
286 3300005841 Ga0068863_100037389 Ga0068863_1000373892 323
287 3300005842 Ga0068858_100067147 Ga0068858_1000671472 323
288 3300005844 Ga0068862_100052886 Ga0068862_1000528863 323
289 3300006237 Ga0097621_100008887 Ga0097621_1000088873 323
290 3300006237 Ga0097621_100026436 Ga0097621_1000264362 323
291 3300006358 Ga0068871_100019002 Ga0068871_1000190023 323
292 3300006844 Ga0075428_100087047 Ga0075428_1000870472 323
293 3300006844 Ga0075428_100271474 Ga0075428_1002714742 323
294 3300006852 Ga0075433_10042928 Ga0075433_100429282 323
295 3300006880 Ga0075429_100052445 Ga0075429_1000524452 323
296 3300006881 Ga0068865_100009196 Ga0068865_1000091964 323
297 3300009098 Ga0105245_10031318 Ga0105245_100313183 323
298 3300009147 Ga0114129_10014519 Ga0114129_100145195 323
299 3300009148 Ga0105243_10014777 Ga0105243_100147774 323
300 3300009148 Ga0105243_10180766 Ga0105243_101807662 323
301 3300009174 Ga0105241_10070007 Ga0105241_100700072 323
302 3300009176 Ga0105242_10025407 Ga0105242_100254072 323
303 3300009177 Ga0105248_10121267 Ga0105248_101212672 323
304 3300009177 Ga0105248_10247519 Ga0105248_102475192 323
305 3300009553 Ga0105249_10095926 Ga0105249_100959263 323
306 3300010375 Ga0105239_10077267 Ga0105239_100772672 323
307 3300011119 Ga0105246_10066906 Ga0105246_100669063 323
308 3300013297 Ga0157378_10021461 Ga0157378_100214612 323
309 3300013297 Ga0157378_10061116 Ga0157378_100611163 323
310 3300013297 Ga0157378_10201356 Ga0157378_102013562 323
311 3300013306 Ga0163162_10498448 Ga0163162_104984482 323
312 3300013306 Ga0163162_10590644 Ga0163162_105906441 323
313 3300014325 Ga0163163_10015670 Ga0163163_100156705 323
314 3300014325 Ga0163163_10024482 Ga0163163_100244824 323
315 3300014326 Ga0157380_10005498 Ga0157380_100054982 323
316 3300014745 Ga0157377_10030363 Ga0157377_100303632 323
317 3300014969 Ga0157376_10004147 Ga0157376_100041472 323
318 3300017792 Ga0163161_10010034 Ga0163161_100100343 323
319 3300025254 Ga0209148_1000660 Ga0209148_100066023 323
320 3300025272 Ga0209455_1001949 Ga0209455_10019496 323
321 3300025315 Ga0207697_10004860 Ga0207697_100048604 323
322 3300025901 Ga0207688_10022756 Ga0207688_100227563 323
323 3300025903 Ga0207680_10162850 Ga0207680_101628502 323
324 3300025903 Ga0207680_10185772 Ga0207680_101857722 323
325 3300025907 Ga0207645_10142014 Ga0207645_101420142 323
326 3300025911 Ga0207654_10132528 Ga0207654_101325282 323
327 3300025912 Ga0207707_10000028 Ga0207707_1000002814 323
328 3300025918 Ga0207662_10212155 Ga0207662_102121552 323
329 3300025921 Ga0207652_10001456 Ga0207652_1000145613 323
330 3300025922 Ga0207646_10107049 Ga0207646_101070492 323
331 3300025923 Ga0207681_10021108 Ga0207681_100211083 323
332 3300025926 Ga0207659_10340751 Ga0207659_103407512 323
333 3300025931 Ga0207644_10051680 Ga0207644_100516802 323
334 3300025931 Ga0207644_10056131 Ga0207644_100561312 323
335 3300025933 Ga0207706_10069412 Ga0207706_100694122 323
336 3300025934 Ga0207686_10037691 Ga0207686_100376912 323
337 3300025936 Ga0207670_10058663 Ga0207670_100586632 323
338 3300025938 Ga0207704_10127450 Ga0207704_101274502 323
339 3300025940 Ga0207691_10002179 Ga0207691_100021792 323
340 3300025941 Ga0207711_10011584 Ga0207711_100115847 323
341 3300025941 Ga0207711_10067488 Ga0207711_100674882 323
342 3300025942 Ga0207689_10009911 Ga0207689_100099117 323
343 3300025942 Ga0207689_10036738 Ga0207689_100367383 323
344 3300025942 Ga0207689_10042553 Ga0207689_100425532 323
345 3300025942 Ga0207689_10117890 Ga0207689_101178902 323
346 3300025944 Ga0207661_10005005 Ga0207661_100050053 323
347 3300025945 Ga0207679_10123682 Ga0207679_101236822 323
348 3300025986 Ga0207658_10055458 Ga0207658_100554581 323
349 3300026075 Ga0207708_10004271 Ga0207708_100042713 323
350 3300026088 Ga0207641_10412116 Ga0207641_104121161 323
351 3300026095 Ga0207676_10006578 Ga0207676_100065782 323
352 3300026095 Ga0207676_10282923 Ga0207676_102829231 323
353 3300026118 Ga0207675_100020009 Ga0207675_1000200092 323
354 3300026121 Ga0207683_10440666 Ga0207683_104406662 323
355 3300028379 Ga0268266_10133736 Ga0268266_101337362 323
356 3300028380 Ga0268265_10047868 Ga0268265_100478682 323
357 3300028381 Ga0268264_10140613 Ga0268264_101406133 323
358 3300036401 Ga0373937_0208189 Ga0373937_0208189_535_1551 323
359 3300038996 Ga0242420_003553 Ga0242420_003553_432_1448 323
360 3300046472 Ga0495580_0108013 Ga0495580_0108013_167_1183 323
361 3300048907 Ga0496104_0054491 Ga0496104_0054491_2432_3448 323
362 3300048909 Ga0496106_0178938 Ga0496106_0178938_75_1091 323
363 3300048911 Ga0496108_0112658 Ga0496108_0112658_748_1764 323
364 3300050507 nmdc:mga05p37_84672_c1 nmdc:mga05p37_84672_c1_1773_2789 323
365 3300050508 nmdc:mga09592_47713_c1 nmdc:mga09592_47713_c1_2038_3054 323
366 3300050512 nmdc:mga0n895_304026_c1 nmdc:mga0n895_304026_c1_19_1035 323
367 3300050515 nmdc:mga0a205_12842_c1 nmdc:mga0a205_12842_c1_3522_4538 323
368 3300050515 nmdc:mga0a205_24376_c1 nmdc:mga0a205_24376_c1_1227_2243 323
369 3300009147 Ga0114129_10002234 Ga0114129_1000223423 324
370 3300050507 nmdc:mga05p37_31200_c1 nmdc:mga05p37_31200_c1_3205_4221 324
371 3300005330 Ga0070690_100066873 Ga0070690_1000668733 325
372 3300005438 Ga0070701_10101209 Ga0070701_101012091 325
373 3300005518 Ga0070699_100006468 Ga0070699_1000064688 325
374 3300005518 Ga0070699_100015295 Ga0070699_1000152952 325
375 3300013306 Ga0163162_10026770 Ga0163162_100267705 325
376 3300025912 Ga0207707_10025765 Ga0207707_100257654 325
377 3300041997 Ga0439431_0024046 Ga0439431_0024046_19_996 325
378 iso_pu_bacteria 2831905167 2831906551 325
379 iso_pu_bacteria 2548877040 2550904854 326
380 iso_pu_bacteria 2571042143 2571527341 326
381 iso_pu_bacteria 2576861424 2578335874 326
382 iso_pu_bacteria 2600255286 2601639586 326
383 iso_pu_bacteria 2728368933 2728532355 326
384 iso_pu_bacteria 2881636855 2881640782 326
385 iso_pu_bacteria 2888578766 2888583685 326
386 iso_pu_bacteria 2904113452 2904119730 326
387 iso_pu_bacteria 2907202186 2907204518 326
388 iso_pu_bacteria 2968558590 2968561057 326
389 iso_pu_bacteria 2971511577 2971514746 326
390 iso_pu_bacteria 2980176882 2980180854 326
391 iso_pu_bacteria 2988225383 2988228715 326
392 iso_pu_bacteria 2996632988 2996636179 326
393 iso_pu_bacteria 8054465665 8054466751 326
394 iso_pu_bacteria 8057733483 8057734472 326
395 3300005458 Ga0070681_10082520 Ga0070681_100825202 327
396 3300031251 Ga0265327_10034325 Ga0265327_100343253 327
397 3300031727 Ga0316576_10112307 Ga0316576_101123073 327
398 3300048911 Ga0496108_0435165 Ga0496108_0435165_96_1100 327
399 3300005331 Ga0070670_100120384 Ga0070670_1001203841 328
400 3300005336 Ga0070680_100011371 Ga0070680_1000113716 328
401 3300005339 Ga0070660_100173681 Ga0070660_1001736811 328
402 3300005340 Ga0070689_100380039 Ga0070689_1003800391 328
403 3300005364 Ga0070673_100151694 Ga0070673_1001516943 328
404 3300005366 Ga0070659_100024585 Ga0070659_1000245854 328
405 3300005457 Ga0070662_100075229 Ga0070662_1000752292 328
406 3300005458 Ga0070681_10009949 Ga0070681_100099492 328
407 3300005535 Ga0070684_100143700 Ga0070684_1001437002 328
408 3300005539 Ga0068853_100010775 Ga0068853_1000107755 328
409 3300005564 Ga0070664_100011274 Ga0070664_1000112743 328
410 3300005577 Ga0068857_100022785 Ga0068857_1000227853 328
411 3300013100 Ga0157373_10040457 Ga0157373_100404573 328
412 3300014325 Ga0163163_10090075 Ga0163163_100900752 328
413 3300025912 Ga0207707_10018373 Ga0207707_100183735 328
414 3300025917 Ga0207660_10176589 Ga0207660_101765891 328
415 3300025919 Ga0207657_10176329 Ga0207657_101763292 328
416 3300025920 Ga0207649_10125483 Ga0207649_101254832 328
417 3300025932 Ga0207690_10015288 Ga0207690_100152883 328
418 3300025936 Ga0207670_10251564 Ga0207670_102515641 328
419 3300025945 Ga0207679_10188564 Ga0207679_101885642 328
420 3300026041 Ga0207639_10027229 Ga0207639_100272292 328
421 3300026116 Ga0207674_10002025 Ga0207674_1000202510 328
422 3300005437 Ga0070710_10124254 Ga0070710_101242541 329
423 3300005937 Ga0081455_10080221 Ga0081455_100802212 329
424 3300025898 Ga0207692_10078558 Ga0207692_100785582 329
425 3300005437 Ga0070710_10002233 Ga0070710_100022334 330
426 3300009094 Ga0111539_10005862 Ga0111539_1000586211 330
427 3300021388 Ga0213875_10046844 Ga0213875_100468441 330
428 3300025915 Ga0207693_10000318 Ga0207693_1000031822 330
429 3300025916 Ga0207663_10140002 Ga0207663_101400022 330
430 3300025928 Ga0207700_10144911 Ga0207700_101449112 330
431 3300027907 Ga0207428_10127532 Ga0207428_101275322 330
432 3300035724 Ga0373933_0008354 Ga0373933_0008354_17_1012 330
433 3300036401 Ga0373937_0033200 Ga0373937_0033200_3326_4321 330
434 3300036401 Ga0373937_0212098 Ga0373937_0212098_74_1072 330
435 3300037853 Ga0436364_0271519 Ga0436364_0271519_151_1146 330
436 3300037853 Ga0436364_0445774 Ga0436364_0445774_2713_3708 330
437 3300039437 Ga0436365_0538543 Ga0436365_0538543_795_1790 330
438 3300039450 Ga0436363_0705637 Ga0436363_0705637_66_1061 330
439 3300039450 Ga0436363_1339971 Ga0436363_1339971_4489_5484 330
440 3300044656 Ga0466969_0013288 Ga0466969_0013288_2269_3264 330
441 3300044694 Ga0466963_0014264 Ga0466963_0014264_559_1554 330
442 3300044694 Ga0466963_0019687 Ga0466963_0019687_1861_2856 330
443 3300044765 Ga0466970_0018802 Ga0466970_0018802_1865_2860 330
444 3300045049 Ga0466959_0002972 Ga0466959_0002972_1732_2727 330
445 3300045976 Ga0466967_0008112 Ga0466967_0008112_3015_4010 330
446 3300046462 Ga0495651_0019189 Ga0495651_0019189_3030_4025 330
447 3300046463 Ga0495653_0043766 Ga0495653_0043766_1323_2318 330
448 3300046477 Ga0495664_0087972 Ga0495664_0087972_164_1159 330
449 3300046511 Ga0495608_0019074 Ga0495608_0019074_1302_2297 330
450 3300046517 Ga0495630_0146197 Ga0495630_0146197_423_1418 330
451 3300046529 Ga0495652_0057374 Ga0495652_0057374_1906_2901 330
452 3300046536 Ga0495587_0069140 Ga0495587_0069140_908_1903 330
453 3300046559 Ga0495667_0023983 Ga0495667_0023983_2037_3032 330
454 3300046663 Ga0495635_0053247 Ga0495635_0053247_251_1246 330
455 3300046675 Ga0495657_0047966 Ga0495657_0047966_553_1548 330
456 3300046680 Ga0495646_0009781 Ga0495646_0009781_4655_5650 330
457 3300047317 Ga0495604_0165329 Ga0495604_0165329_421_1416 330
458 3300047322 Ga0495680_0026856 Ga0495680_0026856_3227_4222 330
459 3300047472 Ga0495686_0050119 Ga0495686_0050119_334_1332 330
460 3300047673 Ga0495593_0102753 Ga0495593_0102753_392_1387 330
461 3300048088 Ga0495602_0006880 Ga0495602_0006880_9542_10537 330
462 3300048904 Ga0496101_0046537 Ga0496101_0046537_1339_2334 330
463 3300048907 Ga0496104_0036380 Ga0496104_0036380_2494_3489 330
464 3300048913 Ga0496110_0315758 Ga0496110_0315758_397_1392 330
465 3300048914 Ga0496111_0069275 Ga0496111_0069275_1230_2225 330
466 3300048916 Ga0496113_0125312 Ga0496113_0125312_26_1021 330
467 3300048917 Ga0496114_0054971 Ga0496114_0054971_425_1420 330
468 3300048918 Ga0496115_0172453 Ga0496115_0172453_397_1392 330
469 3300050511 nmdc:mga08y16_97731_c1 nmdc:mga08y16_97731_c1_907_1923 330
470 3300053077 Ga0495601_0031787 Ga0495601_0031787_1624_2619 330
471 3300053085 Ga0495619_0010545 Ga0495619_0010545_4247_5242 330
472 3300005366 Ga0070659_100121512 Ga0070659_1001215122 331
473 3300009148 Ga0105243_10029250 Ga0105243_100292503 331
474 3300025932 Ga0207690_10092340 Ga0207690_100923402 331
475 3300025935 Ga0207709_10008475 Ga0207709_100084753 331
476 3300026089 Ga0207648_10019959 Ga0207648_100199595 331
477 3300050491 nmdc:mga00v17_133220_c1 nmdc:mga00v17_133220_c1_543_1544 331
478 3300005842 Ga0068858_100261606 Ga0068858_1002616062 332
479 3300025941 Ga0207711_10217929 Ga0207711_102179292 332
480 3300031691 Ga0316579_10011676 Ga0316579_100116763 332
481 3300035398 Ga0316574_0051177 Ga0316574_0051177_832_1830 332
482 3300045836 Ga0466958_0040734 Ga0466958_0040734_105_1181 332
483 3300048916 Ga0496113_0161262 Ga0496113_0161262_16_1032 332
484 3300005331 Ga0070670_100306795 Ga0070670_1003067952 334
485 3300025925 Ga0207650_10076882 Ga0207650_100768822 334
486 iso_pu_bacteria 2558860983 2561468977 334
487 iso_pu_bacteria 2909399089 2909399500 334
488 iso_pu_bacteria 2917554339 2917557230 334
489 iso_pu_bacteria 641228493 641333991 334
490 iso_pu_bacteria 643348555 643391308 334
491 3300005549 Ga0070704_100432237 Ga0070704_1004322371 336
492 3300005985 Ga0081539_10000508 Ga0081539_100005087 336
493 3300025939 Ga0207665_10087381 Ga0207665_100873812 337
494 3300002076 JGI24749J21850_1006202 JGI24749J21850_10062022 338
495 3300002459 JGI24751J29686_10000033 JGI24751J29686_1000003352 338
496 3300005290 Ga0065712_10085068 Ga0065712_100850682 338
497 3300005293 Ga0065715_10003712 Ga0065715_100037123 338
498 3300005293 Ga0065715_10172168 Ga0065715_101721681 338
499 3300005327 Ga0070658_10021878 Ga0070658_100218784 338
500 3300005331 Ga0070670_100000142 Ga0070670_10000014212 338
501 3300005334 Ga0068869_100176394 Ga0068869_1001763941 338
502 3300005337 Ga0070682_100046342 Ga0070682_1000463422 338
503 3300005345 Ga0070692_10012645 Ga0070692_100126453 338
504 3300005441 Ga0070700_100042291 Ga0070700_1000422911 338
505 3300005468 Ga0070707_100004557 Ga0070707_1000045572 338
506 3300005471 Ga0070698_100026846 Ga0070698_1000268462 338
507 3300005539 Ga0068853_100521222 Ga0068853_1005212221 338
508 3300005549 Ga0070704_100113277 Ga0070704_1001132771 338
509 3300005578 Ga0068854_100026868 Ga0068854_1000268683 338
510 3300005578 Ga0068854_100173123 Ga0068854_1001731232 338
511 3300005617 Ga0068859_100020140 Ga0068859_1000201405 338
512 3300005617 Ga0068859_100026381 Ga0068859_1000263812 338
513 3300005617 Ga0068859_100261534 Ga0068859_1002615342 338
514 3300005618 Ga0068864_100190398 Ga0068864_1001903982 338
515 3300005618 Ga0068864_100210056 Ga0068864_1002100562 338
516 3300005843 Ga0068860_100050865 Ga0068860_1000508654 338
517 3300005843 Ga0068860_100087896 Ga0068860_1000878962 338
518 3300005843 Ga0068860_100108354 Ga0068860_1001083541 338
519 3300005844 Ga0068862_100333216 Ga0068862_1003332162 338
520 3300005985 Ga0081539_10002393 Ga0081539_1000239323 338
521 3300006051 Ga0075364_10098589 Ga0075364_100985892 338
522 3300006846 Ga0075430_100019767 Ga0075430_1000197675 338
523 3300006846 Ga0075430_100162599 Ga0075430_1001625992 338
524 3300006931 Ga0097620_100020141 Ga0097620_1000201415 338
525 3300006931 Ga0097620_100026381 Ga0097620_1000263814 338
526 3300006931 Ga0097620_100261524 Ga0097620_1002615242 338
527 3300009094 Ga0111539_10004239 Ga0111539_1000423911 338
528 3300009101 Ga0105247_10000940 Ga0105247_1000094012 338
529 3300009147 Ga0114129_10452895 Ga0114129_104528952 338
530 3300009176 Ga0105242_10060882 Ga0105242_100608822 338
531 3300009177 Ga0105248_10076243 Ga0105248_100762432 338
532 3300009545 Ga0105237_10233320 Ga0105237_102333202 338
533 3300009551 Ga0105238_10013757 Ga0105238_100137575 338
534 3300013306 Ga0163162_10426979 Ga0163162_104269791 338
535 3300013307 Ga0157372_10359897 Ga0157372_103598972 338
536 3300014325 Ga0163163_10000333 Ga0163163_100003337 338
537 3300025900 Ga0207710_10001235 Ga0207710_1000123512 338
538 3300025904 Ga0207647_10035570 Ga0207647_100355703 338
539 3300025908 Ga0207643_10035840 Ga0207643_100358403 338
540 3300025908 Ga0207643_10051910 Ga0207643_100519102 338
541 3300025913 Ga0207695_10233495 Ga0207695_102334952 338
542 3300025922 Ga0207646_10002372 Ga0207646_100023723 338
543 3300025924 Ga0207694_10007727 Ga0207694_100077273 338
544 3300025924 Ga0207694_10027497 Ga0207694_100274973 338
545 3300025925 Ga0207650_10000046 Ga0207650_1000004650 338
546 3300025934 Ga0207686_10032073 Ga0207686_100320732 338
547 3300025942 Ga0207689_10079236 Ga0207689_100792362 338
548 3300025960 Ga0207651_10253147 Ga0207651_102531471 338
549 3300026075 Ga0207708_10026319 Ga0207708_100263193 338
550 3300026075 Ga0207708_10044244 Ga0207708_100442442 338
551 3300026088 Ga0207641_10114736 Ga0207641_101147362 338
552 3300026116 Ga0207674_10368376 Ga0207674_103683761 338
553 3300026118 Ga0207675_100006381 Ga0207675_1000063813 338
554 3300026118 Ga0207675_100119053 Ga0207675_1001190532 338
555 3300027907 Ga0207428_10009788 Ga0207428_100097883 338
556 3300028380 Ga0268265_10191454 Ga0268265_101914541 338
557 3300028381 Ga0268264_10062848 Ga0268264_100628482 338
558 3300028577 Ga0265318_10033209 Ga0265318_100332092 338
559 3300038996 Ga0242420_001887 Ga0242420_001887_1396_2412 338
560 3300041496 Ga0451839_0056850 Ga0451839_0056850_253_1311 338
561 3300047322 Ga0495680_0091922 Ga0495680_0091922_46_1116 338
562 3300048915 Ga0496112_0251503 Ga0496112_0251503_326_1342 338
563 3300049570 Ga0501033_0000050 Ga0501033_0000050_47717_48736 338
564 3300050507 nmdc:mga05p37_275865_c1 nmdc:mga05p37_275865_c1_25_1041 338
565 3300050509 nmdc:mga0qj67_66473_c1 nmdc:mga0qj67_66473_c1_1367_2383 338
566 3300050510 nmdc:mga06r32_165414_c1 nmdc:mga06r32_165414_c1_143_1159 338
567 3300053108 Ga0500562_003616 Ga0500562_003616_2327_3508 338
568 3300053161 Ga0500634_0000015 Ga0500634_0000015_91037_92056 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01450

IlvC

Acetohydroxy acid isomeroreductase, catalytic domain

208

351

1

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

38

202

0.99

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

24

113

0.88

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

43

137

0.83

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

43

128

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l2i-assembly1.cif.gz_B ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_wt 0.985 1 323
8ep7-assembly1.cif.gz_A-2 crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with nadp 0.9838 2 323
5yeq-assembly1.cif.gz_B the structure of sac-kari protein 0.9821 1 324
6l2k-assembly1.cif.gz_B ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_r49e 0.9803 1 325
6l2i-assembly1.cif.gz_B ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_wt 0.979 1 323
ID Description Score Start End Superfamily
af_P9WKJ7_1_183_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9948 1 181 3.40.50.720
4xdyB02 Special;Helix non-globular;ProC C-terminal domain-like fold; 0.9867 182 322 6.10.240.10
4xdyA02 Special;Helix non-globular;ProC C-terminal domain-like fold; 0.986 182 322 6.10.240.10
af_P9WKJ7_184_337_6.10.240.10 Special;Helix non-globular;ProC C-terminal domain-like fold; 0.9853 182 327 6.10.240.10
4xiyA02 Special;Helix non-globular;ProC C-terminal domain-like fold; 0.9852 182 327 6.10.240.10
ID Description Score Start End GO Terms
AF-A0A6P1B4K2-F1-model_v4 deleted 0.9995 14 93
AF-A0A3D4NM10-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9969 106 194 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
GO:0046872
AF-A0A6V8P8H2-F1-model_v4 Ketol-acid reductoisomerase 0.9968 102 195 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-W1XVF2-F1-model_v4 Ketol-acid reductoisomerase 0.9963 107 196 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-A0A7C5RA88-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9961 1 198 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.21 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map