F464667

General Info

Members Datasets Scaffolds Average Seq Length
568 191 1130 399

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0002090|Ga0495583_0002090_7402_8715
Length 437
Sequence VYFLLSNFPAQVASKFELPRGFLQHTFTSFLGGLPMSFEPLKGLRVLDLTSVVVGPVCTWRLAQYGAEVIKVESPEGDLMRGLGGQSPTGQHSGTYLHFNRGKRNICLDLKKAGAKQAIDRLVASSDVIVANMRPQALERLGLDAASIRKRYPDKVYCLITGYGTDGPYAGQPTYDSVVQGATGMAGLTLARDGTPTYVPMLICDHVSGEIAAGAILAALAERKASGKGCSIEVPMFETMAAFVLQEHLAQQSFDPPVGPAGDSRLLSPHNKPVATADGWISFTVNTDAQVRAFLKTTDRHSLLDDPRFSSVAARARNVKQWFEIRGAPLTSRTTAEWLAVLREADIAVQPCNTLESLQHDPHLEAVGLIRFEEHPTEGKTAAIRSTIRFDEAYPPLRAPSQPQGWDTRTVLQELGYADDEVADLLKDGDAIATPAI

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
3 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
4 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
5 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
6 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
9 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
10 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
13 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
14 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
15 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
18 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
19 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
20 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
21 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
22 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
23 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
24 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
25 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
26 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
27 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
28 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
29 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
30 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
31 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
32 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
33 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
34 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
35 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
36 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
37 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
38 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
39 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
40 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
41 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
42 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
43 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
44 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
45 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
46 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
47 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
48 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
49 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
50 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
51 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
52 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
53 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
54 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
55 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
56 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
57 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
58 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
61 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
62 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
65 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
76 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
77 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
78 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
79 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
80 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
87 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
100 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
101 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
102 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
103 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
112 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
123 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
124 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
127 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
128 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
129 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
134 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
135 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
136 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
137 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
138 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
139 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
140 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
143 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
144 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
145 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
148 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
151 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
152 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
156 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
157 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
158 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
159 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
160 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
163 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
164 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
165 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
168 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
169 2511231016 Pseudomonas sp. GM50 Isolate Nodule
170 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
171 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
172 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
173 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
174 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
175 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
176 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
177 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
178 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
179 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
180 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
181 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
182 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
183 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
184 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
185 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
186 2738541277 Variovorax sp. GV051 Isolate Unclassified
187 2738543019 Variovorax sp. GV040 Isolate Unclassified
188 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
189 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
190 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
191 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 0
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.88
Nodule 0.18
Rhizoplane 0
Rhizosphere 69.01
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0002090 3300046506 Bacteria 18019
2 Ga0075365_10000094 3300006038 Bacteria 25917
3 Ga0075368_10000101 3300006042 Bacteria 21910
4 Ga0075368_10001195 3300006042 Bacteria 8200
5 Ga0075363_100000004 3300006048 Bacteria 61740
6 Ga0075363_100047302 3300006048 Bacteria 2284
7 Ga0075364_10000004 3300006051 Bacteria 110554
8 Ga0075364_10000140 3300006051 Bacteria 31249
9 Ga0075362_10000009 3300006177 Bacteria 111748
10 Ga0075362_10000194 3300006177 Bacteria 16984
11 Ga0075367_10000018 3300006178 Bacteria 34198
12 Ga0075367_10006718 3300006178 Bacteria 5837
13 Ga0075369_10000011 3300006186 Bacteria 76681
14 Ga0075369_10000061 3300006186 Bacteria 28090
15 Ga0075366_10000085 3300006195 Bacteria 36576
16 Ga0075370_10000050 3300006353 Bacteria 36486
17 Ga0075370_10000071 3300006353 Bacteria 31090
18 Ga0075370_10001571 3300006353 Bacteria 10034
19 Ga0075428_100461403 3300006844 Bacteria 1360
20 Ga0209813_10004031 3300027866 Bacteria 3480
21 Ga0307517_10000160 3300028786 Bacteria 108370
22 Ga0307517_10109027 3300028786 Bacteria 2121
23 Ga0307515_10002570 3300028794 Bacteria 39179
24 Ga0307515_10010552 3300028794 Bacteria 17690
25 Ga0307515_10015010 3300028794 Bacteria 14308
26 Ga0307515_10079468 3300028794 Bacteria 4296
27 Ga0307515_10191109 3300028794 Bacteria 1957
28 Ga0307512_10037182 3300030522 Bacteria 4116
29 Ga0307512_10080008 3300030522 Bacteria 2356
30 Ga0307513_10117954 3300031456 Bacteria 2630
31 Ga0307509_10000317 3300031507 Bacteria 79032
32 Ga0307509_10004066 3300031507 Bacteria 21456
33 Ga0307509_10133156 3300031507 Bacteria 2437
34 Ga0307508_10000332 3300031616 Bacteria 57039
35 Ga0307508_10001814 3300031616 Bacteria 23664
36 Ga0307508_10013354 3300031616 Bacteria 7510
37 Ga0307514_10001524 3300031649 Bacteria 27729
38 Ga0307514_10010094 3300031649 Bacteria 7906
39 Ga0307516_10126841 3300031730 Bacteria 2336
40 Ga0307507_10094876 3300033179 Bacteria 2533
41 Ga0307510_10013175 3300033180 Bacteria 9808
42 Ga0307510_10038423 3300033180 Bacteria 5292
43 Ga0307510_10056062 3300033180 Bacteria 4108
44 Ga0307510_10057800 3300033180 Bacteria 4022
45 Ga0373923_0064244 3300035111 Bacteria 1565
46 Ga0373927_0007910 3300035695 Bacteria 7183
47 Ga0373927_0056037 3300035695 Bacteria 2548
48 Ga0373947_0038636 3300035725 Bacteria 2837
49 Ga0439465_0063181 3300041413 Bacteria 1230
50 Ga0495617_000129 3300046452 Bacteria 50053
51 Ga0495617_003129 3300046452 Bacteria 6302
52 Ga0495617_011158 3300046452 Bacteria 3071
53 Ga0495627_000329 3300046453 Bacteria 45500
54 Ga0495627_002452 3300046453 Bacteria 8925
55 Ga0495592_0000175 3300046454 Bacteria 56416
56 Ga0495592_0000273 3300046454 Bacteria 44143
57 Ga0495603_0068267 3300046455 Unclassified 2092
58 Ga0495590_0001918 3300046457 Bacteria 8803
59 Ga0495590_0008084 3300046457 Bacteria 4029
60 Ga0495590_0010076 3300046457 Bacteria 3567
61 Ga0495590_0022154 3300046457 Bacteria 2248
62 Ga0495590_0037180 3300046457 Bacteria 1698
63 Ga0495591_000008 3300046458 Bacteria 353558
64 Ga0495591_000053 3300046458 Bacteria 135500
65 Ga0495591_001488 3300046458 Bacteria 14490
66 Ga0495591_013613 3300046458 Bacteria 2963
67 Ga0495629_0000085 3300046459 Bacteria 83152
68 Ga0495638_0000022 3300046460 Bacteria 364765
69 Ga0495638_0000141 3300046460 Bacteria 114543
70 Ga0495638_0000183 3300046460 Bacteria 95741
71 Ga0495638_0003759 3300046460 Bacteria 11801
72 Ga0495638_0024662 3300046460 Bacteria 3917
73 Ga0495638_0069918 3300046460 Bacteria 2150
74 Ga0495653_0000176 3300046463 Bacteria 52724
75 Ga0495653_0001499 3300046463 Bacteria 18244
76 Ga0495653_0082224 3300046463 Bacteria 2378
77 Ga0495650_0000073 3300046471 Bacteria 253286
78 Ga0495650_0000164 3300046471 Bacteria 147142
79 Ga0495650_0000180 3300046471 Bacteria 137884
80 Ga0495650_0001323 3300046471 Bacteria 24912
81 Ga0495650_0002312 3300046471 Bacteria 15805
82 Ga0495650_0093377 3300046471 Unclassified 1141
83 Ga0495580_0004929 3300046472 Bacteria 11156
84 Ga0495605_0000040 3300046474 Bacteria 193955
85 Ga0495605_0000272 3300046474 Bacteria 58560
86 Ga0495605_0003592 3300046474 Bacteria 9190
87 Ga0495605_0009911 3300046474 Bacteria 5342
88 Ga0495605_0017968 3300046474 Bacteria 3798
89 Ga0495605_0034615 3300046474 Bacteria 2557
90 Ga0495664_0009069 3300046477 Bacteria 5561
91 Ga0495664_0119025 3300046477 Bacteria 1597
92 Ga0495584_0000020 3300046491 Bacteria 132682
93 Ga0495584_0000179 3300046491 Bacteria 44738
94 Ga0495584_0000262 3300046491 Bacteria 37590
95 Ga0495584_0003161 3300046491 Bacteria 9151
96 Ga0495584_0010646 3300046491 Bacteria 4723
97 Ga0495584_0012645 3300046491 Bacteria 4308
98 Ga0495585_0009223 3300046492 Bacteria 5933
99 Ga0495585_0010400 3300046492 Bacteria 5540
100 Ga0495585_0033171 3300046492 Bacteria 2924
101 Ga0495596_0000016 3300046500 Bacteria 117489
102 Ga0495596_0000025 3300046500 Bacteria 106069
103 Ga0495596_0000177 3300046500 Bacteria 44496
104 Ga0495596_0002627 3300046500 Bacteria 9518
105 Ga0495596_0003361 3300046500 Bacteria 8130
106 Ga0495607_0000047 3300046501 Bacteria 121696
107 Ga0495607_0000152 3300046501 Bacteria 72216
108 Ga0495607_0000624 3300046501 Bacteria 34369
109 Ga0495607_0001729 3300046501 Bacteria 18707
110 Ga0495607_0005688 3300046501 Bacteria 8882
111 Ga0495607_0005955 3300046501 Bacteria 8647
112 Ga0495607_0056032 3300046501 Bacteria 2264
113 Ga0495583_0000014 3300046506 Bacteria 320136
114 Ga0495583_0000032 3300046506 Bacteria 247728
115 Ga0495583_0000114 3300046506 Bacteria 136026
116 Ga0495583_0000127 3300046506 Bacteria 127780
117 Ga0495583_0000471 3300046506 Bacteria 59495
118 Ga0495583_0005946 3300046506 Bacteria 8101
119 Ga0495583_0014416 3300046506 Bacteria 4363
120 Ga0495583_0043799 3300046506 Bacteria 2081
121 Ga0495583_0045013 3300046506 Bacteria 2043
122 Ga0495606_0001415 3300046507 Bacteria 32260
123 Ga0495606_0005810 3300046507 Bacteria 11643
124 Ga0495606_0006083 3300046507 Bacteria 11267
125 Ga0495606_0040305 3300046507 Bacteria 3140
126 Ga0495606_0045402 3300046507 Bacteria 2912
127 Ga0495606_0059172 3300046507 Unclassified 2459
128 Ga0495610_0000797 3300046512 Bacteria 29566
129 Ga0495610_0001540 3300046512 Bacteria 20312
130 Ga0495610_0008505 3300046512 Bacteria 6630
131 Ga0495610_0023671 3300046512 Unclassified 3331
132 Ga0495616_0000950 3300046513 Bacteria 20830
133 Ga0495616_0002008 3300046513 Bacteria 13692
134 Ga0495616_0002976 3300046513 Bacteria 11001
135 Ga0495616_0008314 3300046513 Bacteria 6155
136 Ga0495616_0013438 3300046513 Bacteria 4618
137 Ga0495616_0015863 3300046513 Bacteria 4178
138 Ga0495616_0027556 3300046513 Bacteria 3014
139 Ga0495620_0000045 3300046515 Bacteria 109595
140 Ga0495620_0006235 3300046515 Bacteria 6568
141 Ga0495620_0053938 3300046515 Bacteria 1701
142 Ga0495628_0032648 3300046516 Bacteria 4201
143 Ga0495628_0042581 3300046516 Bacteria 3621
144 Ga0495630_0009662 3300046517 Bacteria 6936
145 Ga0495630_0055776 3300046517 Unclassified 2961
146 Ga0495630_0108127 3300046517 Bacteria 2107
147 Ga0495631_0003800 3300046518 Bacteria 8210
148 Ga0495631_0009794 3300046518 Bacteria 4772
149 Ga0495631_0027943 3300046518 Bacteria 2577
150 Ga0495631_0029441 3300046518 Unclassified 2497
151 Ga0495632_0000053 3300046519 Bacteria 131977
152 Ga0495632_0000086 3300046519 Bacteria 95327
153 Ga0495632_0000284 3300046519 Bacteria 49472
154 Ga0495632_0000448 3300046519 Bacteria 39223
155 Ga0495632_0000743 3300046519 Bacteria 29431
156 Ga0495632_0000921 3300046519 Bacteria 25800
157 Ga0495632_0002866 3300046519 Bacteria 12724
158 Ga0495632_0003155 3300046519 Bacteria 11917
159 Ga0495632_0015316 3300046519 Bacteria 4305
160 Ga0495632_0034534 3300046519 Bacteria 2587
161 Ga0495632_0075011 3300046519 Bacteria 1619
162 Ga0495637_0000197 3300046520 Bacteria 47128
163 Ga0495637_0000340 3300046520 Bacteria 36022
164 Ga0495637_0000686 3300046520 Bacteria 23330
165 Ga0495637_0002056 3300046520 Bacteria 11319
166 Ga0495637_0002710 3300046520 Bacteria 9648
167 Ga0495637_0003460 3300046520 Bacteria 8392
168 Ga0495637_0005751 3300046520 Bacteria 6286
169 Ga0495637_0017226 3300046520 Bacteria 3372
170 Ga0495643_0000061 3300046522 Bacteria 185933
171 Ga0495643_0000298 3300046522 Bacteria 69615
172 Ga0495643_0000666 3300046522 Bacteria 40418
173 Ga0495643_0006763 3300046522 Bacteria 7498
174 Ga0495643_0011875 3300046522 Bacteria 5279
175 Ga0495643_0015832 3300046522 Bacteria 4444
176 Ga0495643_0026918 3300046522 Bacteria 3238
177 Ga0495643_0028241 3300046522 Bacteria 3147
178 Ga0495643_0062735 3300046522 Bacteria 1967
179 Ga0495643_0062779 3300046522 Bacteria 1966
180 Ga0495644_0000087 3300046523 Bacteria 46212
181 Ga0495644_0000164 3300046523 Bacteria 31315
182 Ga0495644_0007667 3300046523 Bacteria 4163
183 Ga0495644_0021574 3300046523 Unclassified 2457
184 Ga0495648_0000051 3300046524 Bacteria 162502
185 Ga0495648_0000476 3300046524 Bacteria 43122
186 Ga0495648_0001810 3300046524 Bacteria 20595
187 Ga0495648_0003221 3300046524 Bacteria 14474
188 Ga0495648_0004393 3300046524 Bacteria 12058
189 Ga0495648_0011425 3300046524 Bacteria 6689
190 Ga0495648_0017922 3300046524 Bacteria 5040
191 Ga0495648_0029371 3300046524 Bacteria 3650
192 Ga0495648_0030881 3300046524 Bacteria 3535
193 Ga0495648_0064778 3300046524 Bacteria 2152
194 Ga0495663_0000012 3300046525 Bacteria 157546
195 Ga0495663_0000263 3300046525 Bacteria 20187
196 Ga0495663_0001724 3300046525 Bacteria 6785
197 Ga0495666_0001202 3300046526 Bacteria 12499
198 Ga0495666_0001954 3300046526 Bacteria 10157
199 Ga0495666_0012951 3300046526 Bacteria 4156
200 Ga0495666_0069768 3300046526 Bacteria 1672
201 Ga0495666_0071867 3300046526 Unclassified 1644
202 Ga0495642_0000484 3300046528 Bacteria 20442
203 Ga0495642_0005467 3300046528 Bacteria 4880
204 Ga0495642_0014352 3300046528 Bacteria 3068
205 Ga0495642_0030150 3300046528 Bacteria 2169
206 Ga0495652_0198173 3300046529 Bacteria 1526
207 Ga0495654_0000084 3300046530 Bacteria 107326
208 Ga0495654_0000565 3300046530 Bacteria 29730
209 Ga0495654_0002151 3300046530 Bacteria 12850
210 Ga0495654_0002802 3300046530 Bacteria 10986
211 Ga0495654_0003342 3300046530 Bacteria 9888
212 Ga0495654_0039593 3300046530 Bacteria 2352
213 Ga0495654_0051594 3300046530 Bacteria 2006
214 Ga0495665_0007602 3300046531 Bacteria 5869
215 Ga0495587_0000054 3300046536 Bacteria 97507
216 Ga0495587_0013401 3300046536 Bacteria 5154
217 Ga0495609_0000044 3300046538 Bacteria 161642
218 Ga0495609_0001626 3300046538 Bacteria 14655
219 Ga0495609_0001976 3300046538 Bacteria 12983
220 Ga0495609_0004460 3300046538 Bacteria 7653
221 Ga0495609_0005108 3300046538 Bacteria 6994
222 Ga0495621_0002424 3300046539 Bacteria 5028
223 Ga0495597_0000865 3300046542 Bacteria 23729
224 Ga0495597_0003700 3300046542 Bacteria 8765
225 Ga0495597_0021765 3300046542 Bacteria 2980
226 Ga0495597_0085863 3300046542 Bacteria 1340
227 Ga0495645_0000420 3300046543 Bacteria 29291
228 Ga0495645_0002987 3300046543 Bacteria 11446
229 Ga0495645_0042953 3300046543 Bacteria 3297
230 Ga0495622_0000024 3300046557 Bacteria 154056
231 Ga0495622_0000557 3300046557 Bacteria 22389
232 Ga0495622_0000889 3300046557 Bacteria 16295
233 Ga0495622_0007306 3300046557 Bacteria 5128
234 Ga0495633_0004018 3300046558 Bacteria 9521
235 Ga0495633_0004875 3300046558 Bacteria 8393
236 Ga0495633_0029448 3300046558 Bacteria 2672
237 Ga0495656_0001795 3300046615 Bacteria 7051
238 Ga0495656_0002471 3300046615 Bacteria 6150
239 Ga0495656_0011414 3300046615 Bacteria 3261
240 Ga0495656_0027614 3300046615 Bacteria 2268
241 Ga0495656_0075946 3300046615 Bacteria 1504
242 Ga0495668_0000287 3300046616 Bacteria 69408
243 Ga0495668_0023648 3300046616 Bacteria 3502
244 Ga0495668_0108370 3300046616 Bacteria 1519
245 Ga0495634_0000169 3300046642 Bacteria 60237
246 Ga0495611_0000134 3300046648 Bacteria 51892
247 Ga0495611_0000448 3300046648 Bacteria 25003
248 Ga0495611_0000769 3300046648 Bacteria 17966
249 Ga0495611_0007111 3300046648 Bacteria 4753
250 Ga0495611_0008093 3300046648 Bacteria 4462
251 Ga0495625_0000016 3300046660 Bacteria 311353
252 Ga0495625_0001351 3300046660 Bacteria 30318
253 Ga0495625_0002776 3300046660 Bacteria 18479
254 Ga0495625_0009988 3300046660 Bacteria 7894
255 Ga0495625_0023278 3300046660 Bacteria 4733
256 Ga0495625_0025370 3300046660 Bacteria 4497
257 Ga0495625_0051607 3300046660 Bacteria 2948
258 Ga0495625_0054266 3300046660 Bacteria 2863
259 Ga0495625_0057305 3300046660 Bacteria 2771
260 Ga0495625_0057950 3300046660 Bacteria 2753
261 Ga0495625_0136447 3300046660 Bacteria 1658
262 Ga0495635_0000033 3300046663 Bacteria 104638
263 Ga0495635_0000035 3300046663 Bacteria 96395
264 Ga0495659_0000325 3300046664 Bacteria 18827
265 Ga0495659_0004762 3300046664 Bacteria 4273
266 Ga0495659_0005557 3300046664 Bacteria 3967
267 Ga0495661_0000001 3300046665 Bacteria 898372
268 Ga0495661_0000554 3300046665 Bacteria 38651
269 Ga0495661_0000722 3300046665 Bacteria 32461
270 Ga0495661_0003376 3300046665 Bacteria 11825
271 Ga0495661_0006832 3300046665 Bacteria 7989
272 Ga0495661_0012066 3300046665 Bacteria 5845
273 Ga0495661_0015468 3300046665 Bacteria 5094
274 Ga0495661_0067543 3300046665 Unclassified 2100
275 Ga0495588_0000664 3300046674 Bacteria 15931
276 Ga0495588_0001867 3300046674 Bacteria 8980
277 Ga0495588_0003788 3300046674 Bacteria 6626
278 Ga0495588_0005450 3300046674 Bacteria 5663
279 Ga0495588_0008269 3300046674 Bacteria 4767
280 Ga0495588_0016076 3300046674 Bacteria 3612
281 Ga0495588_0031632 3300046674 Bacteria 2664
282 Ga0495588_0032744 3300046674 Bacteria 2621
283 Ga0495623_0000189 3300046679 Bacteria 39192
284 Ga0495623_0076289 3300046679 Bacteria 2080
285 Ga0495646_0000059 3300046680 Bacteria 52693
286 Ga0495646_0000704 3300046680 Bacteria 18491
287 Ga0495646_0013280 3300046680 Bacteria 5234
288 Ga0495646_0041332 3300046680 Bacteria 2834
289 Ga0495646_0051717 3300046680 Bacteria 2485
290 Ga0495647_0000282 3300046681 Bacteria 14145
291 Ga0495658_0001272 3300046683 Bacteria 13253
292 Ga0495658_0006837 3300046683 Bacteria 5617
293 Ga0495669_0000091 3300046684 Bacteria 59795
294 Ga0495669_0014973 3300046684 Bacteria 3318
295 Ga0495669_0039461 3300046684 Bacteria 2091
296 Ga0495624_0000014 3300046690 Bacteria 111102
297 Ga0495624_0001032 3300046690 Bacteria 21928
298 Ga0495624_0002583 3300046690 Bacteria 13692
299 Ga0495624_0011052 3300046690 Bacteria 6215
300 Ga0495624_0190177 3300046690 Unclassified 1249
301 Ga0495670_0000018 3300046691 Bacteria 115019
302 Ga0495670_0000026 3300046691 Bacteria 90929
303 Ga0495670_0000064 3300046691 Bacteria 47436
304 Ga0495670_0005461 3300046691 Bacteria 6240
305 Ga0495671_0000004 3300046692 Bacteria 545630
306 Ga0495671_0000036 3300046692 Bacteria 181192
307 Ga0495671_0000079 3300046692 Bacteria 93288
308 Ga0495671_0001366 3300046692 Bacteria 16554
309 Ga0495671_0002376 3300046692 Bacteria 11940
310 Ga0495671_0018414 3300046692 Bacteria 3707
311 Ga0495671_0067438 3300046692 Bacteria 1760
312 Ga0495649_0000480 3300046694 Bacteria 34342
313 Ga0495649_0000978 3300046694 Bacteria 22513
314 Ga0495649_0004222 3300046694 Bacteria 9424
315 Ga0495649_0009739 3300046694 Bacteria 5692
316 Ga0495649_0022361 3300046694 Bacteria 3538
317 Ga0495649_0027487 3300046694 Bacteria 3157
318 Ga0495649_0033583 3300046694 Bacteria 2823
319 Ga0495589_0000035 3300046794 Bacteria 161642
320 Ga0495589_0000115 3300046794 Bacteria 75796
321 Ga0495600_0016188 3300046809 Bacteria 4729
322 Ga0495660_0000077 3300046810 Bacteria 105543
323 Ga0495660_0000414 3300046810 Bacteria 36352
324 Ga0495660_0017299 3300046810 Bacteria 4152
325 Ga0495660_0043534 3300046810 Bacteria 2475
326 Ga0495604_0000094 3300047317 Bacteria 76004
327 Ga0495636_0000067 3300047318 Bacteria 44261
328 Ga0495636_0000559 3300047318 Bacteria 13656
329 Ga0495636_0004021 3300047318 Bacteria 5747
330 Ga0495674_0006687 3300047319 Bacteria 11046
331 Ga0495674_0024227 3300047319 Bacteria 5581
332 Ga0495672_0001199 3300047320 Bacteria 26191
333 Ga0495672_0001677 3300047320 Bacteria 21483
334 Ga0495672_0001691 3300047320 Bacteria 21368
335 Ga0495672_0003238 3300047320 Bacteria 14133
336 Ga0495672_0013299 3300047320 Bacteria 5685
337 Ga0495672_0028639 3300047320 Bacteria 3520
338 Ga0495672_0043041 3300047320 Bacteria 2718
339 Ga0495676_0000001 3300047321 Bacteria 624167
340 Ga0495676_0000041 3300047321 Bacteria 104634
341 Ga0495676_0000398 3300047321 Bacteria 35184
342 Ga0495676_0098863 3300047321 Bacteria 2164
343 Ga0495680_0000133 3300047322 Bacteria 74109
344 Ga0495680_0000997 3300047322 Bacteria 31518
345 Ga0495680_0070231 3300047322 Bacteria 2671
346 Ga0495683_0002883 3300047323 Bacteria 10174
347 Ga0495683_0004213 3300047323 Bacteria 8217
348 Ga0495687_000066 3300047443 Bacteria 161642
349 Ga0495687_000086 3300047443 Bacteria 143855
350 Ga0495687_000093 3300047443 Bacteria 138076
351 Ga0495687_000566 3300047443 Bacteria 43606
352 Ga0495687_000603 3300047443 Bacteria 42021
353 Ga0495687_003669 3300047443 Bacteria 10931
354 Ga0495687_017794 3300047443 Bacteria 3530
355 Ga0495675_0032563 3300047444 Bacteria 3326
356 Ga0495675_0092919 3300047444 Bacteria 1893
357 Ga0495677_0000321 3300047445 Bacteria 20721
358 Ga0495677_0000604 3300047445 Bacteria 14689
359 Ga0495677_0001554 3300047445 Bacteria 9260
360 Ga0495677_0001627 3300047445 Bacteria 9026
361 Ga0495677_0004008 3300047445 Bacteria 5686
362 Ga0495679_000437 3300047446 Bacteria 30836
363 Ga0495685_000020 3300047447 Bacteria 73280
364 Ga0495685_000155 3300047447 Bacteria 23330
365 Ga0495685_031809 3300047447 Bacteria 1813
366 Ga0495685_043861 3300047447 Bacteria 1526
367 Ga0495673_0000021 3300047469 Bacteria 545523
368 Ga0495673_0000061 3300047469 Bacteria 230647
369 Ga0495673_0000541 3300047469 Bacteria 38812
370 Ga0495673_0000873 3300047469 Bacteria 27837
371 Ga0495673_0001784 3300047469 Bacteria 16340
372 Ga0495673_0001859 3300047469 Bacteria 15837
373 Ga0495673_0006559 3300047469 Bacteria 6823
374 Ga0495673_0029200 3300047469 Bacteria 2605
375 Ga0495673_0041745 3300047469 Bacteria 2063
376 Ga0495673_0041953 3300047469 Unclassified 2057
377 Ga0495681_0000003 3300047470 Bacteria 245567
378 Ga0495681_0000068 3300047470 Bacteria 96387
379 Ga0495681_0000116 3300047470 Bacteria 69786
380 Ga0495681_0000394 3300047470 Bacteria 33879
381 Ga0495681_0004311 3300047470 Bacteria 9735
382 Ga0495681_0005435 3300047470 Bacteria 8532
383 Ga0495681_0011014 3300047470 Bacteria 5423
384 Ga0495681_0011302 3300047470 Bacteria 5326
385 Ga0495681_0051588 3300047470 Unclassified 1934
386 Ga0495684_0009350 3300047471 Bacteria 7566
387 Ga0495686_0001493 3300047472 Bacteria 25335
388 Ga0495686_0001741 3300047472 Bacteria 22337
389 Ga0495686_0002101 3300047472 Bacteria 19528
390 Ga0495686_0015076 3300047472 Bacteria 5293
391 Ga0495686_0033330 3300047472 Bacteria 3326
392 Ga0495593_0000083 3300047673 Bacteria 41204
393 Ga0495593_0001471 3300047673 Bacteria 13833
394 Ga0495593_0009877 3300047673 Bacteria 5538
395 Ga0495602_0000129 3300048088 Bacteria 71215
396 Ga0495602_0062060 3300048088 Bacteria 3244
397 Ga0495614_0000499 3300048089 Bacteria 16028
398 Ga0495615_0000014 3300048090 Bacteria 60447
399 Ga0495615_0000211 3300048090 Bacteria 13489
400 Ga0495615_0005145 3300048090 Unclassified 2333
401 Ga0495626_0000011 3300048091 Bacteria 260928
402 Ga0495626_0000049 3300048091 Bacteria 161052
403 Ga0495626_0000119 3300048091 Bacteria 102920
404 Ga0495626_0000185 3300048091 Bacteria 75817
405 Ga0495626_0000376 3300048091 Bacteria 46584
406 Ga0495626_0000994 3300048091 Bacteria 24359
407 Ga0495626_0001379 3300048091 Bacteria 19548
408 Ga0495626_0059211 3300048091 Bacteria 1748
409 Ga0495678_000008 3300049459 Bacteria 445926
410 Ga0495678_000171 3300049459 Bacteria 75725
411 Ga0495678_000721 3300049459 Bacteria 30019
412 Ga0495682_0000075 3300049460 Bacteria 91041
413 Ga0495682_0005429 3300049460 Bacteria 5298
414 Ga0495682_0019048 3300049460 Bacteria 2583
415 nmdc:mga03683_11_c1 3300050489 Bacteria 120565
416 nmdc:mga03683_1216_c1 3300050489 Bacteria 7609
417 nmdc:mga03683_4377_c1 3300050489 Bacteria 4681
418 nmdc:mga03n38_1_c1 3300050490 Bacteria 91975
419 nmdc:mga03n38_20369_c1 3300050490 Bacteria 2653
420 nmdc:mga03n38_60_c1 3300050490 Bacteria 22561
421 nmdc:mga00v17_1_c1 3300050491 Bacteria 292294
422 nmdc:mga00v17_63868_c2 3300050491 Bacteria 1636
423 nmdc:mga0yw44_103_c1 3300050492 Bacteria 29546
424 nmdc:mga0yw44_61_c1 3300050492 Bacteria 34409
425 nmdc:mga0k408_25318_c1 3300050493 Bacteria 3361
426 nmdc:mga0k408_34957_c1 3300050493 Bacteria 2879
427 nmdc:mga06z11_24159_c1 3300050494 Bacteria 2864
428 nmdc:mga06z11_3192_c1 3300050494 Bacteria 6331
429 nmdc:mga06z11_319_c1 3300050494 Bacteria 18234
430 nmdc:mga04h51_1247_c1 3300050495 Bacteria 5886
431 nmdc:mga04h51_24221_c1 3300050495 Bacteria 1857
432 nmdc:mga07m45_2698_c1 3300050496 Bacteria 8362
433 nmdc:mga07m45_447_c1 3300050496 Bacteria 17238
434 nmdc:mga0sz30_5_c1 3300050516 Bacteria 189060
435 Ga0500610_0006340 3300053079 Bacteria 4952
436 Ga0500610_0031187 3300053079 Bacteria 2706
437 Ga0500635_0000020 3300053080 Bacteria 110196
438 Ga0500578_0059933 3300053086 Bacteria 2432
439 Ga0500578_0075444 3300053086 Bacteria 2148
440 Ga0500643_000479 3300053087 Bacteria 29255
441 Ga0500643_000763 3300053087 Bacteria 20994
442 Ga0500643_001515 3300053087 Bacteria 13260
443 Ga0500643_003650 3300053087 Bacteria 7280
444 Ga0500643_013445 3300053087 Bacteria 2888
445 Ga0500643_038076 3300053087 Bacteria 1428
446 Ga0500583_0000357 3300053092 Bacteria 15023
447 Ga0500651_0000262 3300053093 Bacteria 31432
448 Ga0500651_0000814 3300053093 Bacteria 15257
449 Ga0500641_0000014 3300053096 Bacteria 150696
450 Ga0500641_0000099 3300053096 Bacteria 33503
451 Ga0500641_0009067 3300053096 Bacteria 3568
452 Ga0500555_014742 3300053103 Unclassified 2253
453 Ga0500556_0001922 3300053104 Bacteria 7420
454 Ga0500560_003913 3300053107 Bacteria 3088
455 Ga0500562_012630 3300053108 Unclassified 2150
456 Ga0500571_000074 3300053110 Bacteria 31440
457 Ga0500572_026765 3300053111 Bacteria 1575
458 Ga0500593_000085 3300053117 Bacteria 34051
459 Ga0500594_0001910 3300053118 Bacteria 4507
460 Ga0500594_0006064 3300053118 Bacteria 2703
461 Ga0500597_043269 3300053120 Bacteria 1900
462 Ga0500607_020195 3300053121 Bacteria 3764
463 Ga0500607_039044 3300053121 Bacteria 2580
464 Ga0500607_094550 3300053121 Unclassified 1497
465 Ga0500608_000051 3300053122 Bacteria 52600
466 Ga0500608_002758 3300053122 Bacteria 6471
467 Ga0500608_009923 3300053122 Bacteria 4065
468 Ga0500614_005361 3300053123 Bacteria 2692
469 Ga0500618_000315 3300053125 Bacteria 35779
470 Ga0500618_000372 3300053125 Bacteria 31040
471 Ga0500618_001107 3300053125 Bacteria 13222
472 Ga0500618_001379 3300053125 Bacteria 10994
473 Ga0500618_015391 3300053125 Bacteria 1934
474 Ga0500642_0000526 3300053130 Bacteria 11660
475 Ga0500655_000065 3300053133 Bacteria 28630
476 Ga0500655_000079 3300053133 Bacteria 25542
477 Ga0500658_0000335 3300053134 Bacteria 20976
478 Ga0500659_0000019 3300053135 Bacteria 65589
479 Ga0500559_0000065 3300053136 Bacteria 85032
480 Ga0500559_0001529 3300053136 Bacteria 12968
481 Ga0500559_0007781 3300053136 Bacteria 4734
482 Ga0500559_0009080 3300053136 Bacteria 4320
483 Ga0500559_0010064 3300053136 Bacteria 4071
484 Ga0500559_0037577 3300053136 Unclassified 2099
485 Ga0500559_0075865 3300053136 Bacteria 1521
486 Ga0500559_0081120 3300053136 Bacteria 1474
487 Ga0500561_0000100 3300053137 Bacteria 16567
488 Ga0500561_0001849 3300053137 Bacteria 3492
489 Ga0500561_0009794 3300053137 Unclassified 1958
490 Ga0500564_000044 3300053138 Bacteria 33710
491 Ga0500564_000480 3300053138 Bacteria 11663
492 Ga0500564_027646 3300053138 Bacteria 2611
493 Ga0500568_0000269 3300053139 Bacteria 44003
494 Ga0500568_0047661 3300053139 Bacteria 1697
495 Ga0500573_0000554 3300053140 Bacteria 16273
496 Ga0500573_0005518 3300053140 Bacteria 6785
497 Ga0500574_000006 3300053141 Bacteria 52655
498 Ga0500574_000051 3300053141 Bacteria 13789
499 Ga0500590_002892 3300053148 Bacteria 7783
500 Ga0500590_004333 3300053148 Bacteria 6683
501 Ga0500590_017571 3300053148 Bacteria 3696
502 Ga0500604_0000100 3300053151 Bacteria 27107
503 Ga0500604_0000480 3300053151 Bacteria 10996
504 Ga0500604_0007735 3300053151 Bacteria 2848
505 Ga0500616_0000187 3300053153 Bacteria 101361
506 Ga0500616_0000502 3300053153 Bacteria 49980
507 Ga0500616_0008937 3300053153 Bacteria 6140
508 Ga0500616_0025648 3300053153 Bacteria 3268
509 Ga0500616_0102806 3300053153 Bacteria 1393
510 Ga0500619_041935 3300053154 Bacteria 1449
511 Ga0500622_0000501 3300053156 Bacteria 36484
512 Ga0500622_0000656 3300053156 Bacteria 30810
513 Ga0500622_0001205 3300053156 Bacteria 21252
514 Ga0500622_0003016 3300053156 Bacteria 11634
515 Ga0500622_0003097 3300053156 Bacteria 11454
516 Ga0500622_0011815 3300053156 Bacteria 4745
517 Ga0500622_0048183 3300053156 Bacteria 2199
518 Ga0500624_000039 3300053157 Bacteria 93415
519 Ga0500624_000550 3300053157 Bacteria 10522
520 Ga0500624_000558 3300053157 Bacteria 10404
521 Ga0500624_005946 3300053157 Unclassified 1639
522 Ga0500627_0002447 3300053158 Bacteria 5507
523 Ga0500627_0022904 3300053158 Bacteria 2540
524 Ga0500627_0028157 3300053158 Bacteria 2332
525 Ga0500634_0009172 3300053161 Bacteria 4991
526 Ga0500634_0034049 3300053161 Unclassified 2776
527 Ga0500638_000284 3300053162 Bacteria 11309
528 Ga0500638_000992 3300053162 Bacteria 8182
529 Ga0500636_0000144 3300053177 Bacteria 37563
530 Ga0500636_0000163 3300053177 Bacteria 34947
531 Ga0500636_0000543 3300053177 Bacteria 20542
532 Ga0500636_0003975 3300053177 Bacteria 8331
533 Ga0500637_0000120 3300053178 Bacteria 28438
534 Ga0500637_0000868 3300053178 Bacteria 12121
535 Ga0500567_005394 3300053723 Bacteria 5898
536 Ga0500570_000142 3300053724 Bacteria 21748
537 Ga0500625_000007 3300053729 Bacteria 177638
538 Ga0500645_000773 3300053730 Bacteria 19414
539 Ga0500596_008798 3300053735 Unclassified 1601
540 Ga0500661_000238 3300055283 Bacteria 9855
541 2511328496 2511231016 Bacteria 6704427
542 2585232892 2582581299 Bacteria 6518058
543 2585268182 2582581306 Bacteria 6450535
544 2585268397 2582581306 Bacteria 6450535
545 2585276052 2582581307 Bacteria 6597605
546 2585281690 2582581308 Bacteria 7413247
547 2585334767 2582581316 Bacteria 7774528
548 2585390266 2582581865 Bacteria 6644329
549 2585390394 2582581865 Bacteria 6644329
550 2585399510 2582581867 Bacteria 7184437
551 2585534341 2585427527 Bacteria 7273426
552 2585542898 2585427528 Bacteria 6842387
553 2585556328 2585427530 Bacteria 7383882
554 2585563629 2585427531 Bacteria 6992870
555 2585841160 2585427593 Bacteria 7141551
556 2585846982 2585427594 Bacteria 6180594
557 2585900782 2585427608 Bacteria 6544331
558 2585908780 2585427609 Bacteria 6667127
559 2587984304 2585428125 Bacteria 6662905
560 2738723682 2738541277 Bacteria 7458140
561 2739284413 2738543019 Bacteria 7459457
562 2739649567 2739367664 Bacteria 4114334
563 2740028040 2739367865 Bacteria 4114482
564 2840880109 2840878972 Bacteria 5483153
565 2904770396 2904765812 Bacteria 5369154
566 Ga0495583_0002090
567 Ga0075365_10000094
568 Ga0075368_10000101
569 Ga0075368_10001195
570 Ga0075363_100000004
571 Ga0075363_100047302
572 Ga0075364_10000004
573 Ga0075364_10000140
574 Ga0075362_10000009
575 Ga0075362_10000194
576 Ga0075367_10000018
577 Ga0075367_10006718
578 Ga0075369_10000011
579 Ga0075369_10000061
580 Ga0075366_10000085
581 Ga0075370_10000050
582 Ga0075370_10000071
583 Ga0075370_10001571
584 Ga0075428_100461403
585 Ga0209813_10004031
586 Ga0307517_10000160
587 Ga0307517_10109027
588 Ga0307515_10002570
589 Ga0307515_10010552
590 Ga0307515_10015010
591 Ga0307515_10079468
592 Ga0307515_10191109
593 Ga0307512_10037182
594 Ga0307512_10080008
595 Ga0307513_10117954
596 Ga0307509_10000317
597 Ga0307509_10004066
598 Ga0307509_10133156
599 Ga0307508_10000332
600 Ga0307508_10001814
601 Ga0307508_10013354
602 Ga0307514_10001524
603 Ga0307514_10010094
604 Ga0307516_10126841
605 Ga0307507_10094876
606 Ga0307510_10013175
607 Ga0307510_10038423
608 Ga0307510_10056062
609 Ga0307510_10057800
610 Ga0373923_0064244
611 Ga0373927_0007910
612 Ga0373927_0056037
613 Ga0373947_0038636
614 Ga0439465_0063181
615 Ga0495617_000129
616 Ga0495617_003129
617 Ga0495617_011158
618 Ga0495627_000329
619 Ga0495627_002452
620 Ga0495592_0000175
621 Ga0495592_0000273
622 Ga0495603_0068267
623 Ga0495590_0001918
624 Ga0495590_0008084
625 Ga0495590_0010076
626 Ga0495590_0022154
627 Ga0495590_0037180
628 Ga0495591_000008
629 Ga0495591_000053
630 Ga0495591_001488
631 Ga0495591_013613
632 Ga0495629_0000085
633 Ga0495638_0000022
634 Ga0495638_0000141
635 Ga0495638_0000183
636 Ga0495638_0003759
637 Ga0495638_0024662
638 Ga0495638_0069918
639 Ga0495653_0000176
640 Ga0495653_0001499
641 Ga0495653_0082224
642 Ga0495650_0000073
643 Ga0495650_0000164
644 Ga0495650_0000180
645 Ga0495650_0001323
646 Ga0495650_0002312
647 Ga0495650_0093377
648 Ga0495580_0004929
649 Ga0495605_0000040
650 Ga0495605_0000272
651 Ga0495605_0003592
652 Ga0495605_0009911
653 Ga0495605_0017968
654 Ga0495605_0034615
655 Ga0495664_0009069
656 Ga0495664_0119025
657 Ga0495584_0000020
658 Ga0495584_0000179
659 Ga0495584_0000262
660 Ga0495584_0003161
661 Ga0495584_0010646
662 Ga0495584_0012645
663 Ga0495585_0009223
664 Ga0495585_0010400
665 Ga0495585_0033171
666 Ga0495596_0000016
667 Ga0495596_0000025
668 Ga0495596_0000177
669 Ga0495596_0002627
670 Ga0495596_0003361
671 Ga0495607_0000047
672 Ga0495607_0000152
673 Ga0495607_0000624
674 Ga0495607_0001729
675 Ga0495607_0005688
676 Ga0495607_0005955
677 Ga0495607_0056032
678 Ga0495583_0000014
679 Ga0495583_0000032
680 Ga0495583_0000114
681 Ga0495583_0000127
682 Ga0495583_0000471
683 Ga0495583_0005946
684 Ga0495583_0014416
685 Ga0495583_0043799
686 Ga0495583_0045013
687 Ga0495606_0001415
688 Ga0495606_0005810
689 Ga0495606_0006083
690 Ga0495606_0040305
691 Ga0495606_0045402
692 Ga0495606_0059172
693 Ga0495610_0000797
694 Ga0495610_0001540
695 Ga0495610_0008505
696 Ga0495610_0023671
697 Ga0495616_0000950
698 Ga0495616_0002008
699 Ga0495616_0002976
700 Ga0495616_0008314
701 Ga0495616_0013438
702 Ga0495616_0015863
703 Ga0495616_0027556
704 Ga0495620_0000045
705 Ga0495620_0006235
706 Ga0495620_0053938
707 Ga0495628_0032648
708 Ga0495628_0042581
709 Ga0495630_0009662
710 Ga0495630_0055776
711 Ga0495630_0108127
712 Ga0495631_0003800
713 Ga0495631_0009794
714 Ga0495631_0027943
715 Ga0495631_0029441
716 Ga0495632_0000053
717 Ga0495632_0000086
718 Ga0495632_0000284
719 Ga0495632_0000448
720 Ga0495632_0000743
721 Ga0495632_0000921
722 Ga0495632_0002866
723 Ga0495632_0003155
724 Ga0495632_0015316
725 Ga0495632_0034534
726 Ga0495632_0075011
727 Ga0495637_0000197
728 Ga0495637_0000340
729 Ga0495637_0000686
730 Ga0495637_0002056
731 Ga0495637_0002710
732 Ga0495637_0003460
733 Ga0495637_0005751
734 Ga0495637_0017226
735 Ga0495643_0000061
736 Ga0495643_0000298
737 Ga0495643_0000666
738 Ga0495643_0006763
739 Ga0495643_0011875
740 Ga0495643_0015832
741 Ga0495643_0026918
742 Ga0495643_0028241
743 Ga0495643_0062735
744 Ga0495643_0062779
745 Ga0495644_0000087
746 Ga0495644_0000164
747 Ga0495644_0007667
748 Ga0495644_0021574
749 Ga0495648_0000051
750 Ga0495648_0000476
751 Ga0495648_0001810
752 Ga0495648_0003221
753 Ga0495648_0004393
754 Ga0495648_0011425
755 Ga0495648_0017922
756 Ga0495648_0029371
757 Ga0495648_0030881
758 Ga0495648_0064778
759 Ga0495663_0000012
760 Ga0495663_0000263
761 Ga0495663_0001724
762 Ga0495666_0001202
763 Ga0495666_0001954
764 Ga0495666_0012951
765 Ga0495666_0069768
766 Ga0495666_0071867
767 Ga0495642_0000484
768 Ga0495642_0005467
769 Ga0495642_0014352
770 Ga0495642_0030150
771 Ga0495652_0198173
772 Ga0495654_0000084
773 Ga0495654_0000565
774 Ga0495654_0002151
775 Ga0495654_0002802
776 Ga0495654_0003342
777 Ga0495654_0039593
778 Ga0495654_0051594
779 Ga0495665_0007602
780 Ga0495587_0000054
781 Ga0495587_0013401
782 Ga0495609_0000044
783 Ga0495609_0001626
784 Ga0495609_0001976
785 Ga0495609_0004460
786 Ga0495609_0005108
787 Ga0495621_0002424
788 Ga0495597_0000865
789 Ga0495597_0003700
790 Ga0495597_0021765
791 Ga0495597_0085863
792 Ga0495645_0000420
793 Ga0495645_0002987
794 Ga0495645_0042953
795 Ga0495622_0000024
796 Ga0495622_0000557
797 Ga0495622_0000889
798 Ga0495622_0007306
799 Ga0495633_0004018
800 Ga0495633_0004875
801 Ga0495633_0029448
802 Ga0495656_0001795
803 Ga0495656_0002471
804 Ga0495656_0011414
805 Ga0495656_0027614
806 Ga0495656_0075946
807 Ga0495668_0000287
808 Ga0495668_0023648
809 Ga0495668_0108370
810 Ga0495634_0000169
811 Ga0495611_0000134
812 Ga0495611_0000448
813 Ga0495611_0000769
814 Ga0495611_0007111
815 Ga0495611_0008093
816 Ga0495625_0000016
817 Ga0495625_0001351
818 Ga0495625_0002776
819 Ga0495625_0009988
820 Ga0495625_0023278
821 Ga0495625_0025370
822 Ga0495625_0051607
823 Ga0495625_0054266
824 Ga0495625_0057305
825 Ga0495625_0057950
826 Ga0495625_0136447
827 Ga0495635_0000033
828 Ga0495635_0000035
829 Ga0495659_0000325
830 Ga0495659_0004762
831 Ga0495659_0005557
832 Ga0495661_0000001
833 Ga0495661_0000554
834 Ga0495661_0000722
835 Ga0495661_0003376
836 Ga0495661_0006832
837 Ga0495661_0012066
838 Ga0495661_0015468
839 Ga0495661_0067543
840 Ga0495588_0000664
841 Ga0495588_0001867
842 Ga0495588_0003788
843 Ga0495588_0005450
844 Ga0495588_0008269
845 Ga0495588_0016076
846 Ga0495588_0031632
847 Ga0495588_0032744
848 Ga0495623_0000189
849 Ga0495623_0076289
850 Ga0495646_0000059
851 Ga0495646_0000704
852 Ga0495646_0013280
853 Ga0495646_0041332
854 Ga0495646_0051717
855 Ga0495647_0000282
856 Ga0495658_0001272
857 Ga0495658_0006837
858 Ga0495669_0000091
859 Ga0495669_0014973
860 Ga0495669_0039461
861 Ga0495624_0000014
862 Ga0495624_0001032
863 Ga0495624_0002583
864 Ga0495624_0011052
865 Ga0495624_0190177
866 Ga0495670_0000018
867 Ga0495670_0000026
868 Ga0495670_0000064
869 Ga0495670_0005461
870 Ga0495671_0000004
871 Ga0495671_0000036
872 Ga0495671_0000079
873 Ga0495671_0001366
874 Ga0495671_0002376
875 Ga0495671_0018414
876 Ga0495671_0067438
877 Ga0495649_0000480
878 Ga0495649_0000978
879 Ga0495649_0004222
880 Ga0495649_0009739
881 Ga0495649_0022361
882 Ga0495649_0027487
883 Ga0495649_0033583
884 Ga0495589_0000035
885 Ga0495589_0000115
886 Ga0495600_0016188
887 Ga0495660_0000077
888 Ga0495660_0000414
889 Ga0495660_0017299
890 Ga0495660_0043534
891 Ga0495604_0000094
892 Ga0495636_0000067
893 Ga0495636_0000559
894 Ga0495636_0004021
895 Ga0495674_0006687
896 Ga0495674_0024227
897 Ga0495672_0001199
898 Ga0495672_0001677
899 Ga0495672_0001691
900 Ga0495672_0003238
901 Ga0495672_0013299
902 Ga0495672_0028639
903 Ga0495672_0043041
904 Ga0495676_0000001
905 Ga0495676_0000041
906 Ga0495676_0000398
907 Ga0495676_0098863
908 Ga0495680_0000133
909 Ga0495680_0000997
910 Ga0495680_0070231
911 Ga0495683_0002883
912 Ga0495683_0004213
913 Ga0495687_000066
914 Ga0495687_000086
915 Ga0495687_000093
916 Ga0495687_000566
917 Ga0495687_000603
918 Ga0495687_003669
919 Ga0495687_017794
920 Ga0495675_0032563
921 Ga0495675_0092919
922 Ga0495677_0000321
923 Ga0495677_0000604
924 Ga0495677_0001554
925 Ga0495677_0001627
926 Ga0495677_0004008
927 Ga0495679_000437
928 Ga0495685_000020
929 Ga0495685_000155
930 Ga0495685_031809
931 Ga0495685_043861
932 Ga0495673_0000021
933 Ga0495673_0000061
934 Ga0495673_0000541
935 Ga0495673_0000873
936 Ga0495673_0001784
937 Ga0495673_0001859
938 Ga0495673_0006559
939 Ga0495673_0029200
940 Ga0495673_0041745
941 Ga0495673_0041953
942 Ga0495681_0000003
943 Ga0495681_0000068
944 Ga0495681_0000116
945 Ga0495681_0000394
946 Ga0495681_0004311
947 Ga0495681_0005435
948 Ga0495681_0011014
949 Ga0495681_0011302
950 Ga0495681_0051588
951 Ga0495684_0009350
952 Ga0495686_0001493
953 Ga0495686_0001741
954 Ga0495686_0002101
955 Ga0495686_0015076
956 Ga0495686_0033330
957 Ga0495593_0000083
958 Ga0495593_0001471
959 Ga0495593_0009877
960 Ga0495602_0000129
961 Ga0495602_0062060
962 Ga0495614_0000499
963 Ga0495615_0000014
964 Ga0495615_0000211
965 Ga0495615_0005145
966 Ga0495626_0000011
967 Ga0495626_0000049
968 Ga0495626_0000119
969 Ga0495626_0000185
970 Ga0495626_0000376
971 Ga0495626_0000994
972 Ga0495626_0001379
973 Ga0495626_0059211
974 Ga0495678_000008
975 Ga0495678_000171
976 Ga0495678_000721
977 Ga0495682_0000075
978 Ga0495682_0005429
979 Ga0495682_0019048
980 nmdc:mga03683_11_c1
981 nmdc:mga03683_1216_c1
982 nmdc:mga03683_4377_c1
983 nmdc:mga03n38_1_c1
984 nmdc:mga03n38_20369_c1
985 nmdc:mga03n38_60_c1
986 nmdc:mga00v17_1_c1
987 nmdc:mga00v17_63868_c2
988 nmdc:mga0yw44_103_c1
989 nmdc:mga0yw44_61_c1
990 nmdc:mga0k408_25318_c1
991 nmdc:mga0k408_34957_c1
992 nmdc:mga06z11_24159_c1
993 nmdc:mga06z11_3192_c1
994 nmdc:mga06z11_319_c1
995 nmdc:mga04h51_1247_c1
996 nmdc:mga04h51_24221_c1
997 nmdc:mga07m45_2698_c1
998 nmdc:mga07m45_447_c1
999 nmdc:mga0sz30_5_c1
1000 Ga0500610_0006340
1001 Ga0500610_0031187
1002 Ga0500635_0000020
1003 Ga0500578_0059933
1004 Ga0500578_0075444
1005 Ga0500643_000479
1006 Ga0500643_000763
1007 Ga0500643_001515
1008 Ga0500643_003650
1009 Ga0500643_013445
1010 Ga0500643_038076
1011 Ga0500583_0000357
1012 Ga0500651_0000262
1013 Ga0500651_0000814
1014 Ga0500641_0000014
1015 Ga0500641_0000099
1016 Ga0500641_0009067
1017 Ga0500555_014742
1018 Ga0500556_0001922
1019 Ga0500560_003913
1020 Ga0500562_012630
1021 Ga0500571_000074
1022 Ga0500572_026765
1023 Ga0500593_000085
1024 Ga0500594_0001910
1025 Ga0500594_0006064
1026 Ga0500597_043269
1027 Ga0500607_020195
1028 Ga0500607_039044
1029 Ga0500607_094550
1030 Ga0500608_000051
1031 Ga0500608_002758
1032 Ga0500608_009923
1033 Ga0500614_005361
1034 Ga0500618_000315
1035 Ga0500618_000372
1036 Ga0500618_001107
1037 Ga0500618_001379
1038 Ga0500618_015391
1039 Ga0500642_0000526
1040 Ga0500655_000065
1041 Ga0500655_000079
1042 Ga0500658_0000335
1043 Ga0500659_0000019
1044 Ga0500559_0000065
1045 Ga0500559_0001529
1046 Ga0500559_0007781
1047 Ga0500559_0009080
1048 Ga0500559_0010064
1049 Ga0500559_0037577
1050 Ga0500559_0075865
1051 Ga0500559_0081120
1052 Ga0500561_0000100
1053 Ga0500561_0001849
1054 Ga0500561_0009794
1055 Ga0500564_000044
1056 Ga0500564_000480
1057 Ga0500564_027646
1058 Ga0500568_0000269
1059 Ga0500568_0047661
1060 Ga0500573_0000554
1061 Ga0500573_0005518
1062 Ga0500574_000006
1063 Ga0500574_000051
1064 Ga0500590_002892
1065 Ga0500590_004333
1066 Ga0500590_017571
1067 Ga0500604_0000100
1068 Ga0500604_0000480
1069 Ga0500604_0007735
1070 Ga0500616_0000187
1071 Ga0500616_0000502
1072 Ga0500616_0008937
1073 Ga0500616_0025648
1074 Ga0500616_0102806
1075 Ga0500619_041935
1076 Ga0500622_0000501
1077 Ga0500622_0000656
1078 Ga0500622_0001205
1079 Ga0500622_0003016
1080 Ga0500622_0003097
1081 Ga0500622_0011815
1082 Ga0500622_0048183
1083 Ga0500624_000039
1084 Ga0500624_000550
1085 Ga0500624_000558
1086 Ga0500624_005946
1087 Ga0500627_0002447
1088 Ga0500627_0022904
1089 Ga0500627_0028157
1090 Ga0500634_0009172
1091 Ga0500634_0034049
1092 Ga0500638_000284
1093 Ga0500638_000992
1094 Ga0500636_0000144
1095 Ga0500636_0000163
1096 Ga0500636_0000543
1097 Ga0500636_0003975
1098 Ga0500637_0000120
1099 Ga0500637_0000868
1100 Ga0500567_005394
1101 Ga0500570_000142
1102 Ga0500625_000007
1103 Ga0500645_000773
1104 Ga0500596_008798
1105 Ga0500661_000238
1106 2511328496
1107 2585232892
1108 2585268182
1109 2585268397
1110 2585276052
1111 2585281690
1112 2585334767
1113 2585390266
1114 2585390394
1115 2585399510
1116 2585534341
1117 2585542898
1118 2585556328
1119 2585563629
1120 2585841160
1121 2585846982
1122 2585900782
1123 2585908780
1124 2587984304
1125 2738723682
1126 2739284413
1127 2739649567
1128 2740028040
1129 2840880109
1130 2904770396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

41

408

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.8978 1 373
1pt8-assembly1.cif.gz_B crystal structure of the yfdw gene product of e. coli, in complex with oxalate and acetyl-coa 0.8963 3 395
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8963 6 373
5yit-assembly1.cif.gz_A crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8963 1 377
5yit-assembly3.cif.gz_E-2 crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8942 6 370
ID Description Score Start End Superfamily
af_O06543_1_217_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.892 6 218 3.40.50.10540
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.887 26 229 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8809 3 283 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.875 3 283 3.40.50.10540
af_Q5AMS5_241_485_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8724 3 211 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A2E9XZ25-F1-model_v4 CoA transferase 0.9649 19 395 GO:0008410
AF-A0A1H8X7Q1-F1-model_v4 Crotonobetainyl-CoA:carnitine CoA-transferase CaiB 0.9576 8 399 GO:0008410
AF-A0A157SCF4-F1-model_v4 Acyl-CoA transferase (EC 2.8.3.16) 0.9567 8 380 GO:0033608
AF-A0A1D2UL53-F1-model_v4 Acetyl-CoA acetyltransferase 0.956 8 389 GO:0008410
AF-A0A1Q4AD53-F1-model_v4 CoA transferase 0.9555 20 388 GO:0008410

Map