F464676

General Info

Members Datasets Scaffolds Average Seq Length
568 260 1136 123

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_153854_c1|nmdc:mga0k408_153854_c1_111_563
Length 150
Sequence VDEFRQSEAHRFVPLNDAVIAQRQESKRMVVEFHGARGQRGVTLFGLMFWAIVVGFAALVIMKVLPTLNEYFTIQKAVNKIAKEGGTTVPEIRAAFERTKEIEYSISSISAKDLNITKENDKVVISFAYDKEIELMKPVYLLIKYEGRSK

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
187 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
188 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
189 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
220 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
221 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
222 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
223 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
230 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
231 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
232 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
233 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
234 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
235 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
236 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
237 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
238 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
253 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.08
Nodule 0
Rhizoplane 2.11
Rhizosphere 79.75
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_153854_c1 3300050493 Bacteria 1370
2 rootL2_10026887 3300003322 Bacteria 4953
3 Ga0055531_10071308 3300003794 Bacteria 800
4 Ga0065715_10021876 3300005293 Bacteria 2135
5 Ga0065715_10720038 3300005293 Bacteria 628
6 Ga0070658_10458467 3300005327 Bacteria 1099
7 Ga0070676_10026130 3300005328 Bacteria 3304
8 Ga0070676_10312707 3300005328 Bacteria 1069
9 Ga0070683_100992529 3300005329 Bacteria 806
10 Ga0070690_100116489 3300005330 Bacteria 1789
11 Ga0070690_100522714 3300005330 Bacteria 891
12 Ga0070670_100003220 3300005331 Bacteria 13475
13 Ga0070670_100357361 3300005331 Bacteria 1284
14 Ga0070670_100624239 3300005331 Bacteria 965
15 Ga0070677_10327525 3300005333 Bacteria 786
16 Ga0068869_100006018 3300005334 Bacteria 7673
17 Ga0068869_100600362 3300005334 Bacteria 930
18 Ga0068869_100855590 3300005334 Bacteria 785
19 Ga0068869_101001994 3300005334 Bacteria 727
20 Ga0068869_101398413 3300005334 Unclassified 619
21 Ga0070666_10005842 3300005335 Bacteria 7558
22 Ga0070666_10027063 3300005335 Bacteria 3752
23 Ga0070666_10411142 3300005335 Bacteria 973
24 Ga0070666_11250166 3300005335 Bacteria 553
25 Ga0068868_100057274 3300005338 Bacteria 3079
26 Ga0068868_100108508 3300005338 Bacteria 2253
27 Ga0068868_100558744 3300005338 Bacteria 1009
28 Ga0068868_100703906 3300005338 Bacteria 904
29 Ga0070689_100753615 3300005340 Bacteria 854
30 Ga0070687_100050192 3300005343 Bacteria 2154
31 Ga0070687_101107243 3300005343 Bacteria 580
32 Ga0070661_100168108 3300005344 Bacteria 1664
33 Ga0070661_100536833 3300005344 Bacteria 940
34 Ga0070668_100011100 3300005347 Bacteria 6705
35 Ga0070668_100231263 3300005347 Bacteria 1528
36 Ga0070668_100512239 3300005347 Bacteria 1040
37 Ga0070669_100017644 3300005353 Bacteria 5091
38 Ga0070669_100041907 3300005353 Bacteria 3331
39 Ga0070669_100068841 3300005353 Bacteria 2613
40 Ga0070669_100074021 3300005353 Bacteria 2524
41 Ga0070669_100289219 3300005353 Bacteria 1315
42 Ga0070675_100079394 3300005354 Bacteria 2734
43 Ga0070675_100084711 3300005354 Bacteria 2647
44 Ga0070675_100114972 3300005354 Bacteria 2280
45 Ga0070671_100043214 3300005355 Bacteria 3745
46 Ga0070671_100068058 3300005355 Bacteria 2969
47 Ga0070671_100140591 3300005355 Bacteria 2037
48 Ga0070671_100242409 3300005355 Bacteria 1530
49 Ga0070671_101325714 3300005355 Bacteria 635
50 Ga0070671_101352584 3300005355 Bacteria 629
51 Ga0070674_100015116 3300005356 Bacteria 4812
52 Ga0070674_100142333 3300005356 Bacteria 1801
53 Ga0070674_100321610 3300005356 Bacteria 1240
54 Ga0070674_100421524 3300005356 Bacteria 1095
55 Ga0070674_101866869 3300005356 Bacteria 545
56 Ga0070674_101977099 3300005356 Bacteria 531
57 Ga0070674_102163569 3300005356 Bacteria 508
58 Ga0070673_100104338 3300005364 Bacteria 2340
59 Ga0070673_100107937 3300005364 Bacteria 2303
60 Ga0070673_100279428 3300005364 Bacteria 1464
61 Ga0070673_100595776 3300005364 Bacteria 1008
62 Ga0070673_100603795 3300005364 Bacteria 1001
63 Ga0070673_101079022 3300005364 Bacteria 749
64 Ga0070659_100369700 3300005366 Bacteria 1206
65 Ga0070667_100002053 3300005367 Bacteria 17829
66 Ga0070667_100016760 3300005367 Bacteria 6063
67 Ga0070667_100610387 3300005367 Bacteria 1005
68 Ga0070667_100927243 3300005367 Bacteria 811
69 Ga0070667_101451654 3300005367 Bacteria 644
70 Ga0070667_102158518 3300005367 Unclassified 525
71 Ga0070700_101892422 3300005441 Bacteria 516
72 Ga0070708_100526662 3300005445 Bacteria 1115
73 Ga0070663_100375128 3300005455 Bacteria 1157
74 Ga0070663_101553515 3300005455 Bacteria 589
75 Ga0070678_100354454 3300005456 Bacteria 1262
76 Ga0070678_100442568 3300005456 Bacteria 1137
77 Ga0070678_100754117 3300005456 Bacteria 881
78 Ga0070662_100040625 3300005457 Bacteria 3313
79 Ga0070662_100074754 3300005457 Bacteria 2508
80 Ga0068867_100039168 3300005459 Bacteria 3454
81 Ga0068867_100048217 3300005459 Bacteria 3133
82 Ga0068867_100066783 3300005459 Bacteria 2679
83 Ga0068867_100137014 3300005459 Bacteria 1909
84 Ga0068867_100286849 3300005459 Bacteria 1352
85 Ga0068867_100494732 3300005459 Bacteria 1050
86 Ga0068867_101510746 3300005459 Bacteria 626
87 Ga0070706_100002337 3300005467 Bacteria 19150
88 Ga0070707_100088292 3300005468 Bacteria 2999
89 Ga0070699_100462167 3300005518 Bacteria 1151
90 Ga0070679_101482486 3300005530 Bacteria 625
91 Ga0070679_101591253 3300005530 Bacteria 601
92 Ga0068853_100273069 3300005539 Bacteria 1557
93 Ga0068853_100408605 3300005539 Bacteria 1272
94 Ga0070672_100011605 3300005543 Bacteria 6147
95 Ga0070672_100017626 3300005543 Bacteria 5144
96 Ga0070672_100061377 3300005543 Bacteria 2963
97 Ga0070672_100155255 3300005543 Bacteria 1895
98 Ga0070672_100391362 3300005543 Bacteria 1190
99 Ga0070686_100128427 3300005544 Bacteria 1750
100 Ga0070686_100576132 3300005544 Bacteria 884
101 Ga0070665_100953241 3300005548 Bacteria 870
102 Ga0070665_101807954 3300005548 Bacteria 617
103 Ga0070665_101849039 3300005548 Bacteria 610
104 Ga0068855_101380704 3300005563 Bacteria 727
105 Ga0070664_100214503 3300005564 Bacteria 1720
106 Ga0070664_101515285 3300005564 Bacteria 635
107 Ga0070664_101578077 3300005564 Bacteria 621
108 Ga0068857_100032353 3300005577 Bacteria 4624
109 Ga0068854_100069324 3300005578 Bacteria 2574
110 Ga0068854_100276284 3300005578 Bacteria 1351
111 Ga0068854_100803625 3300005578 Bacteria 820
112 Ga0068854_101094006 3300005578 Bacteria 710
113 Ga0068854_101451679 3300005578 Bacteria 621
114 Ga0068856_100260353 3300005614 Bacteria 1750
115 Ga0070702_101565047 3300005615 Unclassified 544
116 Ga0068852_100039460 3300005616 Bacteria 3975
117 Ga0068852_100212873 3300005616 Bacteria 1834
118 Ga0068852_100244773 3300005616 Bacteria 1715
119 Ga0068852_100764699 3300005616 Bacteria 979
120 Ga0068859_100270336 3300005617 Bacteria 1792
121 Ga0068859_100389835 3300005617 Bacteria 1489
122 Ga0068859_101072620 3300005617 Bacteria 886
123 Ga0068864_100015540 3300005618 Bacteria 6330
124 Ga0068864_100050174 3300005618 Bacteria 3591
125 Ga0068866_10002843 3300005718 Bacteria 7136
126 Ga0068866_10369647 3300005718 Bacteria 916
127 Ga0068866_10731363 3300005718 Bacteria 682
128 Ga0068861_100089167 3300005719 Bacteria 2431
129 Ga0068861_100223300 3300005719 Bacteria 1593
130 Ga0068861_101052396 3300005719 Bacteria 780
131 Ga0068851_10010095 3300005834 Bacteria 4399
132 Ga0068851_10041979 3300005834 Bacteria 2301
133 Ga0068851_10327016 3300005834 Bacteria 887
134 Ga0068851_10348777 3300005834 Bacteria 861
135 Ga0068870_10232199 3300005840 Bacteria 1135
136 Ga0068870_10764895 3300005840 Bacteria 672
137 Ga0068863_100008147 3300005841 Bacteria 10232
138 Ga0068858_100024249 3300005842 Bacteria 5653
139 Ga0068858_100322425 3300005842 Bacteria 1477
140 Ga0068858_100699931 3300005842 Bacteria 986
141 Ga0068860_100010210 3300005843 Bacteria 9293
142 Ga0068860_100757309 3300005843 Bacteria 983
143 Ga0068862_100047805 3300005844 Bacteria 3652
144 Ga0068862_100049502 3300005844 Bacteria 3589
145 Ga0081455_10908443 3300005937 Bacteria 547
146 Ga0075363_100454798 3300006048 Bacteria 757
147 Ga0075363_100499060 3300006048 Bacteria 723
148 Ga0075363_100583718 3300006048 Bacteria 669
149 Ga0075364_10178026 3300006051 Bacteria 1438
150 Ga0075362_10017195 3300006177 Bacteria 2976
151 Ga0075362_10101480 3300006177 Bacteria 1346
152 Ga0075362_10436476 3300006177 Bacteria 664
153 Ga0075362_10548028 3300006177 Bacteria 594
154 Ga0075367_10015567 3300006178 Bacteria 4139
155 Ga0075367_10040368 3300006178 Bacteria 2724
156 Ga0075367_10150660 3300006178 Bacteria 1443
157 Ga0075367_10675978 3300006178 Bacteria 656
158 Ga0075369_10216141 3300006186 Bacteria 887
159 Ga0075369_10354464 3300006186 Bacteria 689
160 Ga0075366_10006193 3300006195 Bacteria 6529
161 Ga0075366_10011917 3300006195 Bacteria 4921
162 Ga0075366_10023339 3300006195 Bacteria 3604
163 Ga0075366_10024071 3300006195 Bacteria 3551
164 Ga0075366_10076863 3300006195 Bacteria 1992
165 Ga0075366_10092368 3300006195 Bacteria 1813
166 Ga0075366_10146567 3300006195 Bacteria 1428
167 Ga0075366_10154208 3300006195 Bacteria 1391
168 Ga0075366_10238071 3300006195 Bacteria 1109
169 Ga0075366_10264571 3300006195 Bacteria 1050
170 Ga0075366_10384094 3300006195 Bacteria 864
171 Ga0075366_10384264 3300006195 Bacteria 863
172 Ga0097621_100019117 3300006237 Bacteria 5252
173 Ga0097621_100271365 3300006237 Bacteria 1491
174 Ga0075370_10002177 3300006353 Bacteria 8992
175 Ga0075370_10006689 3300006353 Bacteria 5815
176 Ga0075370_10008615 3300006353 Bacteria 5258
177 Ga0075370_10077994 3300006353 Bacteria 1901
178 Ga0075370_10115053 3300006353 Bacteria 1563
179 Ga0075370_10143437 3300006353 Bacteria 1397
180 Ga0068871_100003964 3300006358 Bacteria 10223
181 Ga0068871_100225161 3300006358 Bacteria 1626
182 Ga0068871_100761165 3300006358 Bacteria 891
183 Ga0068871_101351159 3300006358 Bacteria 671
184 Ga0068871_101446870 3300006358 Bacteria 648
185 Ga0068871_101676718 3300006358 Bacteria 603
186 Ga0068865_100012253 3300006881 Bacteria 5393
187 Ga0068865_100050655 3300006881 Bacteria 2870
188 Ga0068865_100189229 3300006881 Bacteria 1590
189 Ga0068865_100620332 3300006881 Bacteria 916
190 Ga0097620_100270347 3300006931 Bacteria 1792
191 Ga0097620_100389829 3300006931 Bacteria 1489
192 Ga0097620_101072645 3300006931 Bacteria 886
193 Ga0105240_10415143 3300009093 Bacteria 1513
194 Ga0111539_13123822 3300009094 Bacteria 534
195 Ga0105245_10220613 3300009098 Bacteria 1829
196 Ga0105243_10007512 3300009148 Bacteria 8378
197 Ga0105243_10053672 3300009148 Bacteria 3198
198 Ga0105243_10479183 3300009148 Bacteria 1174
199 Ga0105241_10994224 3300009174 Bacteria 784
200 Ga0105242_10471181 3300009176 Bacteria 1188
201 Ga0105242_10682638 3300009176 Bacteria 1003
202 Ga0105248_10489158 3300009177 Bacteria 1387
203 Ga0105248_10863895 3300009177 Bacteria 1021
204 Ga0105248_11403709 3300009177 Bacteria 790
205 Ga0105237_10048132 3300009545 Bacteria 4286
206 Ga0105238_10254414 3300009551 Bacteria 1735
207 Ga0105238_10672408 3300009551 Bacteria 1046
208 Ga0105238_10702547 3300009551 Bacteria 1023
209 Ga0105249_10076441 3300009553 Bacteria 3103
210 Ga0105239_10149287 3300010375 Bacteria 2608
211 Ga0105239_11204838 3300010375 Bacteria 873
212 Ga0157373_10333173 3300013100 Bacteria 1081
213 Ga0157369_11395663 3300013105 Unclassified 713
214 Ga0157374_10043296 3300013296 Bacteria 4158
215 Ga0157374_11055196 3300013296 Bacteria 832
216 Ga0157378_10016476 3300013297 Bacteria 6474
217 Ga0157378_10338489 3300013297 Bacteria 1466
218 Ga0157378_11421818 3300013297 Bacteria 737
219 Ga0163162_10009814 3300013306 Bacteria 9317
220 Ga0163162_10537560 3300013306 Bacteria 1297
221 Ga0163162_12067383 3300013306 Bacteria 653
222 Ga0157372_10143790 3300013307 Bacteria 2750
223 Ga0157375_10059004 3300013308 Bacteria 3799
224 Ga0157375_10725135 3300013308 Bacteria 1147
225 Ga0157380_10044416 3300014326 Bacteria 3483
226 Ga0157380_10072192 3300014326 Bacteria 2795
227 Ga0157380_10130786 3300014326 Bacteria 2141
228 Ga0157380_10956428 3300014326 Bacteria 887
229 Ga0157377_10572353 3300014745 Bacteria 801
230 Ga0157379_10027057 3300014968 Bacteria 5104
231 Ga0157379_10544188 3300014968 Bacteria 1080
232 Ga0157379_11329915 3300014968 Bacteria 695
233 Ga0157379_11682826 3300014968 Bacteria 621
234 Ga0182007_10033495 3300015262 Bacteria 1741
235 Ga0163161_10014817 3300017792 Bacteria 5432
236 Ga0163161_10025520 3300017792 Bacteria 4182
237 Ga0163161_10539466 3300017792 Bacteria 955
238 Ga0163161_10973349 3300017792 Bacteria 723
239 Ga0163161_11143534 3300017792 Bacteria 671
240 Ga0207666_1064659 3300025271 Bacteria 587
241 Ga0209257_1021296 3300025304 Bacteria 2360
242 Ga0207697_10010635 3300025315 Bacteria 3926
243 Ga0207697_10030157 3300025315 Bacteria 2220
244 Ga0207697_10033168 3300025315 Bacteria 2113
245 Ga0207656_10016091 3300025321 Bacteria 2906
246 Ga0207656_10714357 3300025321 Unclassified 513
247 Ga0207682_10003996 3300025893 Bacteria 6276
248 Ga0207682_10146971 3300025893 Bacteria 1061
249 Ga0207642_10008153 3300025899 Bacteria 3580
250 Ga0207688_10022097 3300025901 Bacteria 3481
251 Ga0207688_10050108 3300025901 Bacteria 2336
252 Ga0207688_10097909 3300025901 Bacteria 1691
253 Ga0207688_10194965 3300025901 Bacteria 1213
254 Ga0207680_10017485 3300025903 Bacteria 3790
255 Ga0207680_10249778 3300025903 Bacteria 1225
256 Ga0207647_10090324 3300025904 Bacteria 1827
257 Ga0207647_10365566 3300025904 Bacteria 816
258 Ga0207645_10051984 3300025907 Bacteria 2618
259 Ga0207645_10201490 3300025907 Bacteria 1309
260 Ga0207645_10222756 3300025907 Bacteria 1244
261 Ga0207645_10757979 3300025907 Bacteria 660
262 Ga0207643_10147034 3300025908 Bacteria 1410
263 Ga0207705_10399103 3300025909 Bacteria 1063
264 Ga0207684_10026601 3300025910 Bacteria 4932
265 Ga0207684_10091896 3300025910 Bacteria 2587
266 Ga0207654_10469748 3300025911 Bacteria 885
267 Ga0207695_10301512 3300025913 Bacteria 1493
268 Ga0207671_10073873 3300025914 Bacteria 2548
269 Ga0207662_10028888 3300025918 Bacteria 3210
270 Ga0207649_10144200 3300025920 Bacteria 1633
271 Ga0207649_10320805 3300025920 Bacteria 1138
272 Ga0207649_11514413 3300025920 Bacteria 531
273 Ga0207652_11700210 3300025921 Unclassified 536
274 Ga0207646_10089304 3300025922 Bacteria 2758
275 Ga0207681_10004142 3300025923 Bacteria 8988
276 Ga0207681_10007931 3300025923 Bacteria 6493
277 Ga0207681_10046312 3300025923 Bacteria 2925
278 Ga0207681_10340698 3300025923 Bacteria 1197
279 Ga0207681_10455633 3300025923 Bacteria 1041
280 Ga0207694_10398476 3300025924 Bacteria 1144
281 Ga0207650_10000587 3300025925 Bacteria 29198
282 Ga0207650_10140997 3300025925 Bacteria 1895
283 Ga0207650_10171932 3300025925 Bacteria 1722
284 Ga0207650_10737075 3300025925 Bacteria 833
285 Ga0207659_10000861 3300025926 Bacteria 18018
286 Ga0207659_10067142 3300025926 Bacteria 2605
287 Ga0207659_10625933 3300025926 Bacteria 919
288 Ga0207687_10300670 3300025927 Bacteria 1292
289 Ga0207687_10627811 3300025927 Bacteria 907
290 Ga0207644_10016499 3300025931 Bacteria 4970
291 Ga0207644_10073992 3300025931 Bacteria 2499
292 Ga0207690_10519798 3300025932 Bacteria 965
293 Ga0207706_10264175 3300025933 Bacteria 1502
294 Ga0207706_10473758 3300025933 Bacteria 1082
295 Ga0207706_10565081 3300025933 Bacteria 978
296 Ga0207686_10433439 3300025934 Bacteria 1008
297 Ga0207686_10720470 3300025934 Bacteria 794
298 Ga0207686_11694929 3300025934 Bacteria 523
299 Ga0207709_10031648 3300025935 Bacteria 3092
300 Ga0207709_10077216 3300025935 Bacteria 2134
301 Ga0207709_10207003 3300025935 Bacteria 1405
302 Ga0207709_11288795 3300025935 Unclassified 603
303 Ga0207670_10120004 3300025936 Bacteria 1910
304 Ga0207669_10004732 3300025937 Bacteria 6026
305 Ga0207669_10012938 3300025937 Bacteria 4124
306 Ga0207669_10126727 3300025937 Bacteria 1746
307 Ga0207669_10522219 3300025937 Bacteria 953
308 Ga0207669_11337992 3300025937 Bacteria 609
309 Ga0207704_10022127 3300025938 Bacteria 3399
310 Ga0207704_10138822 3300025938 Bacteria 1696
311 Ga0207704_10178301 3300025938 Bacteria 1532
312 Ga0207691_10001498 3300025940 Bacteria 23269
313 Ga0207691_10040375 3300025940 Bacteria 4311
314 Ga0207691_10144202 3300025940 Bacteria 2097
315 Ga0207691_10184335 3300025940 Bacteria 1823
316 Ga0207691_10186249 3300025940 Bacteria 1812
317 Ga0207691_10430271 3300025940 Bacteria 1124
318 Ga0207691_10585020 3300025940 Bacteria 945
319 Ga0207691_10664077 3300025940 Bacteria 880
320 Ga0207711_10016383 3300025941 Bacteria 6161
321 Ga0207711_10884152 3300025941 Bacteria 831
322 Ga0207689_10009559 3300025942 Bacteria 8364
323 Ga0207689_10113332 3300025942 Bacteria 2229
324 Ga0207689_10468374 3300025942 Bacteria 1054
325 Ga0207661_11555386 3300025944 Unclassified 606
326 Ga0207679_10349124 3300025945 Bacteria 1289
327 Ga0207679_10731712 3300025945 Bacteria 899
328 Ga0207651_10119483 3300025960 Bacteria 1996
329 Ga0207651_10300707 3300025960 Bacteria 1334
330 Ga0207651_10339182 3300025960 Bacteria 1262
331 Ga0207651_10532118 3300025960 Bacteria 1020
332 Ga0207651_10533592 3300025960 Bacteria 1018
333 Ga0207651_10858317 3300025960 Bacteria 807
334 Ga0207712_10004623 3300025961 Bacteria 8693
335 Ga0207712_10311393 3300025961 Bacteria 1296
336 Ga0207668_10024665 3300025972 Bacteria 3884
337 Ga0207668_10226587 3300025972 Bacteria 1504
338 Ga0207668_10257246 3300025972 Bacteria 1421
339 Ga0207668_10798930 3300025972 Bacteria 835
340 Ga0207640_10044374 3300025981 Bacteria 2848
341 Ga0207640_10703313 3300025981 Bacteria 867
342 Ga0207640_11154065 3300025981 Bacteria 687
343 Ga0207658_10003013 3300025986 Bacteria 12045
344 Ga0207658_10007981 3300025986 Bacteria 7206
345 Ga0207658_10120698 3300025986 Bacteria 2089
346 Ga0207658_10180050 3300025986 Bacteria 1749
347 Ga0207658_10544585 3300025986 Bacteria 1038
348 Ga0207677_10033420 3300026023 Bacteria 3319
349 Ga0207677_10035972 3300026023 Bacteria 3222
350 Ga0207677_10607816 3300026023 Bacteria 960
351 Ga0207703_10021107 3300026035 Bacteria 5097
352 Ga0207703_11636122 3300026035 Bacteria 619
353 Ga0207639_10194504 3300026041 Bacteria 1735
354 Ga0207639_10348098 3300026041 Bacteria 1323
355 Ga0207639_10966055 3300026041 Bacteria 797
356 Ga0207678_10625627 3300026067 Bacteria 945
357 Ga0207678_11419383 3300026067 Bacteria 614
358 Ga0207708_10139866 3300026075 Bacteria 1898
359 Ga0207708_10221879 3300026075 Bacteria 1515
360 Ga0207702_10178641 3300026078 Bacteria 1953
361 Ga0207641_10004568 3300026088 Bacteria 11965
362 Ga0207641_10441467 3300026088 Bacteria 1256
363 Ga0207648_10007408 3300026089 Bacteria 10800
364 Ga0207648_10008093 3300026089 Bacteria 10238
365 Ga0207648_10012908 3300026089 Bacteria 7801
366 Ga0207648_10059871 3300026089 Bacteria 3321
367 Ga0207648_10065652 3300026089 Bacteria 3164
368 Ga0207648_10351462 3300026089 Bacteria 1329
369 Ga0207648_10400697 3300026089 Bacteria 1243
370 Ga0207648_11729676 3300026089 Bacteria 587
371 Ga0207676_10066902 3300026095 Bacteria 2868
372 Ga0207676_10074889 3300026095 Bacteria 2729
373 Ga0207674_10143574 3300026116 Bacteria 2346
374 Ga0207674_10705059 3300026116 Bacteria 974
375 Ga0207675_100031877 3300026118 Bacteria 4910
376 Ga0207675_100322102 3300026118 Bacteria 1509
377 Ga0207683_10065429 3300026121 Bacteria 3206
378 Ga0207683_10515261 3300026121 Bacteria 1105
379 Ga0207683_11225779 3300026121 Bacteria 695
380 Ga0207698_10209335 3300026142 Bacteria 1753
381 Ga0207698_10213567 3300026142 Bacteria 1738
382 Ga0207698_10485084 3300026142 Bacteria 1200
383 Ga0209813_10140209 3300027866 Bacteria 858
384 Ga0209813_10171503 3300027866 Bacteria 789
385 Ga0209813_10251558 3300027866 Bacteria 672
386 Ga0268266_10278554 3300028379 Bacteria 1554
387 Ga0268266_10472704 3300028379 Bacteria 1194
388 Ga0268265_10019161 3300028380 Bacteria 4750
389 Ga0268265_10247423 3300028380 Bacteria 1577
390 Ga0268265_10707509 3300028380 Bacteria 974
391 Ga0268264_10003212 3300028381 Bacteria 14160
392 Ga0268264_10541330 3300028381 Bacteria 1141
393 Ga0268264_11231665 3300028381 Bacteria 758
394 Ga0307517_10094000 3300028786 Bacteria 2425
395 Ga0307515_10114478 3300028794 Bacteria 3117
396 Ga0307515_10199724 3300028794 Bacteria 1879
397 Ga0307515_10267821 3300028794 Bacteria 1434
398 Ga0307515_10528283 3300028794 Bacteria 789
399 Ga0307512_10099819 3300030522 Bacteria 1973
400 Ga0307513_10054292 3300031456 Bacteria 4297
401 Ga0307513_10115320 3300031456 Bacteria 2669
402 Ga0307513_10321550 3300031456 Bacteria 1305
403 Ga0307509_10000225 3300031507 Bacteria 90913
404 Ga0307408_100023888 3300031548 Bacteria 4168
405 Ga0307408_100102091 3300031548 Bacteria 2187
406 Ga0307408_100126115 3300031548 Bacteria 1991
407 Ga0307408_100204316 3300031548 Bacteria 1601
408 Ga0307408_100252647 3300031548 Bacteria 1455
409 Ga0307514_10257953 3300031649 Bacteria 1024
410 Ga0307516_10031934 3300031730 Bacteria 5307
411 Ga0307405_10124588 3300031731 Bacteria 1769
412 Ga0307405_10187711 3300031731 Bacteria 1490
413 Ga0307405_10339283 3300031731 Bacteria 1155
414 Ga0307405_10712687 3300031731 Bacteria 832
415 Ga0307413_10012583 3300031824 Bacteria 4216
416 Ga0307413_11598943 3300031824 Bacteria 579
417 Ga0307518_10322741 3300031838 Bacteria 921
418 Ga0307410_10000484 3300031852 Bacteria 16146
419 Ga0307410_10027877 3300031852 Bacteria 3575
420 Ga0307410_10534243 3300031852 Bacteria 970
421 Ga0307406_10005948 3300031901 Bacteria 6696
422 Ga0307406_10251951 3300031901 Bacteria 1331
423 Ga0307406_10967766 3300031901 Bacteria 728
424 Ga0307407_10113173 3300031903 Bacteria 1707
425 Ga0307412_10018963 3300031911 Bacteria 4153
426 Ga0307412_10209165 3300031911 Bacteria 1487
427 Ga0307412_10262494 3300031911 Bacteria 1347
428 Ga0307412_10393433 3300031911 Bacteria 1126
429 Ga0307409_100195583 3300031995 Bacteria 1804
430 Ga0307409_100486735 3300031995 Bacteria 1198
431 Ga0307409_101646596 3300031995 Bacteria 670
432 Ga0307416_100097312 3300032002 Bacteria 2548
433 Ga0307416_101340916 3300032002 Bacteria 821
434 Ga0307414_10228690 3300032004 Bacteria 1532
435 Ga0307414_10744938 3300032004 Bacteria 890
436 Ga0307411_10052407 3300032005 Bacteria 2667
437 Ga0307411_10202935 3300032005 Bacteria 1524
438 Ga0307411_10563616 3300032005 Bacteria 974
439 Ga0307415_100036458 3300032126 Bacteria 3223
440 Ga0307510_10008316 3300033180 Bacteria 12367
441 Ga0307510_10036316 3300033180 Bacteria 5485
442 Ga0307510_10067356 3300033180 Bacteria 3605
443 Ga0373931_0688082 3300035691 Bacteria 674
444 Ga0373927_0331896 3300035695 Bacteria 1002
445 Ga0373947_0622542 3300035725 Bacteria 736
446 Ga0373937_0197282 3300036401 Bacteria 1892
447 Ga0373925_0014411 3300037068 Bacteria 5715
448 Ga0395905_0032804 3300037471 Bacteria 4882
449 Ga0451789_1255977 3300041443 Bacteria 576
450 Ga0451798_0941624 3300041458 Bacteria 699
451 Ga0451800_0060364 3300041459 Bacteria 1374
452 Ga0451802_0562426 3300041460 Bacteria 501
453 Ga0451802_1793975 3300041460 Bacteria 944
454 Ga0451804_0316912 3300041463 Bacteria 942
455 Ga0451804_0366189 3300041463 Bacteria 1134
456 Ga0451807_0943994 3300041486 Bacteria 692
457 Ga0451843_0486527 3300041509 Bacteria 1882
458 Ga0451843_1255163 3300041509 Bacteria 648
459 Ga0451853_0211777 3300041512 Bacteria 750
460 Ga0451853_4085130 3300041512 Bacteria 3599
461 Ga0439450_044458 3300042008 Bacteria 1040
462 Ga0450913_001708 3300042117 Bacteria 1256
463 Ga0450896_038489 3300042133 Bacteria 740
464 Ga0450898_018315 3300042134 Bacteria 1212
465 Ga0439464_0001964 3300042439 Bacteria 4980
466 Ga0439460_0038281 3300042461 Bacteria 1398
467 Ga0451577_1181352 3300042876 Bacteria 683
468 Ga0495590_0070431 3300046457 Bacteria 1226
469 Ga0495638_0138320 3300046460 Bacteria 1424
470 Ga0495606_0413169 3300046507 Bacteria 700
471 Ga0495620_0055637 3300046515 Bacteria 1667
472 Ga0495632_0019126 3300046519 Bacteria 3739
473 Ga0495632_0029285 3300046519 Bacteria 2868
474 Ga0495642_0070721 3300046528 Bacteria 1459
475 Ga0495598_0184035 3300046537 Bacteria 747
476 Ga0495598_0189791 3300046537 Bacteria 737
477 Ga0495621_0028023 3300046539 Bacteria 1912
478 Ga0495621_0230697 3300046539 Bacteria 752
479 Ga0495597_0048612 3300046542 Bacteria 1876
480 Ga0495597_0175565 3300046542 Bacteria 868
481 Ga0495668_0087270 3300046616 Bacteria 1711
482 Ga0495625_0060457 3300046660 Bacteria 2684
483 Ga0495658_0199009 3300046683 Bacteria 1248
484 Ga0495670_0331650 3300046691 Bacteria 817
485 Ga0495649_0035019 3300046694 Bacteria 2761
486 Ga0495660_0005806 3300046810 Bacteria 7369
487 Ga0495687_000327 3300047443 Bacteria 61677
488 Ga0495687_002550 3300047443 Bacteria 14412
489 Ga0495686_0008561 3300047472 Bacteria 7493
490 Ga0495686_0295025 3300047472 Bacteria 897
491 Ga0495686_0442929 3300047472 Bacteria 691
492 Ga0495626_0019225 3300048091 Bacteria 3417
493 Ga0496100_0409067 3300048903 Bacteria 1035
494 Ga0496104_0224876 3300048907 Bacteria 1789
495 Ga0496106_0044701 3300048909 Bacteria 3325
496 Ga0496110_1407124 3300048913 Bacteria 607
497 Ga0496121_0511530 3300048924 Bacteria 760
498 Ga0496124_0119390 3300048927 Bacteria 2109
499 Ga0501309_052767 3300049129 Bacteria 641
500 Ga0501305_068677 3300049161 Bacteria 620
501 Ga0501292_002950 3300049515 Bacteria 2235
502 Ga0501294_002590 3300049517 Bacteria 1710
503 Ga0501297_055640 3300049520 Bacteria 593
504 Ga0501298_008546 3300049521 Bacteria 1723
505 Ga0501301_001221 3300049524 Bacteria 1617
506 Ga0501042_0607293 3300049578 Bacteria 795
507 Ga0501043_0000020 3300049579 Bacteria 155270
508 Ga0501046_0000039 3300049580 Bacteria 155237
509 Ga0501047_0000028 3300049581 Bacteria 220279
510 Ga0501048_0000484 3300049582 Bacteria 27870
511 Ga0501198_000001 3300049649 Bacteria 234552
512 Ga0501206_001789 3300049653 Bacteria 2696
513 Ga0501206_020954 3300049653 Bacteria 932
514 Ga0501222_000013 3300049662 Bacteria 87490
515 Ga0501253_018237 3300049683 Bacteria 1195
516 Ga0501257_016369 3300049686 Bacteria 1720
517 Ga0501221_051574 3300049704 Bacteria 928
518 Ga0501245_163336 3300049708 Bacteria 500
519 Ga0501262_000983 3300049759 Bacteria 3239
520 Ga0501265_000504 3300049762 Bacteria 4140
521 Ga0501273_016268 3300049770 Bacteria 973
522 Ga0501045_0015944 3300049824 Bacteria 5331
523 nmdc:mga03683_127849_c1 3300050489 Bacteria 1135
524 nmdc:mga03683_258740_c1 3300050489 Bacteria 810
525 nmdc:mga03683_34668_c1 3300050489 Bacteria 2043
526 nmdc:mga03683_50166_c1 3300050489 Bacteria 1393
527 nmdc:mga03n38_416692_c1 3300050490 Bacteria 742
528 nmdc:mga03n38_800757_c1 3300050490 Unclassified 549
529 nmdc:mga03n38_81622_c1 3300050490 Bacteria 1520
530 nmdc:mga00v17_16591_c1 3300050491 Bacteria 4152
531 nmdc:mga0k408_117689_c1 3300050493 Bacteria 1573
532 nmdc:mga0k408_122327_c1 3300050493 Bacteria 1542
533 nmdc:mga0k408_135833_c1 3300050493 Bacteria 1461
534 nmdc:mga0k408_18953_c1 3300050493 Bacteria 3842
535 nmdc:mga0k408_253659_c1 3300050493 Bacteria 1050
536 nmdc:mga0k408_401199_c1 3300050493 Bacteria 816
537 nmdc:mga0k408_513317_c1 3300050493 Bacteria 710
538 nmdc:mga0k408_57958_c1 3300050493 Bacteria 2249
539 nmdc:mga0k408_700031_c1 3300050493 Bacteria 594
540 nmdc:mga06z11_31050_c1 3300050494 Bacteria 2592
541 nmdc:mga06z11_362754_c1 3300050494 Bacteria 869
542 nmdc:mga06z11_475592_c1 3300050494 Bacteria 756
543 nmdc:mga04h51_54553_c1 3300050495 Bacteria 1351
544 nmdc:mga04h51_86019_c1 3300050495 Bacteria 1124
545 nmdc:mga07m45_10161_c1 3300050496 Bacteria 4909
546 nmdc:mga07m45_170805_c1 3300050496 Bacteria 1264
547 nmdc:mga07m45_17093_c1 3300050496 Bacteria 3890
548 nmdc:mga07m45_19223_c1 3300050496 Bacteria 3700
549 nmdc:mga07m45_254523_c1 3300050496 Bacteria 1021
550 nmdc:mga07m45_355797_c1 3300050496 Bacteria 851
551 nmdc:mga07m45_73334_c1 3300050496 Bacteria 1949
552 nmdc:mga08y16_219078_c1 3300050511 Bacteria 1970
553 nmdc:mga0sz30_166552_c1 3300050516 Bacteria 977
554 nmdc:mga0sz30_453400_c1 3300050516 Unclassified 576
555 Ga0495655_0045174 3300053083 Bacteria 1143
556 Ga0500578_0269661 3300053086 Bacteria 1019
557 Ga0500578_0307717 3300053086 Bacteria 938
558 Ga0500646_0051958 3300053090 Bacteria 1185
559 Ga0500583_0079909 3300053092 Bacteria 1578
560 Ga0500594_0002742 3300053118 Bacteria 3835
561 Ga0500621_026662 3300053126 Bacteria 2270
562 Ga0500658_0009667 3300053134 Bacteria 3557
563 Ga0500568_0043133 3300053139 Bacteria 1804
564 Ga0500604_0025933 3300053151 Bacteria 1687
565 Ga0500622_0000347 3300053156 Bacteria 45247
566 Ga0500645_004787 3300053730 Bacteria 5121
567 Ga0590071_005485 3300059421 Bacteria 3047
568 Ga0590074_040878 3300059423 Bacteria 834
569 nmdc:mga0k408_153854_c1
570 rootL2_10026887
571 Ga0055531_10071308
572 Ga0065715_10021876
573 Ga0065715_10720038
574 Ga0070658_10458467
575 Ga0070676_10026130
576 Ga0070676_10312707
577 Ga0070683_100992529
578 Ga0070690_100116489
579 Ga0070690_100522714
580 Ga0070670_100003220
581 Ga0070670_100357361
582 Ga0070670_100624239
583 Ga0070677_10327525
584 Ga0068869_100006018
585 Ga0068869_100600362
586 Ga0068869_100855590
587 Ga0068869_101001994
588 Ga0068869_101398413
589 Ga0070666_10005842
590 Ga0070666_10027063
591 Ga0070666_10411142
592 Ga0070666_11250166
593 Ga0068868_100057274
594 Ga0068868_100108508
595 Ga0068868_100558744
596 Ga0068868_100703906
597 Ga0070689_100753615
598 Ga0070687_100050192
599 Ga0070687_101107243
600 Ga0070661_100168108
601 Ga0070661_100536833
602 Ga0070668_100011100
603 Ga0070668_100231263
604 Ga0070668_100512239
605 Ga0070669_100017644
606 Ga0070669_100041907
607 Ga0070669_100068841
608 Ga0070669_100074021
609 Ga0070669_100289219
610 Ga0070675_100079394
611 Ga0070675_100084711
612 Ga0070675_100114972
613 Ga0070671_100043214
614 Ga0070671_100068058
615 Ga0070671_100140591
616 Ga0070671_100242409
617 Ga0070671_101325714
618 Ga0070671_101352584
619 Ga0070674_100015116
620 Ga0070674_100142333
621 Ga0070674_100321610
622 Ga0070674_100421524
623 Ga0070674_101866869
624 Ga0070674_101977099
625 Ga0070674_102163569
626 Ga0070673_100104338
627 Ga0070673_100107937
628 Ga0070673_100279428
629 Ga0070673_100595776
630 Ga0070673_100603795
631 Ga0070673_101079022
632 Ga0070659_100369700
633 Ga0070667_100002053
634 Ga0070667_100016760
635 Ga0070667_100610387
636 Ga0070667_100927243
637 Ga0070667_101451654
638 Ga0070667_102158518
639 Ga0070700_101892422
640 Ga0070708_100526662
641 Ga0070663_100375128
642 Ga0070663_101553515
643 Ga0070678_100354454
644 Ga0070678_100442568
645 Ga0070678_100754117
646 Ga0070662_100040625
647 Ga0070662_100074754
648 Ga0068867_100039168
649 Ga0068867_100048217
650 Ga0068867_100066783
651 Ga0068867_100137014
652 Ga0068867_100286849
653 Ga0068867_100494732
654 Ga0068867_101510746
655 Ga0070706_100002337
656 Ga0070707_100088292
657 Ga0070699_100462167
658 Ga0070679_101482486
659 Ga0070679_101591253
660 Ga0068853_100273069
661 Ga0068853_100408605
662 Ga0070672_100011605
663 Ga0070672_100017626
664 Ga0070672_100061377
665 Ga0070672_100155255
666 Ga0070672_100391362
667 Ga0070686_100128427
668 Ga0070686_100576132
669 Ga0070665_100953241
670 Ga0070665_101807954
671 Ga0070665_101849039
672 Ga0068855_101380704
673 Ga0070664_100214503
674 Ga0070664_101515285
675 Ga0070664_101578077
676 Ga0068857_100032353
677 Ga0068854_100069324
678 Ga0068854_100276284
679 Ga0068854_100803625
680 Ga0068854_101094006
681 Ga0068854_101451679
682 Ga0068856_100260353
683 Ga0070702_101565047
684 Ga0068852_100039460
685 Ga0068852_100212873
686 Ga0068852_100244773
687 Ga0068852_100764699
688 Ga0068859_100270336
689 Ga0068859_100389835
690 Ga0068859_101072620
691 Ga0068864_100015540
692 Ga0068864_100050174
693 Ga0068866_10002843
694 Ga0068866_10369647
695 Ga0068866_10731363
696 Ga0068861_100089167
697 Ga0068861_100223300
698 Ga0068861_101052396
699 Ga0068851_10010095
700 Ga0068851_10041979
701 Ga0068851_10327016
702 Ga0068851_10348777
703 Ga0068870_10232199
704 Ga0068870_10764895
705 Ga0068863_100008147
706 Ga0068858_100024249
707 Ga0068858_100322425
708 Ga0068858_100699931
709 Ga0068860_100010210
710 Ga0068860_100757309
711 Ga0068862_100047805
712 Ga0068862_100049502
713 Ga0081455_10908443
714 Ga0075363_100454798
715 Ga0075363_100499060
716 Ga0075363_100583718
717 Ga0075364_10178026
718 Ga0075362_10017195
719 Ga0075362_10101480
720 Ga0075362_10436476
721 Ga0075362_10548028
722 Ga0075367_10015567
723 Ga0075367_10040368
724 Ga0075367_10150660
725 Ga0075367_10675978
726 Ga0075369_10216141
727 Ga0075369_10354464
728 Ga0075366_10006193
729 Ga0075366_10011917
730 Ga0075366_10023339
731 Ga0075366_10024071
732 Ga0075366_10076863
733 Ga0075366_10092368
734 Ga0075366_10146567
735 Ga0075366_10154208
736 Ga0075366_10238071
737 Ga0075366_10264571
738 Ga0075366_10384094
739 Ga0075366_10384264
740 Ga0097621_100019117
741 Ga0097621_100271365
742 Ga0075370_10002177
743 Ga0075370_10006689
744 Ga0075370_10008615
745 Ga0075370_10077994
746 Ga0075370_10115053
747 Ga0075370_10143437
748 Ga0068871_100003964
749 Ga0068871_100225161
750 Ga0068871_100761165
751 Ga0068871_101351159
752 Ga0068871_101446870
753 Ga0068871_101676718
754 Ga0068865_100012253
755 Ga0068865_100050655
756 Ga0068865_100189229
757 Ga0068865_100620332
758 Ga0097620_100270347
759 Ga0097620_100389829
760 Ga0097620_101072645
761 Ga0105240_10415143
762 Ga0111539_13123822
763 Ga0105245_10220613
764 Ga0105243_10007512
765 Ga0105243_10053672
766 Ga0105243_10479183
767 Ga0105241_10994224
768 Ga0105242_10471181
769 Ga0105242_10682638
770 Ga0105248_10489158
771 Ga0105248_10863895
772 Ga0105248_11403709
773 Ga0105237_10048132
774 Ga0105238_10254414
775 Ga0105238_10672408
776 Ga0105238_10702547
777 Ga0105249_10076441
778 Ga0105239_10149287
779 Ga0105239_11204838
780 Ga0157373_10333173
781 Ga0157369_11395663
782 Ga0157374_10043296
783 Ga0157374_11055196
784 Ga0157378_10016476
785 Ga0157378_10338489
786 Ga0157378_11421818
787 Ga0163162_10009814
788 Ga0163162_10537560
789 Ga0163162_12067383
790 Ga0157372_10143790
791 Ga0157375_10059004
792 Ga0157375_10725135
793 Ga0157380_10044416
794 Ga0157380_10072192
795 Ga0157380_10130786
796 Ga0157380_10956428
797 Ga0157377_10572353
798 Ga0157379_10027057
799 Ga0157379_10544188
800 Ga0157379_11329915
801 Ga0157379_11682826
802 Ga0182007_10033495
803 Ga0163161_10014817
804 Ga0163161_10025520
805 Ga0163161_10539466
806 Ga0163161_10973349
807 Ga0163161_11143534
808 Ga0207666_1064659
809 Ga0209257_1021296
810 Ga0207697_10010635
811 Ga0207697_10030157
812 Ga0207697_10033168
813 Ga0207656_10016091
814 Ga0207656_10714357
815 Ga0207682_10003996
816 Ga0207682_10146971
817 Ga0207642_10008153
818 Ga0207688_10022097
819 Ga0207688_10050108
820 Ga0207688_10097909
821 Ga0207688_10194965
822 Ga0207680_10017485
823 Ga0207680_10249778
824 Ga0207647_10090324
825 Ga0207647_10365566
826 Ga0207645_10051984
827 Ga0207645_10201490
828 Ga0207645_10222756
829 Ga0207645_10757979
830 Ga0207643_10147034
831 Ga0207705_10399103
832 Ga0207684_10026601
833 Ga0207684_10091896
834 Ga0207654_10469748
835 Ga0207695_10301512
836 Ga0207671_10073873
837 Ga0207662_10028888
838 Ga0207649_10144200
839 Ga0207649_10320805
840 Ga0207649_11514413
841 Ga0207652_11700210
842 Ga0207646_10089304
843 Ga0207681_10004142
844 Ga0207681_10007931
845 Ga0207681_10046312
846 Ga0207681_10340698
847 Ga0207681_10455633
848 Ga0207694_10398476
849 Ga0207650_10000587
850 Ga0207650_10140997
851 Ga0207650_10171932
852 Ga0207650_10737075
853 Ga0207659_10000861
854 Ga0207659_10067142
855 Ga0207659_10625933
856 Ga0207687_10300670
857 Ga0207687_10627811
858 Ga0207644_10016499
859 Ga0207644_10073992
860 Ga0207690_10519798
861 Ga0207706_10264175
862 Ga0207706_10473758
863 Ga0207706_10565081
864 Ga0207686_10433439
865 Ga0207686_10720470
866 Ga0207686_11694929
867 Ga0207709_10031648
868 Ga0207709_10077216
869 Ga0207709_10207003
870 Ga0207709_11288795
871 Ga0207670_10120004
872 Ga0207669_10004732
873 Ga0207669_10012938
874 Ga0207669_10126727
875 Ga0207669_10522219
876 Ga0207669_11337992
877 Ga0207704_10022127
878 Ga0207704_10138822
879 Ga0207704_10178301
880 Ga0207691_10001498
881 Ga0207691_10040375
882 Ga0207691_10144202
883 Ga0207691_10184335
884 Ga0207691_10186249
885 Ga0207691_10430271
886 Ga0207691_10585020
887 Ga0207691_10664077
888 Ga0207711_10016383
889 Ga0207711_10884152
890 Ga0207689_10009559
891 Ga0207689_10113332
892 Ga0207689_10468374
893 Ga0207661_11555386
894 Ga0207679_10349124
895 Ga0207679_10731712
896 Ga0207651_10119483
897 Ga0207651_10300707
898 Ga0207651_10339182
899 Ga0207651_10532118
900 Ga0207651_10533592
901 Ga0207651_10858317
902 Ga0207712_10004623
903 Ga0207712_10311393
904 Ga0207668_10024665
905 Ga0207668_10226587
906 Ga0207668_10257246
907 Ga0207668_10798930
908 Ga0207640_10044374
909 Ga0207640_10703313
910 Ga0207640_11154065
911 Ga0207658_10003013
912 Ga0207658_10007981
913 Ga0207658_10120698
914 Ga0207658_10180050
915 Ga0207658_10544585
916 Ga0207677_10033420
917 Ga0207677_10035972
918 Ga0207677_10607816
919 Ga0207703_10021107
920 Ga0207703_11636122
921 Ga0207639_10194504
922 Ga0207639_10348098
923 Ga0207639_10966055
924 Ga0207678_10625627
925 Ga0207678_11419383
926 Ga0207708_10139866
927 Ga0207708_10221879
928 Ga0207702_10178641
929 Ga0207641_10004568
930 Ga0207641_10441467
931 Ga0207648_10007408
932 Ga0207648_10008093
933 Ga0207648_10012908
934 Ga0207648_10059871
935 Ga0207648_10065652
936 Ga0207648_10351462
937 Ga0207648_10400697
938 Ga0207648_11729676
939 Ga0207676_10066902
940 Ga0207676_10074889
941 Ga0207674_10143574
942 Ga0207674_10705059
943 Ga0207675_100031877
944 Ga0207675_100322102
945 Ga0207683_10065429
946 Ga0207683_10515261
947 Ga0207683_11225779
948 Ga0207698_10209335
949 Ga0207698_10213567
950 Ga0207698_10485084
951 Ga0209813_10140209
952 Ga0209813_10171503
953 Ga0209813_10251558
954 Ga0268266_10278554
955 Ga0268266_10472704
956 Ga0268265_10019161
957 Ga0268265_10247423
958 Ga0268265_10707509
959 Ga0268264_10003212
960 Ga0268264_10541330
961 Ga0268264_11231665
962 Ga0307517_10094000
963 Ga0307515_10114478
964 Ga0307515_10199724
965 Ga0307515_10267821
966 Ga0307515_10528283
967 Ga0307512_10099819
968 Ga0307513_10054292
969 Ga0307513_10115320
970 Ga0307513_10321550
971 Ga0307509_10000225
972 Ga0307408_100023888
973 Ga0307408_100102091
974 Ga0307408_100126115
975 Ga0307408_100204316
976 Ga0307408_100252647
977 Ga0307514_10257953
978 Ga0307516_10031934
979 Ga0307405_10124588
980 Ga0307405_10187711
981 Ga0307405_10339283
982 Ga0307405_10712687
983 Ga0307413_10012583
984 Ga0307413_11598943
985 Ga0307518_10322741
986 Ga0307410_10000484
987 Ga0307410_10027877
988 Ga0307410_10534243
989 Ga0307406_10005948
990 Ga0307406_10251951
991 Ga0307406_10967766
992 Ga0307407_10113173
993 Ga0307412_10018963
994 Ga0307412_10209165
995 Ga0307412_10262494
996 Ga0307412_10393433
997 Ga0307409_100195583
998 Ga0307409_100486735
999 Ga0307409_101646596
1000 Ga0307416_100097312
1001 Ga0307416_101340916
1002 Ga0307414_10228690
1003 Ga0307414_10744938
1004 Ga0307411_10052407
1005 Ga0307411_10202935
1006 Ga0307411_10563616
1007 Ga0307415_100036458
1008 Ga0307510_10008316
1009 Ga0307510_10036316
1010 Ga0307510_10067356
1011 Ga0373931_0688082
1012 Ga0373927_0331896
1013 Ga0373947_0622542
1014 Ga0373937_0197282
1015 Ga0373925_0014411
1016 Ga0395905_0032804
1017 Ga0451789_1255977
1018 Ga0451798_0941624
1019 Ga0451800_0060364
1020 Ga0451802_0562426
1021 Ga0451802_1793975
1022 Ga0451804_0316912
1023 Ga0451804_0366189
1024 Ga0451807_0943994
1025 Ga0451843_0486527
1026 Ga0451843_1255163
1027 Ga0451853_0211777
1028 Ga0451853_4085130
1029 Ga0439450_044458
1030 Ga0450913_001708
1031 Ga0450896_038489
1032 Ga0450898_018315
1033 Ga0439464_0001964
1034 Ga0439460_0038281
1035 Ga0451577_1181352
1036 Ga0495590_0070431
1037 Ga0495638_0138320
1038 Ga0495606_0413169
1039 Ga0495620_0055637
1040 Ga0495632_0019126
1041 Ga0495632_0029285
1042 Ga0495642_0070721
1043 Ga0495598_0184035
1044 Ga0495598_0189791
1045 Ga0495621_0028023
1046 Ga0495621_0230697
1047 Ga0495597_0048612
1048 Ga0495597_0175565
1049 Ga0495668_0087270
1050 Ga0495625_0060457
1051 Ga0495658_0199009
1052 Ga0495670_0331650
1053 Ga0495649_0035019
1054 Ga0495660_0005806
1055 Ga0495687_000327
1056 Ga0495687_002550
1057 Ga0495686_0008561
1058 Ga0495686_0295025
1059 Ga0495686_0442929
1060 Ga0495626_0019225
1061 Ga0496100_0409067
1062 Ga0496104_0224876
1063 Ga0496106_0044701
1064 Ga0496110_1407124
1065 Ga0496121_0511530
1066 Ga0496124_0119390
1067 Ga0501309_052767
1068 Ga0501305_068677
1069 Ga0501292_002950
1070 Ga0501294_002590
1071 Ga0501297_055640
1072 Ga0501298_008546
1073 Ga0501301_001221
1074 Ga0501042_0607293
1075 Ga0501043_0000020
1076 Ga0501046_0000039
1077 Ga0501047_0000028
1078 Ga0501048_0000484
1079 Ga0501198_000001
1080 Ga0501206_001789
1081 Ga0501206_020954
1082 Ga0501222_000013
1083 Ga0501253_018237
1084 Ga0501257_016369
1085 Ga0501221_051574
1086 Ga0501245_163336
1087 Ga0501262_000983
1088 Ga0501265_000504
1089 Ga0501273_016268
1090 Ga0501045_0015944
1091 nmdc:mga03683_127849_c1
1092 nmdc:mga03683_258740_c1
1093 nmdc:mga03683_34668_c1
1094 nmdc:mga03683_50166_c1
1095 nmdc:mga03n38_416692_c1
1096 nmdc:mga03n38_800757_c1
1097 nmdc:mga03n38_81622_c1
1098 nmdc:mga00v17_16591_c1
1099 nmdc:mga0k408_117689_c1
1100 nmdc:mga0k408_122327_c1
1101 nmdc:mga0k408_135833_c1
1102 nmdc:mga0k408_18953_c1
1103 nmdc:mga0k408_253659_c1
1104 nmdc:mga0k408_401199_c1
1105 nmdc:mga0k408_513317_c1
1106 nmdc:mga0k408_57958_c1
1107 nmdc:mga0k408_700031_c1
1108 nmdc:mga06z11_31050_c1
1109 nmdc:mga06z11_362754_c1
1110 nmdc:mga06z11_475592_c1
1111 nmdc:mga04h51_54553_c1
1112 nmdc:mga04h51_86019_c1
1113 nmdc:mga07m45_10161_c1
1114 nmdc:mga07m45_170805_c1
1115 nmdc:mga07m45_17093_c1
1116 nmdc:mga07m45_19223_c1
1117 nmdc:mga07m45_254523_c1
1118 nmdc:mga07m45_355797_c1
1119 nmdc:mga07m45_73334_c1
1120 nmdc:mga08y16_219078_c1
1121 nmdc:mga0sz30_166552_c1
1122 nmdc:mga0sz30_453400_c1
1123 Ga0495655_0045174
1124 Ga0500578_0269661
1125 Ga0500578_0307717
1126 Ga0500646_0051958
1127 Ga0500583_0079909
1128 Ga0500594_0002742
1129 Ga0500621_026662
1130 Ga0500658_0009667
1131 Ga0500568_0043133
1132 Ga0500604_0025933
1133 Ga0500622_0000347
1134 Ga0500645_004787
1135 Ga0590071_005485
1136 Ga0590074_040878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16137

DUF4845

Domain of unknown function (DUF4845)

63

145

0.98

Map