F464677

General Info

Members Datasets Scaffolds Average Seq Length
568 320 1136 318

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0014337|Ga0495601_0014337_2881_3939
Length 352
Sequence MRARPPGLDGAGQMAPAGRYAAPMTTMRAIQMTEFGGPEVLELADLPIPEPAAGEVLIRVSRAGVNFADTHTRTNSYVRKATLPLVPGGEVAGTIARAPAEGGGLEEGARVVALTGTGGYAEYATAPAAHAFAIPDGVEDGTALALIVQGTTAWHLYRTAGRVAEGESVVVHSAAGGVGSLAVQLGHALGAGRVIGTASSEKRRELALSLGADAAVDPAPEGLTERLLQANGGEPVDVVLDMAGGATFDASYEALSHFGRIVVCGISSEEPNRVSTGSLLRHSRAVVGFYLFHCLQRPGMFGEALADLFARVARGELQAVVGGTYPLAEAARAHEDLRGRRTTGKLLLDPAA

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
171 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
198 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
299 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
300 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
301 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
302 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
303 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
308 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
309 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
310 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
311 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
312 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
313 2862574272 Streptomyces sp. AcE210 Isolate Nodule
314 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
315 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
316 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
317 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
318 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
319 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
320 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.35
Isolates 2.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0.18
Rhizoplane 8.27
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0014337 3300053077 Bacteria 4774
2 JGI24735J21928_10008106 3300002067 Bacteria 3408
3 JGI25160J50197_1027544 3300003354 Bacteria 1544
4 Ga0070658_10149554 3300005327 Bacteria 1954
5 Ga0070676_10016946 3300005328 Bacteria 4028
6 Ga0070676_10078983 3300005328 Bacteria 1991
7 Ga0070676_10099842 3300005328 Bacteria 1791
8 Ga0070683_100021152 3300005329 Bacteria 5801
9 Ga0070690_100057431 3300005330 Bacteria 2498
10 Ga0070670_100003423 3300005331 Bacteria 13166
11 Ga0070670_100003853 3300005331 Bacteria 12508
12 Ga0070670_100151587 3300005331 Bacteria 2006
13 Ga0070677_10006162 3300005333 Bacteria 3980
14 Ga0068869_100002225 3300005334 Bacteria 11665
15 Ga0068869_100053236 3300005334 Bacteria 2941
16 Ga0068869_100298279 3300005334 Bacteria 1300
17 Ga0070666_10075883 3300005335 Bacteria 2292
18 Ga0070666_10078019 3300005335 Bacteria 2261
19 Ga0070680_100140990 3300005336 Bacteria 2021
20 Ga0070680_100168411 3300005336 Bacteria 1843
21 Ga0070682_100008989 3300005337 Bacteria 5646
22 Ga0070682_100099709 3300005337 Bacteria 1915
23 Ga0068868_100000506 3300005338 Bacteria 26045
24 Ga0068868_100002416 3300005338 Bacteria 12929
25 Ga0068868_100086667 3300005338 Bacteria 2517
26 Ga0068868_100128776 3300005338 Bacteria 2070
27 Ga0070660_100073883 3300005339 Bacteria 2666
28 Ga0070660_100245163 3300005339 Bacteria 1460
29 Ga0070689_100195733 3300005340 Bacteria 1648
30 Ga0070691_10003548 3300005341 Bacteria 7035
31 Ga0070687_100015465 3300005343 Bacteria 3452
32 Ga0070661_100013545 3300005344 Bacteria 5725
33 Ga0070661_100162632 3300005344 Bacteria 1691
34 Ga0070692_10025409 3300005345 Bacteria 2918
35 Ga0070675_100002379 3300005354 Bacteria 14006
36 Ga0070675_100036729 3300005354 Bacteria 3988
37 Ga0070675_100183178 3300005354 Bacteria 1812
38 Ga0070671_100015608 3300005355 Bacteria 6137
39 Ga0070671_100110448 3300005355 Bacteria 2309
40 Ga0070674_100034607 3300005356 Bacteria 3375
41 Ga0070674_100046514 3300005356 Bacteria 2969
42 Ga0070673_100000290 3300005364 Bacteria 26028
43 Ga0070673_100090496 3300005364 Bacteria 2500
44 Ga0070667_100300496 3300005367 Bacteria 1445
45 Ga0070667_100334616 3300005367 Bacteria 1368
46 Ga0070709_10036390 3300005434 Bacteria 2998
47 Ga0070713_100029854 3300005436 Bacteria 4323
48 Ga0070713_100070019 3300005436 Bacteria 2960
49 Ga0070710_10000271 3300005437 Bacteria 24519
50 Ga0070710_10029817 3300005437 Bacteria 2930
51 Ga0070710_10117396 3300005437 Bacteria 1606
52 Ga0070710_10193769 3300005437 Bacteria 1279
53 Ga0070711_100000326 3300005439 Bacteria 24637
54 Ga0070711_100420716 3300005439 Bacteria 1089
55 Ga0070700_100007928 3300005441 Bacteria 5763
56 Ga0070700_100128890 3300005441 Bacteria 1704
57 Ga0070700_100169288 3300005441 Bacteria 1511
58 Ga0070663_100002860 3300005455 Bacteria 9823
59 Ga0070663_100199127 3300005455 Bacteria 1562
60 Ga0070678_100002873 3300005456 Bacteria 9539
61 Ga0070678_100006404 3300005456 Bacteria 6906
62 Ga0070678_100041381 3300005456 Bacteria 3266
63 Ga0070662_100045540 3300005457 Bacteria 3148
64 Ga0070662_100091596 3300005457 Bacteria 2284
65 Ga0070662_100306071 3300005457 Bacteria 1292
66 Ga0070681_10017899 3300005458 Bacteria 7082
67 Ga0070681_10020771 3300005458 Bacteria 6578
68 Ga0068867_100009938 3300005459 Bacteria 6703
69 Ga0068867_100056416 3300005459 Bacteria 2906
70 Ga0070685_10033859 3300005466 Bacteria 2874
71 Ga0070707_100061114 3300005468 Bacteria 3613
72 Ga0070698_100402490 3300005471 Bacteria 1302
73 Ga0070699_100305811 3300005518 Bacteria 1427
74 Ga0070679_100022494 3300005530 Bacteria 6161
75 Ga0070679_100022860 3300005530 Bacteria 6115
76 Ga0070679_100045732 3300005530 Bacteria 4362
77 Ga0070684_100248828 3300005535 Bacteria 1624
78 Ga0068853_100103336 3300005539 Bacteria 2522
79 Ga0068853_100162990 3300005539 Bacteria 2013
80 Ga0070672_100003493 3300005543 Bacteria 10182
81 Ga0070686_100149891 3300005544 Bacteria 1632
82 Ga0070693_100002484 3300005547 Bacteria 8496
83 Ga0070693_100170341 3300005547 Bacteria 1394
84 Ga0070665_100027256 3300005548 Bacteria 5754
85 Ga0070665_100062791 3300005548 Bacteria 3724
86 Ga0070665_100526605 3300005548 Bacteria 1194
87 Ga0068855_100167154 3300005563 Bacteria 2493
88 Ga0070664_100005082 3300005564 Bacteria 10551
89 Ga0070664_100090735 3300005564 Bacteria 2644
90 Ga0070664_100105592 3300005564 Bacteria 2453
91 Ga0068854_100001523 3300005578 Bacteria 14057
92 Ga0068854_100018014 3300005578 Bacteria 4735
93 Ga0068856_100007435 3300005614 Bacteria 10690
94 Ga0068856_100158159 3300005614 Bacteria 2276
95 Ga0070702_100001869 3300005615 Bacteria 8805
96 Ga0070702_100003637 3300005615 Bacteria 6936
97 Ga0070702_100011469 3300005615 Bacteria 4409
98 Ga0070702_100017476 3300005615 Bacteria 3700
99 Ga0070702_100282862 3300005615 Bacteria 1139
100 Ga0068852_100001955 3300005616 Bacteria 14037
101 Ga0068852_100039516 3300005616 Bacteria 3972
102 Ga0068852_100077349 3300005616 Bacteria 2941
103 Ga0068852_100227546 3300005616 Bacteria 1776
104 Ga0068859_100510001 3300005617 Bacteria 1298
105 Ga0068864_100051888 3300005618 Bacteria 3534
106 Ga0068864_100110090 3300005618 Bacteria 2452
107 Ga0068864_100248548 3300005618 Bacteria 1650
108 Ga0068866_10018149 3300005718 Bacteria 3177
109 Ga0068866_10216622 3300005718 Bacteria 1153
110 Ga0068861_100179309 3300005719 Bacteria 1762
111 Ga0068861_100181051 3300005719 Bacteria 1754
112 Ga0068851_10006943 3300005834 Bacteria 5190
113 Ga0068870_10204620 3300005840 Bacteria 1199
114 Ga0068863_100016289 3300005841 Bacteria 7133
115 Ga0068863_100024215 3300005841 Bacteria 5790
116 Ga0068863_100033462 3300005841 Bacteria 4897
117 Ga0068863_100437582 3300005841 Bacteria 1282
118 Ga0068858_100068154 3300005842 Bacteria 3297
119 Ga0068858_100105978 3300005842 Bacteria 2624
120 Ga0068858_100328979 3300005842 Bacteria 1461
121 Ga0081538_10003652 3300005981 Bacteria 14456
122 Ga0081538_10011533 3300005981 Bacteria 7153
123 Ga0081540_1000863 3300005983 Bacteria 27456
124 Ga0081539_10005001 3300005985 Bacteria 14004
125 Ga0081539_10096977 3300005985 Bacteria 1511
126 Ga0070717_10415975 3300006028 Bacteria 1209
127 Ga0070717_10447360 3300006028 Bacteria 1164
128 Ga0075432_10018453 3300006058 Bacteria 2380
129 Ga0070712_100051663 3300006175 Bacteria 2864
130 Ga0070712_100234177 3300006175 Bacteria 1460
131 Ga0097621_100005925 3300006237 Bacteria 8639
132 Ga0068871_100006079 3300006358 Bacteria 8496
133 Ga0068871_100011522 3300006358 Bacteria 6486
134 Ga0068871_100470214 3300006358 Bacteria 1129
135 Ga0075428_100010486 3300006844 Bacteria 10297
136 Ga0075428_100084841 3300006844 Bacteria 3455
137 Ga0075430_100185583 3300006846 Bacteria 1729
138 Ga0075431_100046941 3300006847 Bacteria 4453
139 Ga0075431_100063053 3300006847 Bacteria 3824
140 Ga0075433_10150727 3300006852 Bacteria 2069
141 Ga0075434_100012093 3300006871 Bacteria 8173
142 Ga0075429_100020347 3300006880 Bacteria 5756
143 Ga0075429_100062582 3300006880 Bacteria 3242
144 Ga0075429_100111907 3300006880 Bacteria 2386
145 Ga0068865_100040225 3300006881 Bacteria 3175
146 Ga0068865_100050351 3300006881 Bacteria 2877
147 Ga0075436_100029586 3300006914 Bacteria 3766
148 Ga0097620_100509959 3300006931 Bacteria 1298
149 Ga0075435_100000815 3300007076 Bacteria 19432
150 Ga0105251_10050701 3300009011 Bacteria 1982
151 Ga0105240_10007499 3300009093 Bacteria 15829
152 Ga0105240_10012503 3300009093 Bacteria 11713
153 Ga0105240_10057686 3300009093 Bacteria 4849
154 Ga0105240_10129707 3300009093 Bacteria 3026
155 Ga0111539_10290268 3300009094 Bacteria 1903
156 Ga0105245_10009265 3300009098 Bacteria 8587
157 Ga0105245_10060811 3300009098 Bacteria 3403
158 Ga0105245_10278219 3300009098 Bacteria 1635
159 Ga0105245_10357817 3300009098 Bacteria 1448
160 Ga0105245_10511661 3300009098 Bacteria 1218
161 Ga0114129_10016322 3300009147 Bacteria 10571
162 Ga0114129_10056024 3300009147 Bacteria 5524
163 Ga0114129_10166952 3300009147 Bacteria 3003
164 Ga0105243_10009731 3300009148 Bacteria 7322
165 Ga0105243_10026406 3300009148 Bacteria 4444
166 Ga0105243_10124834 3300009148 Bacteria 2176
167 Ga0105243_10612658 3300009148 Bacteria 1050
168 Ga0105241_10003029 3300009174 Bacteria 12554
169 Ga0105248_10016037 3300009177 Bacteria 8246
170 Ga0105248_10082167 3300009177 Bacteria 3622
171 Ga0105248_10095342 3300009177 Bacteria 3350
172 Ga0105248_10420450 3300009177 Bacteria 1505
173 Ga0105237_10000431 3300009545 Bacteria 59607
174 Ga0105237_10153808 3300009545 Bacteria 2296
175 Ga0105238_10027344 3300009551 Bacteria 5811
176 Ga0105238_10207821 3300009551 Bacteria 1933
177 Ga0105249_10071695 3300009553 Bacteria 3201
178 Ga0105239_10021851 3300010375 Bacteria 7054
179 Ga0105239_10228790 3300010375 Bacteria 2086
180 Ga0105246_10001085 3300011119 Bacteria 15741
181 Ga0157370_10140191 3300013104 Bacteria 2253
182 Ga0157369_10438335 3300013105 Bacteria 1353
183 Ga0157374_10000911 3300013296 Bacteria 25717
184 Ga0157374_10188364 3300013296 Bacteria 2018
185 Ga0157374_10204772 3300013296 Bacteria 1933
186 Ga0157374_10427324 3300013296 Bacteria 1324
187 Ga0157378_10076496 3300013297 Bacteria 3016
188 Ga0163162_10006814 3300013306 Bacteria 11084
189 Ga0157372_10000022 3300013307 Bacteria 206038
190 Ga0157372_10568161 3300013307 Bacteria 1322
191 Ga0157375_10001769 3300013308 Bacteria 18549
192 Ga0157375_10036375 3300013308 Bacteria 4710
193 Ga0163163_10023671 3300014325 Bacteria 5832
194 Ga0163163_10143792 3300014325 Bacteria 2428
195 Ga0163163_10319002 3300014325 Bacteria 1607
196 Ga0182008_10234623 3300014497 Bacteria 942
197 Ga0157377_10032234 3300014745 Bacteria 2852
198 Ga0157377_10060511 3300014745 Bacteria 2162
199 Ga0157377_10076425 3300014745 Bacteria 1948
200 Ga0157379_10214132 3300014968 Bacteria 1745
201 Ga0157376_10005443 3300014969 Bacteria 8901
202 Ga0157376_10097525 3300014969 Bacteria 2561
203 Ga0163161_10024730 3300017792 Bacteria 4245
204 Ga0206353_10182179 3300020082 Bacteria 2079
205 Ga0207426_1002250 3300025302 Bacteria 12808
206 Ga0207656_10006689 3300025321 Bacteria 4164
207 Ga0207713_1052834 3300025735 Bacteria 1605
208 Ga0207682_10003415 3300025893 Bacteria 6909
209 Ga0207682_10021726 3300025893 Bacteria 2525
210 Ga0207692_10000110 3300025898 Bacteria 24396
211 Ga0207692_10039479 3300025898 Bacteria 2323
212 Ga0207642_10071238 3300025899 Bacteria 1655
213 Ga0207710_10040903 3300025900 Bacteria 2055
214 Ga0207688_10001198 3300025901 Bacteria 13408
215 Ga0207688_10099623 3300025901 Bacteria 1676
216 Ga0207688_10122542 3300025901 Bacteria 1518
217 Ga0207680_10170816 3300025903 Bacteria 1464
218 Ga0207699_10109962 3300025906 Bacteria 1764
219 Ga0207645_10006949 3300025907 Bacteria 8060
220 Ga0207643_10000125 3300025908 Bacteria 53016
221 Ga0207643_10038359 3300025908 Bacteria 2691
222 Ga0207705_10028217 3300025909 Bacteria 4001
223 Ga0207684_10031595 3300025910 Bacteria 4503
224 Ga0207654_10063063 3300025911 Bacteria 2174
225 Ga0207695_10006100 3300025913 Bacteria 15724
226 Ga0207695_10073737 3300025913 Bacteria 3477
227 Ga0207671_10001590 3300025914 Bacteria 25816
228 Ga0207671_10131395 3300025914 Bacteria 1922
229 Ga0207693_10039655 3300025915 Bacteria 3708
230 Ga0207693_10063941 3300025915 Bacteria 2883
231 Ga0207693_10193426 3300025915 Bacteria 1601
232 Ga0207663_10000379 3300025916 Bacteria 19428
233 Ga0207663_10125655 3300025916 Bacteria 1764
234 Ga0207660_10017794 3300025917 Bacteria 4729
235 Ga0207660_10279483 3300025917 Bacteria 1325
236 Ga0207657_10035210 3300025919 Bacteria 4492
237 Ga0207649_10004951 3300025920 Bacteria 7200
238 Ga0207652_10066100 3300025921 Bacteria 3133
239 Ga0207646_10389653 3300025922 Bacteria 1259
240 Ga0207694_10049972 3300025924 Bacteria 3238
241 Ga0207694_10203102 3300025924 Bacteria 1613
242 Ga0207650_10005762 3300025925 Bacteria 8450
243 Ga0207650_10017951 3300025925 Bacteria 4958
244 Ga0207650_10066187 3300025925 Bacteria 2709
245 Ga0207659_10000428 3300025926 Bacteria 25327
246 Ga0207659_10035778 3300025926 Bacteria 3435
247 Ga0207687_10048994 3300025927 Bacteria 2936
248 Ga0207687_10068102 3300025927 Bacteria 2535
249 Ga0207687_10123589 3300025927 Bacteria 1939
250 Ga0207700_10053448 3300025928 Bacteria 3027
251 Ga0207664_10406746 3300025929 Bacteria 1211
252 Ga0207644_10000583 3300025931 Bacteria 23344
253 Ga0207690_10135985 3300025932 Bacteria 1805
254 Ga0207706_10030590 3300025933 Bacteria 4801
255 Ga0207706_10036583 3300025933 Bacteria 4361
256 Ga0207706_10063915 3300025933 Bacteria 3240
257 Ga0207669_10115848 3300025937 Bacteria 1807
258 Ga0207704_10246539 3300025938 Bacteria 1338
259 Ga0207691_10000948 3300025940 Bacteria 28719
260 Ga0207691_10102816 3300025940 Bacteria 2548
261 Ga0207711_10120421 3300025941 Bacteria 2342
262 Ga0207711_10179348 3300025941 Bacteria 1925
263 Ga0207711_10194299 3300025941 Bacteria 1850
264 Ga0207689_10000198 3300025942 Bacteria 53018
265 Ga0207689_10004523 3300025942 Bacteria 12591
266 Ga0207661_10003071 3300025944 Bacteria 11554
267 Ga0207661_10003247 3300025944 Bacteria 11270
268 Ga0207679_10004505 3300025945 Bacteria 8677
269 Ga0207679_10049257 3300025945 Bacteria 3073
270 Ga0207679_10121514 3300025945 Bacteria 2080
271 Ga0207679_10412110 3300025945 Bacteria 1191
272 Ga0207667_10067350 3300025949 Bacteria 3730
273 Ga0207651_10014981 3300025960 Bacteria 4492
274 Ga0207651_10017968 3300025960 Bacteria 4194
275 Ga0207651_10044129 3300025960 Bacteria 2981
276 Ga0207640_10034098 3300025981 Bacteria 3174
277 Ga0207640_10151067 3300025981 Bacteria 1706
278 Ga0207677_10000856 3300026023 Bacteria 17405
279 Ga0207677_10023483 3300026023 Bacteria 3811
280 Ga0207678_10000141 3300026067 Bacteria 59147
281 Ga0207678_10110680 3300026067 Bacteria 2343
282 Ga0207708_10011989 3300026075 Bacteria 6459
283 Ga0207708_10016633 3300026075 Bacteria 5533
284 Ga0207708_10152849 3300026075 Bacteria 1818
285 Ga0207708_10209491 3300026075 Bacteria 1558
286 Ga0207702_10006992 3300026078 Bacteria 9657
287 Ga0207702_10012008 3300026078 Bacteria 7200
288 Ga0207702_10081251 3300026078 Bacteria 2814
289 Ga0207641_10017988 3300026088 Bacteria 5791
290 Ga0207641_10026463 3300026088 Bacteria 4787
291 Ga0207648_10008599 3300026089 Bacteria 9873
292 Ga0207648_10009609 3300026089 Bacteria 9252
293 Ga0207648_10193459 3300026089 Bacteria 1803
294 Ga0207676_10001346 3300026095 Bacteria 18259
295 Ga0207676_10009032 3300026095 Bacteria 7096
296 Ga0207676_10076926 3300026095 Bacteria 2698
297 Ga0207674_10540757 3300026116 Bacteria 1125
298 Ga0207675_100111926 3300026118 Bacteria 2576
299 Ga0207683_10000172 3300026121 Bacteria 55979
300 Ga0207683_10000313 3300026121 Bacteria 44050
301 Ga0207683_10010950 3300026121 Bacteria 7735
302 Ga0207698_10015047 3300026142 Bacteria 5168
303 Ga0207698_10025915 3300026142 Bacteria 4140
304 Ga0209969_1001278 3300027360 Bacteria 3468
305 Ga0210000_1005439 3300027462 Bacteria 1846
306 Ga0209999_1000296 3300027543 Bacteria 7351
307 Ga0209971_1009581 3300027682 Bacteria 2294
308 Ga0209974_10002906 3300027876 Bacteria 6213
309 Ga0209974_10072904 3300027876 Bacteria 1173
310 Ga0268266_10058570 3300028379 Bacteria 3317
311 Ga0268264_10023387 3300028381 Bacteria 5042
312 Ga0265319_1054827 3300028563 Bacteria 1306
313 Ga0265318_10004816 3300028577 Bacteria 6459
314 Ga0307517_10010040 3300028786 Bacteria 13310
315 Ga0307517_10133063 3300028786 Bacteria 1781
316 Ga0316177_1042586 3300030731 Bacteria 5203
317 Ga0316180_1004638 3300030736 Bacteria 2188
318 Ga0265760_10001145 3300031090 Bacteria 7711
319 Ga0265330_10002094 3300031235 Bacteria 11025
320 Ga0265332_10000673 3300031238 Bacteria 22062
321 Ga0265320_10003250 3300031240 Bacteria 10986
322 Ga0265329_10006060 3300031242 Bacteria 4829
323 Ga0265339_10063293 3300031249 Bacteria 1987
324 Ga0265331_10002978 3300031250 Bacteria 11147
325 Ga0265327_10051674 3300031251 Bacteria 2144
326 Ga0265316_10008265 3300031344 Bacteria 9675
327 Ga0307509_10148950 3300031507 Bacteria 2260
328 Ga0307408_100069624 3300031548 Bacteria 2595
329 Ga0265314_10003101 3300031711 Bacteria 16353
330 Ga0265342_10002141 3300031712 Bacteria 17424
331 Ga0307516_10353047 3300031730 Bacteria 1136
332 Ga0307405_10023706 3300031731 Bacteria 3493
333 Ga0307405_10026517 3300031731 Bacteria 3344
334 Ga0307413_10039450 3300031824 Bacteria 2746
335 Ga0307518_10000036 3300031838 Bacteria 91114
336 Ga0307410_10010700 3300031852 Bacteria 5213
337 Ga0307409_100021443 3300031995 Bacteria 4429
338 Ga0307409_100033985 3300031995 Bacteria 3718
339 Ga0307416_100017969 3300032002 Bacteria 4966
340 Ga0307416_100058124 3300032002 Bacteria 3133
341 Ga0307416_100094899 3300032002 Bacteria 2574
342 Ga0307416_100556510 3300032002 Bacteria 1221
343 Ga0307415_100017115 3300032126 Bacteria 4339
344 Ga0373947_0056069 3300035725 Bacteria 2381
345 Ga0395899_0234581 3300037312 Bacteria 1265
346 Ga0395898_0117044 3300037466 Bacteria 2553
347 Ga0395898_0219930 3300037466 Bacteria 1812
348 Ga0395905_0024577 3300037471 Bacteria 5685
349 Ga0439463_045454 3300042016 Bacteria 1118
350 Ga0439459_0038488 3300042438 Bacteria 1006
351 Ga0451577_0328234 3300042876 Bacteria 1388
352 Ga0466969_0023038 3300044656 Bacteria 3211
353 Ga0466965_0034703 3300044683 Bacteria 2468
354 Ga0466966_0003085 3300044684 Bacteria 10980
355 Ga0466966_0039600 3300044684 Bacteria 3035
356 Ga0466966_0060323 3300044684 Bacteria 2395
357 Ga0466961_0000190 3300044693 Bacteria 40985
358 Ga0466961_0026551 3300044693 Bacteria 3722
359 Ga0466961_0030290 3300044693 Bacteria 3478
360 Ga0466961_0032781 3300044693 Bacteria 3338
361 Ga0466961_0037519 3300044693 Bacteria 3108
362 Ga0466964_0069070 3300044706 Bacteria 1489
363 Ga0466968_0151450 3300044735 Bacteria 1066
364 Ga0466959_0036084 3300045049 Bacteria 3653
365 Ga0466959_0043746 3300045049 Bacteria 3300
366 Ga0466958_0008873 3300045836 Bacteria 5585
367 Ga0466958_0061336 3300045836 Bacteria 2291
368 Ga0466958_0065926 3300045836 Bacteria 2210
369 Ga0466967_0410777 3300045976 Bacteria 1318
370 Ga0495592_0018018 3300046454 Bacteria 5364
371 Ga0495629_0019151 3300046459 Bacteria 4893
372 Ga0495629_0028004 3300046459 Bacteria 4002
373 Ga0495651_0048938 3300046462 Bacteria 3264
374 Ga0495653_0001671 3300046463 Bacteria 17440
375 Ga0495653_0014011 3300046463 Bacteria 6538
376 Ga0495580_0080079 3300046472 Bacteria 2278
377 Ga0495580_0085059 3300046472 Bacteria 2203
378 Ga0495605_0075585 3300046474 Bacteria 1584
379 Ga0495662_0008122 3300046476 Bacteria 5169
380 Ga0495664_0000073 3300046477 Bacteria 49243
381 Ga0495664_0030446 3300046477 Bacteria 3161
382 Ga0495664_0080641 3300046477 Bacteria 1950
383 Ga0495608_0014491 3300046511 Bacteria 5467
384 Ga0495608_0101175 3300046511 Bacteria 1858
385 Ga0495618_0000046 3300046514 Bacteria 93942
386 Ga0495628_0040560 3300046516 Bacteria 3720
387 Ga0495628_0268102 3300046516 Bacteria 1271
388 Ga0495630_0001117 3300046517 Bacteria 18462
389 Ga0495632_0030314 3300046519 Bacteria 2809
390 Ga0495643_0003006 3300046522 Bacteria 12686
391 Ga0495666_0059263 3300046526 Bacteria 1831
392 Ga0495666_0061023 3300046526 Bacteria 1801
393 Ga0495642_0090659 3300046528 Bacteria 1294
394 Ga0495652_0014520 3300046529 Bacteria 7068
395 Ga0495652_0035994 3300046529 Bacteria 4306
396 Ga0495640_0011689 3300046533 Bacteria 6739
397 Ga0495645_0000022 3300046543 Bacteria 137019
398 Ga0495645_0003048 3300046543 Bacteria 11343
399 Ga0495645_0004535 3300046543 Bacteria 9476
400 Ga0495667_0050042 3300046559 Bacteria 2758
401 Ga0495635_0008722 3300046663 Bacteria 7079
402 Ga0495657_0000041 3300046675 Bacteria 115251
403 Ga0495657_0014917 3300046675 Bacteria 5698
404 Ga0495657_0045523 3300046675 Bacteria 2977
405 Ga0495599_0053763 3300046678 Bacteria 2522
406 Ga0495623_0087283 3300046679 Bacteria 1922
407 Ga0495646_0012198 3300046680 Bacteria 5464
408 Ga0495646_0168533 3300046680 Bacteria 1208
409 Ga0495647_0085092 3300046681 Bacteria 1288
410 Ga0495669_0062539 3300046684 Bacteria 1687
411 Ga0495613_0002329 3300046689 Bacteria 14377
412 Ga0495613_0050954 3300046689 Bacteria 3052
413 Ga0495613_0116494 3300046689 Bacteria 1922
414 Ga0495670_0006343 3300046691 Bacteria 5810
415 Ga0495581_0020780 3300047315 Bacteria 3808
416 Ga0495581_0130179 3300047315 Bacteria 1466
417 Ga0495604_0000216 3300047317 Bacteria 52795
418 Ga0495604_0003567 3300047317 Bacteria 12404
419 Ga0495604_0021804 3300047317 Bacteria 5113
420 Ga0495604_0299046 3300047317 Bacteria 1081
421 Ga0495674_0002673 3300047319 Bacteria 17352
422 Ga0495676_0031407 3300047321 Bacteria 4492
423 Ga0495676_0044071 3300047321 Bacteria 3645
424 Ga0495675_0034732 3300047444 Bacteria 3219
425 Ga0495681_0006206 3300047470 Bacteria 7883
426 Ga0495684_0002822 3300047471 Bacteria 13698
427 Ga0495602_0074274 3300048088 Bacteria 2890
428 Ga0496100_0015459 3300048903 Bacteria 4458
429 Ga0496100_0038504 3300048903 Bacteria 3031
430 Ga0496101_0043891 3300048904 Bacteria 3197
431 Ga0496102_0000040 3300048905 Bacteria 196737
432 Ga0496102_0063027 3300048905 Bacteria 3394
433 Ga0496102_0072593 3300048905 Bacteria 3163
434 Ga0496103_0000294 3300048906 Bacteria 46122
435 Ga0496104_0000006 3300048907 Bacteria 536446
436 Ga0496104_0017947 3300048907 Bacteria 6451
437 Ga0496104_0065527 3300048907 Bacteria 3447
438 Ga0496104_0080101 3300048907 Bacteria 3113
439 Ga0496105_0004008 3300048908 Bacteria 11018
440 Ga0496105_0007657 3300048908 Bacteria 8370
441 Ga0496105_0109076 3300048908 Bacteria 2285
442 Ga0496106_0002994 3300048909 Bacteria 12576
443 Ga0496106_0281674 3300048909 Bacteria 1332
444 Ga0496108_0005808 3300048911 Bacteria 10003
445 Ga0496108_0026932 3300048911 Bacteria 4744
446 Ga0496108_0075204 3300048911 Bacteria 2853
447 Ga0496108_0213234 3300048911 Bacteria 1676
448 Ga0496108_0292630 3300048911 Bacteria 1418
449 Ga0496109_0015228 3300048912 Bacteria 6695
450 Ga0496109_0052239 3300048912 Bacteria 3724
451 Ga0496109_0053866 3300048912 Bacteria 3670
452 Ga0496109_0223390 3300048912 Bacteria 1771
453 Ga0496109_0406832 3300048912 Bacteria 1286
454 Ga0496110_0000044 3300048913 Bacteria 61218
455 Ga0496110_0019503 3300048913 Bacteria 5708
456 Ga0496110_0026526 3300048913 Bacteria 4959
457 Ga0496110_0029727 3300048913 Bacteria 4706
458 Ga0496110_0045394 3300048913 Bacteria 3841
459 Ga0496110_0074130 3300048913 Bacteria 3022
460 Ga0496111_0000304 3300048914 Bacteria 24108
461 Ga0496111_0042508 3300048914 Bacteria 3263
462 Ga0496111_0081176 3300048914 Bacteria 2367
463 Ga0496111_0149551 3300048914 Bacteria 1732
464 Ga0496112_0113577 3300048915 Bacteria 2679
465 Ga0496113_0034637 3300048916 Bacteria 3685
466 Ga0496113_0038427 3300048916 Bacteria 3519
467 Ga0496113_0095713 3300048916 Bacteria 2295
468 Ga0496113_0121837 3300048916 Bacteria 2039
469 Ga0496114_0161347 3300048917 Bacteria 1950
470 Ga0496114_0177593 3300048917 Bacteria 1858
471 Ga0496115_0000059 3300048918 Bacteria 102022
472 Ga0496115_0000087 3300048918 Bacteria 86513
473 Ga0496115_0151824 3300048918 Bacteria 1913
474 Ga0496115_0165275 3300048918 Bacteria 1830
475 Ga0496122_0157026 3300048925 Bacteria 1394
476 Ga0496124_0018661 3300048927 Bacteria 6488
477 Ga0496124_0034827 3300048927 Bacteria 4412
478 Ga0501031_0013765 3300049568 Bacteria 5273
479 Ga0501032_0002157 3300049569 Bacteria 15505
480 Ga0501032_0028281 3300049569 Bacteria 3852
481 Ga0501033_0017480 3300049570 Bacteria 5418
482 Ga0501033_0029993 3300049570 Bacteria 4087
483 Ga0501033_0035959 3300049570 Bacteria 3713
484 Ga0501033_0050003 3300049570 Bacteria 3102
485 Ga0501034_0009005 3300049571 Bacteria 10484
486 Ga0501034_0037215 3300049571 Bacteria 4927
487 Ga0501036_0017828 3300049572 Bacteria 5942
488 Ga0501036_0030117 3300049572 Bacteria 4585
489 Ga0501036_0126835 3300049572 Bacteria 2155
490 Ga0501037_0004888 3300049573 Bacteria 9746
491 Ga0501037_0034377 3300049573 Bacteria 3740
492 Ga0501037_0116875 3300049573 Bacteria 1919
493 Ga0501037_0141391 3300049573 Bacteria 1722
494 Ga0501038_0022596 3300049574 Bacteria 5633
495 Ga0501038_0033572 3300049574 Bacteria 4519
496 Ga0501038_0036163 3300049574 Bacteria 4334
497 Ga0501038_0178666 3300049574 Bacteria 1714
498 Ga0501039_0092640 3300049575 Bacteria 2355
499 Ga0501040_0006671 3300049576 Bacteria 7492
500 Ga0501041_0009101 3300049577 Bacteria 5843
501 Ga0501042_0012321 3300049578 Bacteria 5789
502 Ga0501042_0037421 3300049578 Bacteria 3443
503 Ga0501042_0106903 3300049578 Bacteria 2014
504 Ga0501043_0000952 3300049579 Bacteria 25679
505 Ga0501046_0008376 3300049580 Bacteria 9013
506 Ga0501047_0000261 3300049581 Bacteria 61793
507 Ga0501047_0000547 3300049581 Bacteria 40575
508 Ga0501047_0029622 3300049581 Bacteria 5278
509 Ga0501047_0036940 3300049581 Bacteria 4721
510 Ga0501047_0058535 3300049581 Bacteria 3722
511 Ga0501048_0137723 3300049582 Bacteria 1725
512 Ga0501067_0001659 3300049583 Bacteria 12224
513 Ga0501068_0001603 3300049584 Bacteria 12047
514 Ga0501068_0164821 3300049584 Bacteria 1397
515 Ga0501070_0054657 3300049586 Bacteria 3311
516 Ga0501070_0153481 3300049586 Bacteria 1899
517 Ga0501071_0009745 3300049587 Bacteria 6409
518 Ga0501071_0110115 3300049587 Bacteria 2035
519 Ga0501072_0028700 3300049588 Bacteria 4343
520 Ga0501073_0038136 3300049589 Bacteria 3410
521 Ga0501076_0137846 3300049592 Bacteria 1981
522 Ga0501079_0012317 3300049741 Bacteria 6524
523 Ga0501080_0117664 3300049742 Bacteria 2463
524 Ga0501080_0201499 3300049742 Bacteria 1827
525 Ga0501083_0005717 3300049744 Bacteria 8800
526 Ga0501035_0003878 3300049822 Bacteria 14268
527 Ga0501035_0013704 3300049822 Bacteria 7480
528 Ga0501044_0017091 3300049823 Bacteria 7784
529 Ga0501044_0033101 3300049823 Bacteria 5432
530 Ga0501044_0066204 3300049823 Bacteria 3684
531 Ga0501044_0263956 3300049823 Bacteria 1659
532 nmdc:mga05p37_8283_c1 3300050507 Bacteria 12292
533 nmdc:mga05p37_9413_c1 3300050507 Bacteria 3114
534 nmdc:mga09592_116029_c1 3300050508 Bacteria 2298
535 nmdc:mga09592_286195_c1 3300050508 Bacteria 1429
536 nmdc:mga09592_62259_c1 3300050508 Bacteria 3156
537 nmdc:mga06r32_12954_c1 3300050510 Bacteria 7540
538 nmdc:mga08y16_11879_c1 3300050511 Bacteria 9147
539 nmdc:mga08y16_16853_c1 3300050511 Bacteria 7691
540 nmdc:mga0n895_501_c1 3300050512 Bacteria 26516
541 nmdc:mga0rr50_78481_c1 3300050513 Bacteria 2541
542 nmdc:mga08x19_22229_c1 3300050514 Bacteria 3926
543 Ga0495601_0016278 3300053077 Bacteria 4505
544 Ga0495601_0111260 3300053077 Bacteria 1774
545 Ga0495612_0000103 3300053078 Bacteria 36230
546 Ga0495655_0009659 3300053083 Bacteria 1878
547 Ga0500646_0000042 3300053090 Bacteria 35008
548 Ga0500569_003941 3300053109 Bacteria 3081
549 Ga0500621_071573 3300053126 Bacteria 1397
550 Ga0500652_014799 3300053131 Bacteria 2799
551 Ga0500561_0002038 3300053137 Bacteria 3359
552 Ga0500616_0026798 3300053153 Bacteria 3186
553 Ga0500633_0001764 3300053160 Bacteria 4226
554 Ga0501084_0303566 3300054114 Bacteria 1348
555 2586058134 2585427649 Bacteria 9053857
556 2753076049 2751185734 Bacteria 8863695
557 2795794280 2795385472 Bacteria 6627535
558 2809593019 2808606522 Bacteria 9488490
559 2833711309 2833709550 Bacteria 4008291
560 2837185764 2837183177 Bacteria 4637169
561 2862583986 2862574272 Bacteria 10567477
562 2870730211 2870721527 Bacteria 9689237
563 2915768288 2915768154 Bacteria 8424322
564 2917739793 2917736166 Bacteria 9690793
565 2995470999 2995463766 Bacteria 8577691
566 2997457330 2997451912 Bacteria 8492419
567 3006327679 3006321560 Bacteria 8247479
568 8047718273 8047710418 Bacteria 11023148
569 Ga0495601_0014337
570 JGI24735J21928_10008106
571 JGI25160J50197_1027544
572 Ga0070658_10149554
573 Ga0070676_10016946
574 Ga0070676_10078983
575 Ga0070676_10099842
576 Ga0070683_100021152
577 Ga0070690_100057431
578 Ga0070670_100003423
579 Ga0070670_100003853
580 Ga0070670_100151587
581 Ga0070677_10006162
582 Ga0068869_100002225
583 Ga0068869_100053236
584 Ga0068869_100298279
585 Ga0070666_10075883
586 Ga0070666_10078019
587 Ga0070680_100140990
588 Ga0070680_100168411
589 Ga0070682_100008989
590 Ga0070682_100099709
591 Ga0068868_100000506
592 Ga0068868_100002416
593 Ga0068868_100086667
594 Ga0068868_100128776
595 Ga0070660_100073883
596 Ga0070660_100245163
597 Ga0070689_100195733
598 Ga0070691_10003548
599 Ga0070687_100015465
600 Ga0070661_100013545
601 Ga0070661_100162632
602 Ga0070692_10025409
603 Ga0070675_100002379
604 Ga0070675_100036729
605 Ga0070675_100183178
606 Ga0070671_100015608
607 Ga0070671_100110448
608 Ga0070674_100034607
609 Ga0070674_100046514
610 Ga0070673_100000290
611 Ga0070673_100090496
612 Ga0070667_100300496
613 Ga0070667_100334616
614 Ga0070709_10036390
615 Ga0070713_100029854
616 Ga0070713_100070019
617 Ga0070710_10000271
618 Ga0070710_10029817
619 Ga0070710_10117396
620 Ga0070710_10193769
621 Ga0070711_100000326
622 Ga0070711_100420716
623 Ga0070700_100007928
624 Ga0070700_100128890
625 Ga0070700_100169288
626 Ga0070663_100002860
627 Ga0070663_100199127
628 Ga0070678_100002873
629 Ga0070678_100006404
630 Ga0070678_100041381
631 Ga0070662_100045540
632 Ga0070662_100091596
633 Ga0070662_100306071
634 Ga0070681_10017899
635 Ga0070681_10020771
636 Ga0068867_100009938
637 Ga0068867_100056416
638 Ga0070685_10033859
639 Ga0070707_100061114
640 Ga0070698_100402490
641 Ga0070699_100305811
642 Ga0070679_100022494
643 Ga0070679_100022860
644 Ga0070679_100045732
645 Ga0070684_100248828
646 Ga0068853_100103336
647 Ga0068853_100162990
648 Ga0070672_100003493
649 Ga0070686_100149891
650 Ga0070693_100002484
651 Ga0070693_100170341
652 Ga0070665_100027256
653 Ga0070665_100062791
654 Ga0070665_100526605
655 Ga0068855_100167154
656 Ga0070664_100005082
657 Ga0070664_100090735
658 Ga0070664_100105592
659 Ga0068854_100001523
660 Ga0068854_100018014
661 Ga0068856_100007435
662 Ga0068856_100158159
663 Ga0070702_100001869
664 Ga0070702_100003637
665 Ga0070702_100011469
666 Ga0070702_100017476
667 Ga0070702_100282862
668 Ga0068852_100001955
669 Ga0068852_100039516
670 Ga0068852_100077349
671 Ga0068852_100227546
672 Ga0068859_100510001
673 Ga0068864_100051888
674 Ga0068864_100110090
675 Ga0068864_100248548
676 Ga0068866_10018149
677 Ga0068866_10216622
678 Ga0068861_100179309
679 Ga0068861_100181051
680 Ga0068851_10006943
681 Ga0068870_10204620
682 Ga0068863_100016289
683 Ga0068863_100024215
684 Ga0068863_100033462
685 Ga0068863_100437582
686 Ga0068858_100068154
687 Ga0068858_100105978
688 Ga0068858_100328979
689 Ga0081538_10003652
690 Ga0081538_10011533
691 Ga0081540_1000863
692 Ga0081539_10005001
693 Ga0081539_10096977
694 Ga0070717_10415975
695 Ga0070717_10447360
696 Ga0075432_10018453
697 Ga0070712_100051663
698 Ga0070712_100234177
699 Ga0097621_100005925
700 Ga0068871_100006079
701 Ga0068871_100011522
702 Ga0068871_100470214
703 Ga0075428_100010486
704 Ga0075428_100084841
705 Ga0075430_100185583
706 Ga0075431_100046941
707 Ga0075431_100063053
708 Ga0075433_10150727
709 Ga0075434_100012093
710 Ga0075429_100020347
711 Ga0075429_100062582
712 Ga0075429_100111907
713 Ga0068865_100040225
714 Ga0068865_100050351
715 Ga0075436_100029586
716 Ga0097620_100509959
717 Ga0075435_100000815
718 Ga0105251_10050701
719 Ga0105240_10007499
720 Ga0105240_10012503
721 Ga0105240_10057686
722 Ga0105240_10129707
723 Ga0111539_10290268
724 Ga0105245_10009265
725 Ga0105245_10060811
726 Ga0105245_10278219
727 Ga0105245_10357817
728 Ga0105245_10511661
729 Ga0114129_10016322
730 Ga0114129_10056024
731 Ga0114129_10166952
732 Ga0105243_10009731
733 Ga0105243_10026406
734 Ga0105243_10124834
735 Ga0105243_10612658
736 Ga0105241_10003029
737 Ga0105248_10016037
738 Ga0105248_10082167
739 Ga0105248_10095342
740 Ga0105248_10420450
741 Ga0105237_10000431
742 Ga0105237_10153808
743 Ga0105238_10027344
744 Ga0105238_10207821
745 Ga0105249_10071695
746 Ga0105239_10021851
747 Ga0105239_10228790
748 Ga0105246_10001085
749 Ga0157370_10140191
750 Ga0157369_10438335
751 Ga0157374_10000911
752 Ga0157374_10188364
753 Ga0157374_10204772
754 Ga0157374_10427324
755 Ga0157378_10076496
756 Ga0163162_10006814
757 Ga0157372_10000022
758 Ga0157372_10568161
759 Ga0157375_10001769
760 Ga0157375_10036375
761 Ga0163163_10023671
762 Ga0163163_10143792
763 Ga0163163_10319002
764 Ga0182008_10234623
765 Ga0157377_10032234
766 Ga0157377_10060511
767 Ga0157377_10076425
768 Ga0157379_10214132
769 Ga0157376_10005443
770 Ga0157376_10097525
771 Ga0163161_10024730
772 Ga0206353_10182179
773 Ga0207426_1002250
774 Ga0207656_10006689
775 Ga0207713_1052834
776 Ga0207682_10003415
777 Ga0207682_10021726
778 Ga0207692_10000110
779 Ga0207692_10039479
780 Ga0207642_10071238
781 Ga0207710_10040903
782 Ga0207688_10001198
783 Ga0207688_10099623
784 Ga0207688_10122542
785 Ga0207680_10170816
786 Ga0207699_10109962
787 Ga0207645_10006949
788 Ga0207643_10000125
789 Ga0207643_10038359
790 Ga0207705_10028217
791 Ga0207684_10031595
792 Ga0207654_10063063
793 Ga0207695_10006100
794 Ga0207695_10073737
795 Ga0207671_10001590
796 Ga0207671_10131395
797 Ga0207693_10039655
798 Ga0207693_10063941
799 Ga0207693_10193426
800 Ga0207663_10000379
801 Ga0207663_10125655
802 Ga0207660_10017794
803 Ga0207660_10279483
804 Ga0207657_10035210
805 Ga0207649_10004951
806 Ga0207652_10066100
807 Ga0207646_10389653
808 Ga0207694_10049972
809 Ga0207694_10203102
810 Ga0207650_10005762
811 Ga0207650_10017951
812 Ga0207650_10066187
813 Ga0207659_10000428
814 Ga0207659_10035778
815 Ga0207687_10048994
816 Ga0207687_10068102
817 Ga0207687_10123589
818 Ga0207700_10053448
819 Ga0207664_10406746
820 Ga0207644_10000583
821 Ga0207690_10135985
822 Ga0207706_10030590
823 Ga0207706_10036583
824 Ga0207706_10063915
825 Ga0207669_10115848
826 Ga0207704_10246539
827 Ga0207691_10000948
828 Ga0207691_10102816
829 Ga0207711_10120421
830 Ga0207711_10179348
831 Ga0207711_10194299
832 Ga0207689_10000198
833 Ga0207689_10004523
834 Ga0207661_10003071
835 Ga0207661_10003247
836 Ga0207679_10004505
837 Ga0207679_10049257
838 Ga0207679_10121514
839 Ga0207679_10412110
840 Ga0207667_10067350
841 Ga0207651_10014981
842 Ga0207651_10017968
843 Ga0207651_10044129
844 Ga0207640_10034098
845 Ga0207640_10151067
846 Ga0207677_10000856
847 Ga0207677_10023483
848 Ga0207678_10000141
849 Ga0207678_10110680
850 Ga0207708_10011989
851 Ga0207708_10016633
852 Ga0207708_10152849
853 Ga0207708_10209491
854 Ga0207702_10006992
855 Ga0207702_10012008
856 Ga0207702_10081251
857 Ga0207641_10017988
858 Ga0207641_10026463
859 Ga0207648_10008599
860 Ga0207648_10009609
861 Ga0207648_10193459
862 Ga0207676_10001346
863 Ga0207676_10009032
864 Ga0207676_10076926
865 Ga0207674_10540757
866 Ga0207675_100111926
867 Ga0207683_10000172
868 Ga0207683_10000313
869 Ga0207683_10010950
870 Ga0207698_10015047
871 Ga0207698_10025915
872 Ga0209969_1001278
873 Ga0210000_1005439
874 Ga0209999_1000296
875 Ga0209971_1009581
876 Ga0209974_10002906
877 Ga0209974_10072904
878 Ga0268266_10058570
879 Ga0268264_10023387
880 Ga0265319_1054827
881 Ga0265318_10004816
882 Ga0307517_10010040
883 Ga0307517_10133063
884 Ga0316177_1042586
885 Ga0316180_1004638
886 Ga0265760_10001145
887 Ga0265330_10002094
888 Ga0265332_10000673
889 Ga0265320_10003250
890 Ga0265329_10006060
891 Ga0265339_10063293
892 Ga0265331_10002978
893 Ga0265327_10051674
894 Ga0265316_10008265
895 Ga0307509_10148950
896 Ga0307408_100069624
897 Ga0265314_10003101
898 Ga0265342_10002141
899 Ga0307516_10353047
900 Ga0307405_10023706
901 Ga0307405_10026517
902 Ga0307413_10039450
903 Ga0307518_10000036
904 Ga0307410_10010700
905 Ga0307409_100021443
906 Ga0307409_100033985
907 Ga0307416_100017969
908 Ga0307416_100058124
909 Ga0307416_100094899
910 Ga0307416_100556510
911 Ga0307415_100017115
912 Ga0373947_0056069
913 Ga0395899_0234581
914 Ga0395898_0117044
915 Ga0395898_0219930
916 Ga0395905_0024577
917 Ga0439463_045454
918 Ga0439459_0038488
919 Ga0451577_0328234
920 Ga0466969_0023038
921 Ga0466965_0034703
922 Ga0466966_0003085
923 Ga0466966_0039600
924 Ga0466966_0060323
925 Ga0466961_0000190
926 Ga0466961_0026551
927 Ga0466961_0030290
928 Ga0466961_0032781
929 Ga0466961_0037519
930 Ga0466964_0069070
931 Ga0466968_0151450
932 Ga0466959_0036084
933 Ga0466959_0043746
934 Ga0466958_0008873
935 Ga0466958_0061336
936 Ga0466958_0065926
937 Ga0466967_0410777
938 Ga0495592_0018018
939 Ga0495629_0019151
940 Ga0495629_0028004
941 Ga0495651_0048938
942 Ga0495653_0001671
943 Ga0495653_0014011
944 Ga0495580_0080079
945 Ga0495580_0085059
946 Ga0495605_0075585
947 Ga0495662_0008122
948 Ga0495664_0000073
949 Ga0495664_0030446
950 Ga0495664_0080641
951 Ga0495608_0014491
952 Ga0495608_0101175
953 Ga0495618_0000046
954 Ga0495628_0040560
955 Ga0495628_0268102
956 Ga0495630_0001117
957 Ga0495632_0030314
958 Ga0495643_0003006
959 Ga0495666_0059263
960 Ga0495666_0061023
961 Ga0495642_0090659
962 Ga0495652_0014520
963 Ga0495652_0035994
964 Ga0495640_0011689
965 Ga0495645_0000022
966 Ga0495645_0003048
967 Ga0495645_0004535
968 Ga0495667_0050042
969 Ga0495635_0008722
970 Ga0495657_0000041
971 Ga0495657_0014917
972 Ga0495657_0045523
973 Ga0495599_0053763
974 Ga0495623_0087283
975 Ga0495646_0012198
976 Ga0495646_0168533
977 Ga0495647_0085092
978 Ga0495669_0062539
979 Ga0495613_0002329
980 Ga0495613_0050954
981 Ga0495613_0116494
982 Ga0495670_0006343
983 Ga0495581_0020780
984 Ga0495581_0130179
985 Ga0495604_0000216
986 Ga0495604_0003567
987 Ga0495604_0021804
988 Ga0495604_0299046
989 Ga0495674_0002673
990 Ga0495676_0031407
991 Ga0495676_0044071
992 Ga0495675_0034732
993 Ga0495681_0006206
994 Ga0495684_0002822
995 Ga0495602_0074274
996 Ga0496100_0015459
997 Ga0496100_0038504
998 Ga0496101_0043891
999 Ga0496102_0000040
1000 Ga0496102_0063027
1001 Ga0496102_0072593
1002 Ga0496103_0000294
1003 Ga0496104_0000006
1004 Ga0496104_0017947
1005 Ga0496104_0065527
1006 Ga0496104_0080101
1007 Ga0496105_0004008
1008 Ga0496105_0007657
1009 Ga0496105_0109076
1010 Ga0496106_0002994
1011 Ga0496106_0281674
1012 Ga0496108_0005808
1013 Ga0496108_0026932
1014 Ga0496108_0075204
1015 Ga0496108_0213234
1016 Ga0496108_0292630
1017 Ga0496109_0015228
1018 Ga0496109_0052239
1019 Ga0496109_0053866
1020 Ga0496109_0223390
1021 Ga0496109_0406832
1022 Ga0496110_0000044
1023 Ga0496110_0019503
1024 Ga0496110_0026526
1025 Ga0496110_0029727
1026 Ga0496110_0045394
1027 Ga0496110_0074130
1028 Ga0496111_0000304
1029 Ga0496111_0042508
1030 Ga0496111_0081176
1031 Ga0496111_0149551
1032 Ga0496112_0113577
1033 Ga0496113_0034637
1034 Ga0496113_0038427
1035 Ga0496113_0095713
1036 Ga0496113_0121837
1037 Ga0496114_0161347
1038 Ga0496114_0177593
1039 Ga0496115_0000059
1040 Ga0496115_0000087
1041 Ga0496115_0151824
1042 Ga0496115_0165275
1043 Ga0496122_0157026
1044 Ga0496124_0018661
1045 Ga0496124_0034827
1046 Ga0501031_0013765
1047 Ga0501032_0002157
1048 Ga0501032_0028281
1049 Ga0501033_0017480
1050 Ga0501033_0029993
1051 Ga0501033_0035959
1052 Ga0501033_0050003
1053 Ga0501034_0009005
1054 Ga0501034_0037215
1055 Ga0501036_0017828
1056 Ga0501036_0030117
1057 Ga0501036_0126835
1058 Ga0501037_0004888
1059 Ga0501037_0034377
1060 Ga0501037_0116875
1061 Ga0501037_0141391
1062 Ga0501038_0022596
1063 Ga0501038_0033572
1064 Ga0501038_0036163
1065 Ga0501038_0178666
1066 Ga0501039_0092640
1067 Ga0501040_0006671
1068 Ga0501041_0009101
1069 Ga0501042_0012321
1070 Ga0501042_0037421
1071 Ga0501042_0106903
1072 Ga0501043_0000952
1073 Ga0501046_0008376
1074 Ga0501047_0000261
1075 Ga0501047_0000547
1076 Ga0501047_0029622
1077 Ga0501047_0036940
1078 Ga0501047_0058535
1079 Ga0501048_0137723
1080 Ga0501067_0001659
1081 Ga0501068_0001603
1082 Ga0501068_0164821
1083 Ga0501070_0054657
1084 Ga0501070_0153481
1085 Ga0501071_0009745
1086 Ga0501071_0110115
1087 Ga0501072_0028700
1088 Ga0501073_0038136
1089 Ga0501076_0137846
1090 Ga0501079_0012317
1091 Ga0501080_0117664
1092 Ga0501080_0201499
1093 Ga0501083_0005717
1094 Ga0501035_0003878
1095 Ga0501035_0013704
1096 Ga0501044_0017091
1097 Ga0501044_0033101
1098 Ga0501044_0066204
1099 Ga0501044_0263956
1100 nmdc:mga05p37_8283_c1
1101 nmdc:mga05p37_9413_c1
1102 nmdc:mga09592_116029_c1
1103 nmdc:mga09592_286195_c1
1104 nmdc:mga09592_62259_c1
1105 nmdc:mga06r32_12954_c1
1106 nmdc:mga08y16_11879_c1
1107 nmdc:mga08y16_16853_c1
1108 nmdc:mga0n895_501_c1
1109 nmdc:mga0rr50_78481_c1
1110 nmdc:mga08x19_22229_c1
1111 Ga0495601_0016278
1112 Ga0495601_0111260
1113 Ga0495612_0000103
1114 Ga0495655_0009659
1115 Ga0500646_0000042
1116 Ga0500569_003941
1117 Ga0500621_071573
1118 Ga0500652_014799
1119 Ga0500561_0002038
1120 Ga0500616_0026798
1121 Ga0500633_0001764
1122 Ga0501084_0303566
1123 2586058134
1124 2753076049
1125 2795794280
1126 2809593019
1127 2833711309
1128 2837185764
1129 2862583986
1130 2870730211
1131 2915768288
1132 2917739793
1133 2995470999
1134 2997457330
1135 3006327679
1136 8047718273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

52

136

0.96

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

177

311

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

210

348

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9276 1 315
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.926 1 315
4rvu-assembly2.cif.gz_B the native structure of mycobacterial rv1454c complexed with nadph 0.9251 1 315
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9247 1 315
4rvu-assembly1.cif.gz_D the native structure of mycobacterial rv1454c complexed with nadph 0.923 1 315
ID Description Score Start End Superfamily
af_B0BNC9_26_350_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9391 2 314 3.90.180.10
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 114 258 3.40.50.720
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9353 112 283 3.40.50.720
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9336 115 280 3.40.50.720
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.926 125 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1H6CWX0-F1-model_v4 NADPH2:quinone reductase 0.9838 1 317 GO:0016491
AF-A0A6J4PZM8-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9543 134 254 GO:0016491
AF-A0A2S7MY95-F1-model_v4 Alcohol dehydrogenase 0.9542 1 317 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A2S7MY95-F1-model_v4 Alcohol dehydrogenase 0.9513 1 317 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A399DWR7-F1-model_v4 2-haloacrylate reductase (EC 1.3.1.103) 0.9499 134 315 GO:0102523

Map