F464683

General Info

Members Datasets Scaffolds Average Seq Length
568 311 1136 170

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2861691609|2861692264
Length 198
Sequence EDDLLRLPEGSALPYRPCVGVALFNRDGQVFIGRRKREAGPEHVEGDRAWQMPQGGIDEGEEPLAAALRELHEETNVPAEAVTWLGETRDWLAYDLPPAVMKQAWKGRYRGQRQKWFAFGLTGSETVIDVDAPGGGRHKPEFEAWRWERLDALPDLIIPFKRPVYEGVVAAFSGLTGWHGAEGDPAEGPAAGRADGPV

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
288 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
293 2643221558 Rhizobium sp. Root149 Isolate Unclassified
294 2643221629 Devosia sp. Root105 Isolate Unclassified
295 2643221662 Devosia sp. Root413D1 Isolate Unclassified
296 2643221674 Devosia sp. Root436 Isolate Unclassified
297 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
298 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
299 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
300 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
301 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
302 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
303 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
304 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
305 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
306 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
307 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
308 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
309 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
310 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
311 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 0.88
Rhizoplane 2.11
Rhizosphere 86.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10049266 3300001990 Bacteria 1281
2 JGI25165J46597_1002342 3300003214 Bacteria 6376
3 rootH1_10110309 3300003316 Bacteria 1346
4 rootH2_10023430 3300003320 Bacteria 3790
5 rootH2_10163117 3300003320 Bacteria 4255
6 rootH1_10133252 3300003323 Bacteria 2018
7 Ga0070683_100076546 3300005329 Bacteria 3128
8 Ga0070683_100151361 3300005329 Bacteria 2200
9 Ga0068869_100637772 3300005334 Bacteria 903
10 Ga0070682_100740058 3300005337 Bacteria 793
11 Ga0068868_100061013 3300005338 Bacteria 2987
12 Ga0070660_100005035 3300005339 Bacteria 9136
13 Ga0070660_100043481 3300005339 Bacteria 3433
14 Ga0070660_100044272 3300005339 Bacteria 3404
15 Ga0070660_100109586 3300005339 Bacteria 2195
16 Ga0070691_10434919 3300005341 Bacteria 746
17 Ga0070661_100002138 3300005344 Bacteria 13614
18 Ga0070661_100030582 3300005344 Bacteria 3890
19 Ga0070661_100038380 3300005344 Bacteria 3487
20 Ga0070661_100050194 3300005344 Bacteria 3053
21 Ga0070661_100092182 3300005344 Bacteria 2244
22 Ga0070668_100002867 3300005347 Bacteria 12717
23 Ga0070669_100653300 3300005353 Bacteria 885
24 Ga0070675_100239206 3300005354 Bacteria 1586
25 Ga0070675_100389819 3300005354 Bacteria 1241
26 Ga0070674_100019581 3300005356 Bacteria 4302
27 Ga0070673_100002917 3300005364 Bacteria 10535
28 Ga0070688_100773022 3300005365 Bacteria 749
29 Ga0070659_100151544 3300005366 Bacteria 1892
30 Ga0070667_100221079 3300005367 Bacteria 1686
31 Ga0070710_10245030 3300005437 Bacteria 1150
32 Ga0070711_100960762 3300005439 Bacteria 732
33 Ga0070663_100051249 3300005455 Bacteria 2939
34 Ga0070663_100103447 3300005455 Bacteria 2128
35 Ga0070663_100127923 3300005455 Bacteria 1926
36 Ga0070663_100499517 3300005455 Bacteria 1010
37 Ga0070662_100240217 3300005457 Bacteria 1452
38 Ga0070662_100284056 3300005457 Bacteria 1340
39 Ga0068867_100269350 3300005459 Bacteria 1392
40 Ga0070679_100274832 3300005530 Bacteria 1638
41 Ga0070679_100308787 3300005530 Bacteria 1532
42 Ga0070684_100620218 3300005535 Bacteria 1006
43 Ga0070697_100459924 3300005536 Bacteria 1109
44 Ga0068853_100001173 3300005539 Bacteria 18642
45 Ga0068853_100002927 3300005539 Bacteria 12988
46 Ga0068853_100003202 3300005539 Bacteria 12508
47 Ga0068853_100309880 3300005539 Bacteria 1461
48 Ga0068853_100593561 3300005539 Bacteria 1051
49 Ga0068853_100880238 3300005539 Bacteria 860
50 Ga0070695_100517471 3300005545 Bacteria 925
51 Ga0070693_100015338 3300005547 Bacteria 3943
52 Ga0070665_100107953 3300005548 Bacteria 2786
53 Ga0070665_100200420 3300005548 Bacteria 1996
54 Ga0068855_100013555 3300005563 Bacteria 9833
55 Ga0068855_100052706 3300005563 Bacteria 4789
56 Ga0068855_100093399 3300005563 Bacteria 3469
57 Ga0068855_100191116 3300005563 Bacteria 2309
58 Ga0068855_100956500 3300005563 Bacteria 902
59 Ga0068855_100960502 3300005563 Bacteria 900
60 Ga0070664_100082793 3300005564 Bacteria 2767
61 Ga0070664_100179544 3300005564 Bacteria 1881
62 Ga0068854_100001830 3300005578 Bacteria 12954
63 Ga0068854_100013461 3300005578 Bacteria 5371
64 Ga0068856_100035546 3300005614 Bacteria 4883
65 Ga0068856_100039147 3300005614 Bacteria 4654
66 Ga0068856_100040458 3300005614 Bacteria 4579
67 Ga0068856_100067916 3300005614 Bacteria 3523
68 Ga0068856_101083724 3300005614 Bacteria 819
69 Ga0070702_100756809 3300005615 Bacteria 747
70 Ga0068852_100007433 3300005616 Bacteria 7997
71 Ga0068852_100051436 3300005616 Bacteria 3535
72 Ga0068852_100052848 3300005616 Bacteria 3494
73 Ga0068852_100143748 3300005616 Bacteria 2210
74 Ga0068852_100282145 3300005616 Bacteria 1602
75 Ga0068859_102538217 3300005617 Bacteria 564
76 Ga0068851_10010084 3300005834 Bacteria 4402
77 Ga0068858_100179653 3300005842 Bacteria 1998
78 Ga0068860_100428821 3300005843 Bacteria 1312
79 Ga0081455_10000002 3300005937 Bacteria 460472
80 Ga0075365_10516978 3300006038 Bacteria 844
81 Ga0075368_10104514 3300006042 Bacteria 1165
82 Ga0075363_100114901 3300006048 Bacteria 1499
83 Ga0075364_10036653 3300006051 Bacteria 3171
84 Ga0075364_10156799 3300006051 Bacteria 1535
85 Ga0070715_11036566 3300006163 Bacteria 513
86 Ga0075362_10051336 3300006177 Bacteria 1845
87 Ga0075362_10061657 3300006177 Bacteria 1697
88 Ga0075367_10024872 3300006178 Bacteria 3379
89 Ga0075367_10314133 3300006178 Bacteria 987
90 Ga0075366_10079947 3300006195 Bacteria 1952
91 Ga0097621_100996517 3300006237 Bacteria 784
92 Ga0075370_10054904 3300006353 Bacteria 2263
93 Ga0075370_10086494 3300006353 Bacteria 1805
94 Ga0075370_10172935 3300006353 Bacteria 1270
95 Ga0068871_100076656 3300006358 Bacteria 2762
96 Ga0075428_100004902 3300006844 Bacteria 14861
97 Ga0075430_100108066 3300006846 Bacteria 2321
98 Ga0075431_100000787 3300006847 Bacteria 27635
99 Ga0075429_100009279 3300006880 Bacteria 8541
100 Ga0068865_100223600 3300006881 Bacteria 1473
101 Ga0075436_100412997 3300006914 Bacteria 979
102 Ga0097620_102537981 3300006931 Bacteria 564
103 Ga0079104_1004038 3300006946 Bacteria 6485
104 Ga0105240_10041453 3300009093 Bacteria 5877
105 Ga0105240_10084473 3300009093 Bacteria 3892
106 Ga0105240_10415435 3300009093 Bacteria 1513
107 Ga0105240_10462061 3300009093 Bacteria 1418
108 Ga0111539_10001373 3300009094 Bacteria 32376
109 Ga0105245_10012111 3300009098 Bacteria 7501
110 Ga0105245_10069242 3300009098 Bacteria 3199
111 Ga0105245_10163071 3300009098 Bacteria 2116
112 Ga0105247_10022161 3300009101 Bacteria 3824
113 Ga0105247_10136235 3300009101 Bacteria 1605
114 Ga0114129_10007982 3300009147 Bacteria 15071
115 Ga0105243_10525474 3300009148 Bacteria 1126
116 Ga0105243_10953344 3300009148 Bacteria 857
117 Ga0105243_11131060 3300009148 Bacteria 793
118 Ga0105241_10032260 3300009174 Bacteria 3926
119 Ga0105241_11085542 3300009174 Bacteria 753
120 Ga0105242_10144763 3300009176 Bacteria 2066
121 Ga0105242_10317605 3300009176 Bacteria 1428
122 Ga0105248_10130680 3300009177 Bacteria 2833
123 Ga0105237_10095519 3300009545 Bacteria 2962
124 Ga0105237_10416910 3300009545 Bacteria 1348
125 Ga0105238_10006072 3300009551 Bacteria 11980
126 Ga0105238_10069258 3300009551 Bacteria 3529
127 Ga0105238_10100768 3300009551 Bacteria 2871
128 Ga0105238_10579542 3300009551 Bacteria 1128
129 Ga0105238_10586800 3300009551 Bacteria 1121
130 Ga0105249_10548449 3300009553 Bacteria 1206
131 Ga0105239_10078644 3300010375 Bacteria 3630
132 Ga0105239_10199901 3300010375 Bacteria 2239
133 Ga0105239_10292716 3300010375 Bacteria 1833
134 Ga0105246_10060955 3300011119 Bacteria 2623
135 Ga0157373_10460850 3300013100 Bacteria 915
136 Ga0157370_10008447 3300013104 Bacteria 11108
137 Ga0157370_10061666 3300013104 Bacteria 3559
138 Ga0157370_10339591 3300013104 Bacteria 1384
139 Ga0157374_10150844 3300013296 Bacteria 2260
140 Ga0157378_10113174 3300013297 Bacteria 2491
141 Ga0157378_10217516 3300013297 Bacteria 1815
142 Ga0157378_10248078 3300013297 Bacteria 1703
143 Ga0163162_10045526 3300013306 Bacteria 4396
144 Ga0157372_10055104 3300013307 Bacteria 4439
145 Ga0157372_10188639 3300013307 Bacteria 2388
146 Ga0157375_10150497 3300013308 Bacteria 2462
147 Ga0163163_10272816 3300014325 Bacteria 1742
148 Ga0157376_10640169 3300014969 Bacteria 1062
149 Ga0157376_11126074 3300014969 Bacteria 811
150 Ga0163161_10727928 3300017792 Bacteria 828
151 Ga0207427_105765 3300025231 Bacteria 1686
152 Ga0209233_1000289 3300025261 Bacteria 65502
153 Ga0207656_10001196 3300025321 Bacteria 8551
154 Ga0207692_10541174 3300025898 Bacteria 743
155 Ga0207647_10057394 3300025904 Bacteria 2386
156 Ga0207645_10137989 3300025907 Bacteria 1588
157 Ga0207705_10001959 3300025909 Bacteria 16054
158 Ga0207705_10020597 3300025909 Bacteria 4709
159 Ga0207705_10317311 3300025909 Bacteria 1197
160 Ga0207705_10766058 3300025909 Bacteria 750
161 Ga0207654_10097303 3300025911 Bacteria 1807
162 Ga0207695_10120654 3300025913 Bacteria 2590
163 Ga0207695_10398341 3300025913 Bacteria 1261
164 Ga0207671_10298058 3300025914 Bacteria 1273
165 Ga0207657_10001847 3300025919 Bacteria 22875
166 Ga0207657_10004351 3300025919 Bacteria 15001
167 Ga0207657_10051959 3300025919 Bacteria 3560
168 Ga0207657_10066239 3300025919 Bacteria 3075
169 Ga0207649_10003973 3300025920 Bacteria 8063
170 Ga0207649_10015589 3300025920 Bacteria 4269
171 Ga0207649_10032185 3300025920 Bacteria 3124
172 Ga0207649_10363206 3300025920 Bacteria 1075
173 Ga0207652_10224948 3300025921 Bacteria 1691
174 Ga0207694_10055484 3300025924 Bacteria 3075
175 Ga0207694_10336337 3300025924 Bacteria 1248
176 Ga0207694_10712198 3300025924 Bacteria 847
177 Ga0207700_10157610 3300025928 Bacteria 1882
178 Ga0207690_10101711 3300025932 Bacteria 2053
179 Ga0207690_10214777 3300025932 Bacteria 1468
180 Ga0207690_10292747 3300025932 Bacteria 1271
181 Ga0207690_10978096 3300025932 Bacteria 704
182 Ga0207706_10298011 3300025933 Bacteria 1405
183 Ga0207669_10139710 3300025937 Bacteria 1679
184 Ga0207704_10219561 3300025938 Bacteria 1405
185 Ga0207665_10055079 3300025939 Bacteria 2683
186 Ga0207691_10727445 3300025940 Bacteria 836
187 Ga0207689_10630210 3300025942 Bacteria 903
188 Ga0207661_10349000 3300025944 Bacteria 1335
189 Ga0207679_10011252 3300025945 Bacteria 5785
190 Ga0207679_10484811 3300025945 Bacteria 1101
191 Ga0207667_10004448 3300025949 Bacteria 17165
192 Ga0207667_10010728 3300025949 Bacteria 10688
193 Ga0207667_10025234 3300025949 Bacteria 6509
194 Ga0207667_10054071 3300025949 Bacteria 4223
195 Ga0207667_10086052 3300025949 Bacteria 3254
196 Ga0207667_10092336 3300025949 Bacteria 3126
197 Ga0207667_10688405 3300025949 Bacteria 1026
198 Ga0207667_10707330 3300025949 Bacteria 1010
199 Ga0207651_10021509 3300025960 Bacteria 3923
200 Ga0207651_10581709 3300025960 Bacteria 977
201 Ga0207668_10003263 3300025972 Bacteria 9508
202 Ga0207640_10002261 3300025981 Bacteria 10370
203 Ga0207658_10484292 3300025986 Bacteria 1100
204 Ga0207677_10025220 3300026023 Bacteria 3705
205 Ga0207677_10450054 3300026023 Bacteria 1103
206 Ga0207703_10226009 3300026035 Bacteria 1676
207 Ga0207703_10801966 3300026035 Bacteria 899
208 Ga0207639_10001130 3300026041 Bacteria 18129
209 Ga0207639_10002574 3300026041 Bacteria 12170
210 Ga0207639_10032763 3300026041 Bacteria 3828
211 Ga0207639_10511019 3300026041 Bacteria 1099
212 Ga0207678_10057441 3300026067 Bacteria 3349
213 Ga0207678_10256170 3300026067 Bacteria 1499
214 Ga0207708_10552096 3300026075 Bacteria 971
215 Ga0207702_10019506 3300026078 Bacteria 5610
216 Ga0207702_10025300 3300026078 Bacteria 4926
217 Ga0207702_10100785 3300026078 Bacteria 2549
218 Ga0207702_10249418 3300026078 Bacteria 1666
219 Ga0207641_11477606 3300026088 Bacteria 681
220 Ga0207648_10123021 3300026089 Bacteria 2281
221 Ga0207648_10372850 3300026089 Bacteria 1289
222 Ga0207674_10003697 3300026116 Bacteria 18675
223 Ga0207674_10044178 3300026116 Bacteria 4591
224 Ga0207675_100420490 3300026118 Bacteria 1320
225 Ga0207698_10003276 3300026142 Bacteria 9727
226 Ga0207698_10009033 3300026142 Bacteria 6330
227 Ga0207698_10368344 3300026142 Bacteria 1363
228 Ga0207698_10562800 3300026142 Bacteria 1119
229 Ga0207428_10004254 3300027907 Bacteria 13701
230 Ga0268264_10516332 3300028381 Bacteria 1167
231 Ga0265319_1113913 3300028563 Bacteria 844
232 Ga0265318_10017771 3300028577 Bacteria 2913
233 Ga0265318_10044752 3300028577 Bacteria 1674
234 Ga0265324_10089185 3300029957 Bacteria 1049
235 Ga0265330_10016486 3300031235 Bacteria 3408
236 Ga0265330_10176548 3300031235 Bacteria 905
237 Ga0265330_10206188 3300031235 Bacteria 831
238 Ga0265330_10245333 3300031235 Bacteria 755
239 Ga0265320_10006100 3300031240 Bacteria 7643
240 Ga0265320_10111924 3300031240 Bacteria 1250
241 Ga0265325_10002112 3300031241 Bacteria 13571
242 Ga0265325_10012366 3300031241 Bacteria 4884
243 Ga0265325_10040986 3300031241 Bacteria 2429
244 Ga0265329_10038151 3300031242 Bacteria 1546
245 Ga0265329_10057732 3300031242 Bacteria 1230
246 Ga0265340_10030452 3300031247 Bacteria 2704
247 Ga0265340_10087211 3300031247 Bacteria 1463
248 Ga0265339_10013004 3300031249 Bacteria 5059
249 Ga0265339_10110424 3300031249 Bacteria 1423
250 Ga0265331_10003140 3300031250 Bacteria 10787
251 Ga0265331_10030823 3300031250 Bacteria 2667
252 Ga0265331_10051270 3300031250 Bacteria 1975
253 Ga0265327_10027089 3300031251 Bacteria 3305
254 Ga0265316_10044636 3300031344 Bacteria 3523
255 Ga0265316_10061937 3300031344 Bacteria 2904
256 Ga0265316_10071048 3300031344 Bacteria 2684
257 Ga0265316_10127976 3300031344 Bacteria 1914
258 Ga0265316_10308160 3300031344 Bacteria 1152
259 Ga0265316_10653399 3300031344 Bacteria 743
260 Ga0265313_10000045 3300031595 Bacteria 114646
261 Ga0265313_10010603 3300031595 Bacteria 5805
262 Ga0265313_10081830 3300031595 Bacteria 1465
263 Ga0265313_10122087 3300031595 Bacteria 1135
264 Ga0265314_10004593 3300031711 Bacteria 12745
265 Ga0265314_10025163 3300031711 Bacteria 4497
266 Ga0265314_10040088 3300031711 Bacteria 3365
267 Ga0265314_10176725 3300031711 Bacteria 1283
268 Ga0265314_10222158 3300031711 Bacteria 1102
269 Ga0265342_10008205 3300031712 Bacteria 7523
270 Ga0265342_10052475 3300031712 Bacteria 2430
271 Ga0265342_10193750 3300031712 Bacteria 1108
272 Ga0307516_10051115 3300031730 Bacteria 4053
273 Ga0307413_10031791 3300031824 Bacteria 2983
274 Ga0307413_11426614 3300031824 Bacteria 610
275 Ga0307406_10352149 3300031901 Bacteria 1151
276 Ga0307416_100337168 3300032002 Bacteria 1519
277 Ga0307416_100542504 3300032002 Bacteria 1235
278 Ga0307416_100859959 3300032002 Bacteria 1005
279 Ga0307414_10117444 3300032004 Bacteria 2038
280 Ga0307414_11282262 3300032004 Bacteria 679
281 Ga0307414_11516008 3300032004 Bacteria 624
282 Ga0307411_10234830 3300032005 Bacteria 1432
283 Ga0373934_0006551 3300035086 Bacteria 4320
284 Ga0373934_0070565 3300035086 Bacteria 1397
285 Ga0373923_0020236 3300035111 Bacteria 2583
286 Ga0373936_0000301 3300035113 Bacteria 16586
287 Ga0373941_0215802 3300035115 Bacteria 735
288 Ga0373945_0002637 3300035116 Bacteria 5617
289 Ga0373953_0000709 3300035117 Bacteria 9221
290 Ga0373953_0025327 3300035117 Bacteria 2265
291 Ga0373954_0014897 3300035118 Bacteria 3469
292 Ga0373954_0017055 3300035118 Bacteria 3257
293 Ga0373956_0226136 3300035119 Bacteria 888
294 Ga0373957_0000730 3300035120 Bacteria 8552
295 Ga0373943_0004281 3300035170 Bacteria 6482
296 Ga0373946_0003598 3300035171 Bacteria 5495
297 Ga0373955_0000164 3300035172 Bacteria 26907
298 Ga0373955_0024013 3300035172 Bacteria 3112
299 Ga0373955_0632992 3300035172 Bacteria 656
300 Ga0373924_0012208 3300035410 Bacteria 3207
301 Ga0373924_0016173 3300035410 Bacteria 2846
302 Ga0373935_0000011 3300035692 Bacteria 89873
303 Ga0373935_0063163 3300035692 Bacteria 2373
304 Ga0373927_0025272 3300035695 Bacteria 3882
305 Ga0373927_0168835 3300035695 Bacteria 1434
306 Ga0373927_0187439 3300035695 Bacteria 1357
307 Ga0373933_0000357 3300035724 Bacteria 29188
308 Ga0373933_0005248 3300035724 Bacteria 7063
309 Ga0373947_0000139 3300035725 Bacteria 37679
310 Ga0373937_0000041 3300036401 Bacteria 108866
311 Ga0373937_0001701 3300036401 Bacteria 18497
312 Ga0373937_0473088 3300036401 Bacteria 1190
313 Ga0373925_0000048 3300037068 Bacteria 129615
314 Ga0373925_0519608 3300037068 Bacteria 978
315 Ga0395899_0105789 3300037312 Bacteria 2026
316 Ga0395900_0020719 3300037418 Bacteria 6719
317 Ga0395900_0214754 3300037418 Bacteria 1941
318 Ga0395898_0152891 3300037466 Bacteria 2207
319 Ga0395898_0575036 3300037466 Bacteria 1069
320 Ga0395898_1184543 3300037466 Bacteria 695
321 Ga0436364_0458239 3300037853 Bacteria 979
322 Ga0436364_0515436 3300037853 Bacteria 1046
323 Ga0436364_0624265 3300037853 Bacteria 1596
324 Ga0436364_0855514 3300037853 Bacteria 1389
325 Ga0436364_1069039 3300037853 Bacteria 847
326 Ga0395901_0137719 3300038443 Bacteria 2565
327 Ga0395901_0289566 3300038443 Bacteria 1700
328 Ga0395901_0613888 3300038443 Bacteria 1095
329 Ga0436360_1039408 3300039438 Bacteria 665
330 Ga0436360_1094690 3300039438 Bacteria 1018
331 Ga0436361_0500655 3300039447 Bacteria 1595
332 Ga0436361_1192758 3300039447 Bacteria 1309
333 Ga0436363_0122028 3300039450 Bacteria 1223
334 Ga0436363_0779060 3300039450 Bacteria 1804
335 Ga0436363_1435802 3300039450 Bacteria 3095
336 Ga0436363_1499860 3300039450 Bacteria 1177
337 Ga0439453_0011377 3300041408 Bacteria 1483
338 Ga0439465_0123910 3300041413 Bacteria 908
339 Ga0439465_0210228 3300041413 Bacteria 711
340 Ga0451797_0836775 3300041453 Bacteria 1065
341 Ga0439452_055480 3300042010 Bacteria 898
342 Ga0439435_0047181 3300042436 Bacteria 1222
343 Ga0466969_0073012 3300044656 Bacteria 1647
344 Ga0466965_0637856 3300044683 Bacteria 607
345 Ga0466961_0220119 3300044693 Bacteria 1170
346 Ga0466963_0835753 3300044694 Bacteria 649
347 Ga0466957_0111625 3300044842 Bacteria 1734
348 Ga0466959_0111959 3300045049 Bacteria 1947
349 Ga0451576_0007905 3300045051 Bacteria 12600
350 Ga0466958_0268200 3300045836 Bacteria 1093
351 Ga0495592_0000074 3300046454 Bacteria 89381
352 Ga0495592_0002150 3300046454 Bacteria 13878
353 Ga0495629_0038627 3300046459 Bacteria 3361
354 Ga0495651_0000304 3300046462 Bacteria 38409
355 Ga0495651_0002729 3300046462 Bacteria 13687
356 Ga0495653_0000738 3300046463 Bacteria 24961
357 Ga0495653_0136485 3300046463 Bacteria 1730
358 Ga0495605_0428156 3300046474 Bacteria 547
359 Ga0495662_0004174 3300046476 Bacteria 7279
360 Ga0495664_0000008 3300046477 Bacteria 307158
361 Ga0495664_0007653 3300046477 Bacteria 6007
362 Ga0495608_0000014 3300046511 Bacteria 221042
363 Ga0495608_0000943 3300046511 Bacteria 20472
364 Ga0495618_0000013 3300046514 Bacteria 168671
365 Ga0495618_0001029 3300046514 Bacteria 19114
366 Ga0495628_0000008 3300046516 Bacteria 284313
367 Ga0495628_0003985 3300046516 Bacteria 13155
368 Ga0495630_0001180 3300046517 Bacteria 18008
369 Ga0495630_0020549 3300046517 Bacteria 4868
370 Ga0495652_0000005 3300046529 Bacteria 524368
371 Ga0495652_0011331 3300046529 Bacteria 8065
372 Ga0495640_0000020 3300046533 Bacteria 116618
373 Ga0495640_0012379 3300046533 Bacteria 6520
374 Ga0495586_0003355 3300046535 Bacteria 8583
375 Ga0495587_0000005 3300046536 Bacteria 358412
376 Ga0495587_0001771 3300046536 Bacteria 14440
377 Ga0495645_0000007 3300046543 Bacteria 376299
378 Ga0495645_0073187 3300046543 Bacteria 2468
379 Ga0495667_0000012 3300046559 Bacteria 220967
380 Ga0495667_0005482 3300046559 Bacteria 8572
381 Ga0495634_0000052 3300046642 Bacteria 91494
382 Ga0495634_0128754 3300046642 Bacteria 1615
383 Ga0495635_0000010 3300046663 Bacteria 246385
384 Ga0495635_0030151 3300046663 Bacteria 3770
385 Ga0495657_0000052 3300046675 Bacteria 101480
386 Ga0495599_0000031 3300046678 Bacteria 109567
387 Ga0495599_0015430 3300046678 Bacteria 4740
388 Ga0495623_0000031 3300046679 Bacteria 84524
389 Ga0495623_0000055 3300046679 Bacteria 69548
390 Ga0495646_0000012 3300046680 Bacteria 185805
391 Ga0495646_0001170 3300046680 Bacteria 15326
392 Ga0495647_0119256 3300046681 Bacteria 1108
393 Ga0495613_0020669 3300046689 Bacteria 4908
394 Ga0495613_0027248 3300046689 Bacteria 4252
395 Ga0495624_0029301 3300046690 Bacteria 3592
396 Ga0495600_0000016 3300046809 Bacteria 111762
397 Ga0495600_0003351 3300046809 Bacteria 9420
398 Ga0495581_0060989 3300047315 Bacteria 2179
399 Ga0495604_0000001 3300047317 Bacteria 708627
400 Ga0495604_0001634 3300047317 Bacteria 18463
401 Ga0495674_0000012 3300047319 Bacteria 270651
402 Ga0495674_0006479 3300047319 Bacteria 11224
403 Ga0495680_0000150 3300047322 Bacteria 70458
404 Ga0495680_0001836 3300047322 Bacteria 22387
405 Ga0495675_0000108 3300047444 Bacteria 59810
406 Ga0495675_0002106 3300047444 Bacteria 11865
407 Ga0495684_0000021 3300047471 Bacteria 144901
408 Ga0495684_0015714 3300047471 Bacteria 5825
409 Ga0495686_0385619 3300047472 Bacteria 755
410 Ga0495593_0002268 3300047673 Bacteria 11530
411 Ga0495593_0054865 3300047673 Bacteria 2099
412 Ga0495602_0000031 3300048088 Bacteria 141518
413 Ga0495602_0006837 3300048088 Bacteria 11980
414 Ga0496100_0196526 3300048903 Bacteria 1467
415 Ga0496101_0007392 3300048904 Bacteria 7116
416 Ga0496102_0464099 3300048905 Bacteria 1187
417 Ga0496105_0025099 3300048908 Bacteria 4847
418 Ga0496106_0288522 3300048909 Bacteria 1315
419 Ga0496107_0035951 3300048910 Bacteria 3552
420 Ga0496108_0043176 3300048911 Bacteria 3766
421 Ga0496109_0028458 3300048912 Bacteria 4998
422 Ga0496110_0352088 3300048913 Bacteria 1341
423 Ga0496114_0016267 3300048917 Bacteria 5991
424 Ga0496115_0018462 3300048918 Bacteria 5354
425 Ga0496120_0400429 3300048923 Bacteria 606
426 Ga0496121_0289732 3300048924 Bacteria 1116
427 Ga0496124_0466321 3300048927 Bacteria 857
428 Ga0496125_0278121 3300048928 Bacteria 1039
429 Ga0496126_0077521 3300048929 Bacteria 2946
430 Ga0496126_0282094 3300048929 Bacteria 1376
431 Ga0496126_0419342 3300048929 Bacteria 1082
432 Ga0501031_0006162 3300049568 Bacteria 7830
433 Ga0501031_0129105 3300049568 Bacteria 1651
434 Ga0501032_0075461 3300049569 Bacteria 2245
435 Ga0501032_0123097 3300049569 Bacteria 1714
436 Ga0501033_0091951 3300049570 Bacteria 2219
437 Ga0501034_0000166 3300049571 Bacteria 122782
438 Ga0501034_0036544 3300049571 Bacteria 4975
439 Ga0501034_0041418 3300049571 Bacteria 4660
440 Ga0501034_0087279 3300049571 Bacteria 3119
441 Ga0501034_0098246 3300049571 Bacteria 2923
442 Ga0501034_0156779 3300049571 Bacteria 2250
443 Ga0501034_0159232 3300049571 Bacteria 2230
444 Ga0501034_0186294 3300049571 Bacteria 2039
445 Ga0501034_0244305 3300049571 Bacteria 1740
446 Ga0501034_0391075 3300049571 Bacteria 1314
447 Ga0501034_0469564 3300049571 Bacteria 1174
448 Ga0501034_0655114 3300049571 Bacteria 951
449 Ga0501034_0982294 3300049571 Bacteria 729
450 Ga0501034_1307360 3300049571 Bacteria 602
451 Ga0501036_0082223 3300049572 Bacteria 2722
452 Ga0501036_0244952 3300049572 Bacteria 1503
453 Ga0501036_0642727 3300049572 Bacteria 878
454 Ga0501036_0917774 3300049572 Bacteria 718
455 Ga0501037_0003204 3300049573 Bacteria 11860
456 Ga0501037_0011787 3300049573 Bacteria 6438
457 Ga0501037_0186976 3300049573 Bacteria 1468
458 Ga0501037_0202313 3300049573 Bacteria 1403
459 Ga0501037_0247612 3300049573 Bacteria 1248
460 Ga0501038_0019570 3300049574 Bacteria 6100
461 Ga0501038_0038986 3300049574 Bacteria 4158
462 Ga0501038_0627069 3300049574 Bacteria 811
463 Ga0501038_0880060 3300049574 Bacteria 662
464 Ga0501039_0000452 3300049575 Bacteria 29793
465 Ga0501039_0090218 3300049575 Bacteria 2388
466 Ga0501039_0513990 3300049575 Bacteria 940
467 Ga0501039_0745331 3300049575 Bacteria 765
468 Ga0501040_0026878 3300049576 Bacteria 3872
469 Ga0501041_0088198 3300049577 Bacteria 1915
470 Ga0501042_0170498 3300049578 Bacteria 1570
471 Ga0501043_0440030 3300049579 Bacteria 981
472 Ga0501046_0000224 3300049580 Bacteria 58986
473 Ga0501046_0008529 3300049580 Bacteria 8925
474 Ga0501046_0012397 3300049580 Bacteria 7258
475 Ga0501046_0058059 3300049580 Bacteria 3034
476 Ga0501046_0223029 3300049580 Bacteria 1395
477 Ga0501046_0354426 3300049580 Bacteria 1065
478 Ga0501047_0000283 3300049581 Bacteria 58613
479 Ga0501047_0044435 3300049581 Bacteria 4292
480 Ga0501047_0354254 3300049581 Bacteria 1304
481 Ga0501047_0978059 3300049581 Bacteria 659
482 Ga0501048_0845951 3300049582 Bacteria 658
483 Ga0501067_0002361 3300049583 Bacteria 10450
484 Ga0501068_0087963 3300049584 Bacteria 1914
485 Ga0501069_0397843 3300049585 Bacteria 815
486 Ga0501070_0016940 3300049586 Bacteria 6115
487 Ga0501070_0197439 3300049586 Bacteria 1652
488 Ga0501070_0463743 3300049586 Bacteria 1020
489 Ga0501073_0030558 3300049589 Bacteria 3845
490 Ga0501073_0202136 3300049589 Bacteria 1374
491 Ga0501076_0153776 3300049592 Bacteria 1872
492 Ga0501076_0219673 3300049592 Bacteria 1553
493 Ga0501077_0689095 3300049593 Bacteria 657
494 Ga0501079_0041609 3300049741 Bacteria 3548
495 Ga0501080_0000315 3300049742 Bacteria 37063
496 Ga0501080_0384644 3300049742 Bacteria 1264
497 Ga0501080_0479936 3300049742 Bacteria 1112
498 Ga0501080_0624692 3300049742 Bacteria 955
499 Ga0501081_0560056 3300049743 Bacteria 854
500 Ga0501083_0193114 3300049744 Bacteria 1329
501 Ga0501083_0206892 3300049744 Bacteria 1280
502 Ga0501280_000972 3300049776 Bacteria 5988
503 Ga0501035_0000084 3300049822 Bacteria 116222
504 Ga0501035_0010130 3300049822 Bacteria 8749
505 Ga0501035_0109246 3300049822 Bacteria 2424
506 Ga0501035_0178158 3300049822 Bacteria 1833
507 Ga0501035_0315020 3300049822 Bacteria 1316
508 Ga0501035_1443159 3300049822 Bacteria 526
509 Ga0501044_0000073 3300049823 Bacteria 122507
510 Ga0501044_0023883 3300049823 Bacteria 6498
511 Ga0501044_0041207 3300049823 Bacteria 4808
512 Ga0501044_0069139 3300049823 Bacteria 3595
513 Ga0501044_0121685 3300049823 Bacteria 2610
514 Ga0501044_0256254 3300049823 Bacteria 1689
515 Ga0501044_1259193 3300049823 Bacteria 607
516 Ga0501044_1451795 3300049823 Bacteria 551
517 Ga0501045_0144796 3300049824 Bacteria 1767
518 nmdc:mga03683_303664_c1 3300050489 Bacteria 749
519 nmdc:mga03683_74518_c2 3300050489 Bacteria 1133
520 nmdc:mga00v17_272356_c1 3300050491 Bacteria 1098
521 nmdc:mga00v17_89_c1 3300050491 Bacteria 55686
522 nmdc:mga06z11_565336_c1 3300050494 Bacteria 691
523 nmdc:mga06z11_68675_c1 3300050494 Bacteria 1868
524 nmdc:mga04h51_48320_c1 3300050495 Bacteria 1417
525 nmdc:mga05p37_916_c1 3300050507 Bacteria 33331
526 nmdc:mga09592_20568_c1 3300050508 Bacteria 5429
527 nmdc:mga0qj67_2642_c2 3300050509 Bacteria 11550
528 nmdc:mga06r32_1826_c1 3300050510 Bacteria 19014
529 nmdc:mga08y16_325_c1 3300050511 Bacteria 43258
530 Ga0495601_0000011 3300053077 Bacteria 264937
531 Ga0495601_0004198 3300053077 Bacteria 8307
532 Ga0495612_0000006 3300053078 Bacteria 269278
533 Ga0495612_0003202 3300053078 Bacteria 6784
534 Ga0495595_0000235 3300053084 Bacteria 21997
535 Ga0495595_0000782 3300053084 Bacteria 12064
536 Ga0495619_0000013 3300053085 Bacteria 264865
537 Ga0495619_0036570 3300053085 Bacteria 3197
538 Ga0500604_0000120 3300053151 Bacteria 23719
539 Ga0500616_0000001 3300053153 Bacteria 1986011
540 Ga0500616_0038755 3300053153 Bacteria 2572
541 Ga0500638_177050 3300053162 Bacteria 924
542 Ga0500637_0199348 3300053178 Bacteria 1140
543 Ga0500645_010737 3300053730 Bacteria 3013
544 Ga0501084_0663509 3300054114 Bacteria 880
545 Ga0501082_0001711 3300060353 Bacteria 19341
546 Ga0501082_0163984 3300060353 Bacteria 1931
547 Ga0501082_0210983 3300060353 Bacteria 1689
548 Ga0501082_0570253 3300060353 Bacteria 990
549 2861692264 2861691609 Bacteria 5628931
550 2643814862 2643221558 Bacteria 5460675
551 2644165158 2643221629 Bacteria 5850260
552 2644351040 2643221662 Bacteria 5851492
553 2644412417 2643221674 Bacteria 3919126
554 2720615312 2718218232 Bacteria 6720332
555 2738746346 2738541281 Bacteria 5112672
556 2739355576 2738543032 Bacteria 5115625
557 2757571057 2757320392 Bacteria 3737298
558 2829747586 2829745981 Bacteria 5406054
559 2842700918 2842698319 Bacteria 5190321
560 2889791498 2889790730 Bacteria 5689708
561 2889916443 2889914905 Bacteria 5702301
562 2894821109 2894817345 Bacteria 4892941
563 2902406181 2902405164 Bacteria 6784948
564 2917554925 2917554339 Bacteria 4987857
565 2921290303 2921289301 Bacteria 7316391
566 2924220546 2924214083 Bacteria 7080103
567 2928126820 2928125067 Bacteria 5937560
568 2939674248 2939669807 Bacteria 5028511
569 JGI24737J22298_10049266
570 JGI25165J46597_1002342
571 rootH1_10110309
572 rootH2_10023430
573 rootH2_10163117
574 rootH1_10133252
575 Ga0070683_100076546
576 Ga0070683_100151361
577 Ga0068869_100637772
578 Ga0070682_100740058
579 Ga0068868_100061013
580 Ga0070660_100005035
581 Ga0070660_100043481
582 Ga0070660_100044272
583 Ga0070660_100109586
584 Ga0070691_10434919
585 Ga0070661_100002138
586 Ga0070661_100030582
587 Ga0070661_100038380
588 Ga0070661_100050194
589 Ga0070661_100092182
590 Ga0070668_100002867
591 Ga0070669_100653300
592 Ga0070675_100239206
593 Ga0070675_100389819
594 Ga0070674_100019581
595 Ga0070673_100002917
596 Ga0070688_100773022
597 Ga0070659_100151544
598 Ga0070667_100221079
599 Ga0070710_10245030
600 Ga0070711_100960762
601 Ga0070663_100051249
602 Ga0070663_100103447
603 Ga0070663_100127923
604 Ga0070663_100499517
605 Ga0070662_100240217
606 Ga0070662_100284056
607 Ga0068867_100269350
608 Ga0070679_100274832
609 Ga0070679_100308787
610 Ga0070684_100620218
611 Ga0070697_100459924
612 Ga0068853_100001173
613 Ga0068853_100002927
614 Ga0068853_100003202
615 Ga0068853_100309880
616 Ga0068853_100593561
617 Ga0068853_100880238
618 Ga0070695_100517471
619 Ga0070693_100015338
620 Ga0070665_100107953
621 Ga0070665_100200420
622 Ga0068855_100013555
623 Ga0068855_100052706
624 Ga0068855_100093399
625 Ga0068855_100191116
626 Ga0068855_100956500
627 Ga0068855_100960502
628 Ga0070664_100082793
629 Ga0070664_100179544
630 Ga0068854_100001830
631 Ga0068854_100013461
632 Ga0068856_100035546
633 Ga0068856_100039147
634 Ga0068856_100040458
635 Ga0068856_100067916
636 Ga0068856_101083724
637 Ga0070702_100756809
638 Ga0068852_100007433
639 Ga0068852_100051436
640 Ga0068852_100052848
641 Ga0068852_100143748
642 Ga0068852_100282145
643 Ga0068859_102538217
644 Ga0068851_10010084
645 Ga0068858_100179653
646 Ga0068860_100428821
647 Ga0081455_10000002
648 Ga0075365_10516978
649 Ga0075368_10104514
650 Ga0075363_100114901
651 Ga0075364_10036653
652 Ga0075364_10156799
653 Ga0070715_11036566
654 Ga0075362_10051336
655 Ga0075362_10061657
656 Ga0075367_10024872
657 Ga0075367_10314133
658 Ga0075366_10079947
659 Ga0097621_100996517
660 Ga0075370_10054904
661 Ga0075370_10086494
662 Ga0075370_10172935
663 Ga0068871_100076656
664 Ga0075428_100004902
665 Ga0075430_100108066
666 Ga0075431_100000787
667 Ga0075429_100009279
668 Ga0068865_100223600
669 Ga0075436_100412997
670 Ga0097620_102537981
671 Ga0079104_1004038
672 Ga0105240_10041453
673 Ga0105240_10084473
674 Ga0105240_10415435
675 Ga0105240_10462061
676 Ga0111539_10001373
677 Ga0105245_10012111
678 Ga0105245_10069242
679 Ga0105245_10163071
680 Ga0105247_10022161
681 Ga0105247_10136235
682 Ga0114129_10007982
683 Ga0105243_10525474
684 Ga0105243_10953344
685 Ga0105243_11131060
686 Ga0105241_10032260
687 Ga0105241_11085542
688 Ga0105242_10144763
689 Ga0105242_10317605
690 Ga0105248_10130680
691 Ga0105237_10095519
692 Ga0105237_10416910
693 Ga0105238_10006072
694 Ga0105238_10069258
695 Ga0105238_10100768
696 Ga0105238_10579542
697 Ga0105238_10586800
698 Ga0105249_10548449
699 Ga0105239_10078644
700 Ga0105239_10199901
701 Ga0105239_10292716
702 Ga0105246_10060955
703 Ga0157373_10460850
704 Ga0157370_10008447
705 Ga0157370_10061666
706 Ga0157370_10339591
707 Ga0157374_10150844
708 Ga0157378_10113174
709 Ga0157378_10217516
710 Ga0157378_10248078
711 Ga0163162_10045526
712 Ga0157372_10055104
713 Ga0157372_10188639
714 Ga0157375_10150497
715 Ga0163163_10272816
716 Ga0157376_10640169
717 Ga0157376_11126074
718 Ga0163161_10727928
719 Ga0207427_105765
720 Ga0209233_1000289
721 Ga0207656_10001196
722 Ga0207692_10541174
723 Ga0207647_10057394
724 Ga0207645_10137989
725 Ga0207705_10001959
726 Ga0207705_10020597
727 Ga0207705_10317311
728 Ga0207705_10766058
729 Ga0207654_10097303
730 Ga0207695_10120654
731 Ga0207695_10398341
732 Ga0207671_10298058
733 Ga0207657_10001847
734 Ga0207657_10004351
735 Ga0207657_10051959
736 Ga0207657_10066239
737 Ga0207649_10003973
738 Ga0207649_10015589
739 Ga0207649_10032185
740 Ga0207649_10363206
741 Ga0207652_10224948
742 Ga0207694_10055484
743 Ga0207694_10336337
744 Ga0207694_10712198
745 Ga0207700_10157610
746 Ga0207690_10101711
747 Ga0207690_10214777
748 Ga0207690_10292747
749 Ga0207690_10978096
750 Ga0207706_10298011
751 Ga0207669_10139710
752 Ga0207704_10219561
753 Ga0207665_10055079
754 Ga0207691_10727445
755 Ga0207689_10630210
756 Ga0207661_10349000
757 Ga0207679_10011252
758 Ga0207679_10484811
759 Ga0207667_10004448
760 Ga0207667_10010728
761 Ga0207667_10025234
762 Ga0207667_10054071
763 Ga0207667_10086052
764 Ga0207667_10092336
765 Ga0207667_10688405
766 Ga0207667_10707330
767 Ga0207651_10021509
768 Ga0207651_10581709
769 Ga0207668_10003263
770 Ga0207640_10002261
771 Ga0207658_10484292
772 Ga0207677_10025220
773 Ga0207677_10450054
774 Ga0207703_10226009
775 Ga0207703_10801966
776 Ga0207639_10001130
777 Ga0207639_10002574
778 Ga0207639_10032763
779 Ga0207639_10511019
780 Ga0207678_10057441
781 Ga0207678_10256170
782 Ga0207708_10552096
783 Ga0207702_10019506
784 Ga0207702_10025300
785 Ga0207702_10100785
786 Ga0207702_10249418
787 Ga0207641_11477606
788 Ga0207648_10123021
789 Ga0207648_10372850
790 Ga0207674_10003697
791 Ga0207674_10044178
792 Ga0207675_100420490
793 Ga0207698_10003276
794 Ga0207698_10009033
795 Ga0207698_10368344
796 Ga0207698_10562800
797 Ga0207428_10004254
798 Ga0268264_10516332
799 Ga0265319_1113913
800 Ga0265318_10017771
801 Ga0265318_10044752
802 Ga0265324_10089185
803 Ga0265330_10016486
804 Ga0265330_10176548
805 Ga0265330_10206188
806 Ga0265330_10245333
807 Ga0265320_10006100
808 Ga0265320_10111924
809 Ga0265325_10002112
810 Ga0265325_10012366
811 Ga0265325_10040986
812 Ga0265329_10038151
813 Ga0265329_10057732
814 Ga0265340_10030452
815 Ga0265340_10087211
816 Ga0265339_10013004
817 Ga0265339_10110424
818 Ga0265331_10003140
819 Ga0265331_10030823
820 Ga0265331_10051270
821 Ga0265327_10027089
822 Ga0265316_10044636
823 Ga0265316_10061937
824 Ga0265316_10071048
825 Ga0265316_10127976
826 Ga0265316_10308160
827 Ga0265316_10653399
828 Ga0265313_10000045
829 Ga0265313_10010603
830 Ga0265313_10081830
831 Ga0265313_10122087
832 Ga0265314_10004593
833 Ga0265314_10025163
834 Ga0265314_10040088
835 Ga0265314_10176725
836 Ga0265314_10222158
837 Ga0265342_10008205
838 Ga0265342_10052475
839 Ga0265342_10193750
840 Ga0307516_10051115
841 Ga0307413_10031791
842 Ga0307413_11426614
843 Ga0307406_10352149
844 Ga0307416_100337168
845 Ga0307416_100542504
846 Ga0307416_100859959
847 Ga0307414_10117444
848 Ga0307414_11282262
849 Ga0307414_11516008
850 Ga0307411_10234830
851 Ga0373934_0006551
852 Ga0373934_0070565
853 Ga0373923_0020236
854 Ga0373936_0000301
855 Ga0373941_0215802
856 Ga0373945_0002637
857 Ga0373953_0000709
858 Ga0373953_0025327
859 Ga0373954_0014897
860 Ga0373954_0017055
861 Ga0373956_0226136
862 Ga0373957_0000730
863 Ga0373943_0004281
864 Ga0373946_0003598
865 Ga0373955_0000164
866 Ga0373955_0024013
867 Ga0373955_0632992
868 Ga0373924_0012208
869 Ga0373924_0016173
870 Ga0373935_0000011
871 Ga0373935_0063163
872 Ga0373927_0025272
873 Ga0373927_0168835
874 Ga0373927_0187439
875 Ga0373933_0000357
876 Ga0373933_0005248
877 Ga0373947_0000139
878 Ga0373937_0000041
879 Ga0373937_0001701
880 Ga0373937_0473088
881 Ga0373925_0000048
882 Ga0373925_0519608
883 Ga0395899_0105789
884 Ga0395900_0020719
885 Ga0395900_0214754
886 Ga0395898_0152891
887 Ga0395898_0575036
888 Ga0395898_1184543
889 Ga0436364_0458239
890 Ga0436364_0515436
891 Ga0436364_0624265
892 Ga0436364_0855514
893 Ga0436364_1069039
894 Ga0395901_0137719
895 Ga0395901_0289566
896 Ga0395901_0613888
897 Ga0436360_1039408
898 Ga0436360_1094690
899 Ga0436361_0500655
900 Ga0436361_1192758
901 Ga0436363_0122028
902 Ga0436363_0779060
903 Ga0436363_1435802
904 Ga0436363_1499860
905 Ga0439453_0011377
906 Ga0439465_0123910
907 Ga0439465_0210228
908 Ga0451797_0836775
909 Ga0439452_055480
910 Ga0439435_0047181
911 Ga0466969_0073012
912 Ga0466965_0637856
913 Ga0466961_0220119
914 Ga0466963_0835753
915 Ga0466957_0111625
916 Ga0466959_0111959
917 Ga0451576_0007905
918 Ga0466958_0268200
919 Ga0495592_0000074
920 Ga0495592_0002150
921 Ga0495629_0038627
922 Ga0495651_0000304
923 Ga0495651_0002729
924 Ga0495653_0000738
925 Ga0495653_0136485
926 Ga0495605_0428156
927 Ga0495662_0004174
928 Ga0495664_0000008
929 Ga0495664_0007653
930 Ga0495608_0000014
931 Ga0495608_0000943
932 Ga0495618_0000013
933 Ga0495618_0001029
934 Ga0495628_0000008
935 Ga0495628_0003985
936 Ga0495630_0001180
937 Ga0495630_0020549
938 Ga0495652_0000005
939 Ga0495652_0011331
940 Ga0495640_0000020
941 Ga0495640_0012379
942 Ga0495586_0003355
943 Ga0495587_0000005
944 Ga0495587_0001771
945 Ga0495645_0000007
946 Ga0495645_0073187
947 Ga0495667_0000012
948 Ga0495667_0005482
949 Ga0495634_0000052
950 Ga0495634_0128754
951 Ga0495635_0000010
952 Ga0495635_0030151
953 Ga0495657_0000052
954 Ga0495599_0000031
955 Ga0495599_0015430
956 Ga0495623_0000031
957 Ga0495623_0000055
958 Ga0495646_0000012
959 Ga0495646_0001170
960 Ga0495647_0119256
961 Ga0495613_0020669
962 Ga0495613_0027248
963 Ga0495624_0029301
964 Ga0495600_0000016
965 Ga0495600_0003351
966 Ga0495581_0060989
967 Ga0495604_0000001
968 Ga0495604_0001634
969 Ga0495674_0000012
970 Ga0495674_0006479
971 Ga0495680_0000150
972 Ga0495680_0001836
973 Ga0495675_0000108
974 Ga0495675_0002106
975 Ga0495684_0000021
976 Ga0495684_0015714
977 Ga0495686_0385619
978 Ga0495593_0002268
979 Ga0495593_0054865
980 Ga0495602_0000031
981 Ga0495602_0006837
982 Ga0496100_0196526
983 Ga0496101_0007392
984 Ga0496102_0464099
985 Ga0496105_0025099
986 Ga0496106_0288522
987 Ga0496107_0035951
988 Ga0496108_0043176
989 Ga0496109_0028458
990 Ga0496110_0352088
991 Ga0496114_0016267
992 Ga0496115_0018462
993 Ga0496120_0400429
994 Ga0496121_0289732
995 Ga0496124_0466321
996 Ga0496125_0278121
997 Ga0496126_0077521
998 Ga0496126_0282094
999 Ga0496126_0419342
1000 Ga0501031_0006162
1001 Ga0501031_0129105
1002 Ga0501032_0075461
1003 Ga0501032_0123097
1004 Ga0501033_0091951
1005 Ga0501034_0000166
1006 Ga0501034_0036544
1007 Ga0501034_0041418
1008 Ga0501034_0087279
1009 Ga0501034_0098246
1010 Ga0501034_0156779
1011 Ga0501034_0159232
1012 Ga0501034_0186294
1013 Ga0501034_0244305
1014 Ga0501034_0391075
1015 Ga0501034_0469564
1016 Ga0501034_0655114
1017 Ga0501034_0982294
1018 Ga0501034_1307360
1019 Ga0501036_0082223
1020 Ga0501036_0244952
1021 Ga0501036_0642727
1022 Ga0501036_0917774
1023 Ga0501037_0003204
1024 Ga0501037_0011787
1025 Ga0501037_0186976
1026 Ga0501037_0202313
1027 Ga0501037_0247612
1028 Ga0501038_0019570
1029 Ga0501038_0038986
1030 Ga0501038_0627069
1031 Ga0501038_0880060
1032 Ga0501039_0000452
1033 Ga0501039_0090218
1034 Ga0501039_0513990
1035 Ga0501039_0745331
1036 Ga0501040_0026878
1037 Ga0501041_0088198
1038 Ga0501042_0170498
1039 Ga0501043_0440030
1040 Ga0501046_0000224
1041 Ga0501046_0008529
1042 Ga0501046_0012397
1043 Ga0501046_0058059
1044 Ga0501046_0223029
1045 Ga0501046_0354426
1046 Ga0501047_0000283
1047 Ga0501047_0044435
1048 Ga0501047_0354254
1049 Ga0501047_0978059
1050 Ga0501048_0845951
1051 Ga0501067_0002361
1052 Ga0501068_0087963
1053 Ga0501069_0397843
1054 Ga0501070_0016940
1055 Ga0501070_0197439
1056 Ga0501070_0463743
1057 Ga0501073_0030558
1058 Ga0501073_0202136
1059 Ga0501076_0153776
1060 Ga0501076_0219673
1061 Ga0501077_0689095
1062 Ga0501079_0041609
1063 Ga0501080_0000315
1064 Ga0501080_0384644
1065 Ga0501080_0479936
1066 Ga0501080_0624692
1067 Ga0501081_0560056
1068 Ga0501083_0193114
1069 Ga0501083_0206892
1070 Ga0501280_000972
1071 Ga0501035_0000084
1072 Ga0501035_0010130
1073 Ga0501035_0109246
1074 Ga0501035_0178158
1075 Ga0501035_0315020
1076 Ga0501035_1443159
1077 Ga0501044_0000073
1078 Ga0501044_0023883
1079 Ga0501044_0041207
1080 Ga0501044_0069139
1081 Ga0501044_0121685
1082 Ga0501044_0256254
1083 Ga0501044_1259193
1084 Ga0501044_1451795
1085 Ga0501045_0144796
1086 nmdc:mga03683_303664_c1
1087 nmdc:mga03683_74518_c2
1088 nmdc:mga00v17_272356_c1
1089 nmdc:mga00v17_89_c1
1090 nmdc:mga06z11_565336_c1
1091 nmdc:mga06z11_68675_c1
1092 nmdc:mga04h51_48320_c1
1093 nmdc:mga05p37_916_c1
1094 nmdc:mga09592_20568_c1
1095 nmdc:mga0qj67_2642_c2
1096 nmdc:mga06r32_1826_c1
1097 nmdc:mga08y16_325_c1
1098 Ga0495601_0000011
1099 Ga0495601_0004198
1100 Ga0495612_0000006
1101 Ga0495612_0003202
1102 Ga0495595_0000235
1103 Ga0495595_0000782
1104 Ga0495619_0000013
1105 Ga0495619_0036570
1106 Ga0500604_0000120
1107 Ga0500616_0000001
1108 Ga0500616_0038755
1109 Ga0500638_177050
1110 Ga0500637_0199348
1111 Ga0500645_010737
1112 Ga0501084_0663509
1113 Ga0501082_0001711
1114 Ga0501082_0163984
1115 Ga0501082_0210983
1116 Ga0501082_0570253
1117 2861692264
1118 2643814862
1119 2644165158
1120 2644351040
1121 2644412417
1122 2720615312
1123 2738746346
1124 2739355576
1125 2757571057
1126 2829747586
1127 2842700918
1128 2889791498
1129 2889916443
1130 2894821109
1131 2902406181
1132 2917554925
1133 2921290303
1134 2924220546
1135 2928126820
1136 2939674248

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

14

168

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9255 11 175
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.9243 11 175
6vcn-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpg 0.9065 11 174
6vcp-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with utp 0.9057 11 174
6vco-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpa 0.9002 11 175
ID Description Score Start End Superfamily
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9243 11 175 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8892 27 168 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8869 1 168 3.90.79.10
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8786 11 175 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8655 1 168 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A529K4I9-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) 0.9754 49 170 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A6M1SQ27-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9737 4 174 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A530QHP3-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) 0.9712 66 170 GO:0016787
AF-A0A2D7ACW3-F1-model_v4 RNA pyrophosphohydrolase 0.9675 4 177 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A257ZH96-F1-model_v4 RNA pyrophosphohydrolase 0.9642 47 169 GO:0006753
GO:0008893
GO:0019693
GO:0034432

Map