F464683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 568 | 311 | 1136 | 170 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2861691609|2861692264 |
| Length | 198 |
| Sequence | EDDLLRLPEGSALPYRPCVGVALFNRDGQVFIGRRKREAGPEHVEGDRAWQMPQGGIDEGEEPLAAALRELHEETNVPAEAVTWLGETRDWLAYDLPPAVMKQAWKGRYRGQRQKWFAFGLTGSETVIDVDAPGGGRHKPEFEAWRWERLDALPDLIIPFKRPVYEGVVAAFSGLTGWHGAEGDPAEGPAAGRADGPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 135 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 137 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 178 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 179 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 180 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 181 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 182 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 183 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 240 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 241 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 242 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 287 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 288 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 289 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 293 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 294 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 295 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 296 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 297 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 298 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 299 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 300 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 301 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 302 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 303 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 304 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 305 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 306 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 307 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 308 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 309 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 310 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 311 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.48 |
| Metatranscriptomes | 0 |
| Isolates | 3.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.11 |
| Nodule | 0.88 |
| Rhizoplane | 2.11 |
| Rhizosphere | 86.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10049266 | 3300001990 | Bacteria | 1281 |
| 2 | JGI25165J46597_1002342 | 3300003214 | Bacteria | 6376 |
| 3 | rootH1_10110309 | 3300003316 | Bacteria | 1346 |
| 4 | rootH2_10023430 | 3300003320 | Bacteria | 3790 |
| 5 | rootH2_10163117 | 3300003320 | Bacteria | 4255 |
| 6 | rootH1_10133252 | 3300003323 | Bacteria | 2018 |
| 7 | Ga0070683_100076546 | 3300005329 | Bacteria | 3128 |
| 8 | Ga0070683_100151361 | 3300005329 | Bacteria | 2200 |
| 9 | Ga0068869_100637772 | 3300005334 | Bacteria | 903 |
| 10 | Ga0070682_100740058 | 3300005337 | Bacteria | 793 |
| 11 | Ga0068868_100061013 | 3300005338 | Bacteria | 2987 |
| 12 | Ga0070660_100005035 | 3300005339 | Bacteria | 9136 |
| 13 | Ga0070660_100043481 | 3300005339 | Bacteria | 3433 |
| 14 | Ga0070660_100044272 | 3300005339 | Bacteria | 3404 |
| 15 | Ga0070660_100109586 | 3300005339 | Bacteria | 2195 |
| 16 | Ga0070691_10434919 | 3300005341 | Bacteria | 746 |
| 17 | Ga0070661_100002138 | 3300005344 | Bacteria | 13614 |
| 18 | Ga0070661_100030582 | 3300005344 | Bacteria | 3890 |
| 19 | Ga0070661_100038380 | 3300005344 | Bacteria | 3487 |
| 20 | Ga0070661_100050194 | 3300005344 | Bacteria | 3053 |
| 21 | Ga0070661_100092182 | 3300005344 | Bacteria | 2244 |
| 22 | Ga0070668_100002867 | 3300005347 | Bacteria | 12717 |
| 23 | Ga0070669_100653300 | 3300005353 | Bacteria | 885 |
| 24 | Ga0070675_100239206 | 3300005354 | Bacteria | 1586 |
| 25 | Ga0070675_100389819 | 3300005354 | Bacteria | 1241 |
| 26 | Ga0070674_100019581 | 3300005356 | Bacteria | 4302 |
| 27 | Ga0070673_100002917 | 3300005364 | Bacteria | 10535 |
| 28 | Ga0070688_100773022 | 3300005365 | Bacteria | 749 |
| 29 | Ga0070659_100151544 | 3300005366 | Bacteria | 1892 |
| 30 | Ga0070667_100221079 | 3300005367 | Bacteria | 1686 |
| 31 | Ga0070710_10245030 | 3300005437 | Bacteria | 1150 |
| 32 | Ga0070711_100960762 | 3300005439 | Bacteria | 732 |
| 33 | Ga0070663_100051249 | 3300005455 | Bacteria | 2939 |
| 34 | Ga0070663_100103447 | 3300005455 | Bacteria | 2128 |
| 35 | Ga0070663_100127923 | 3300005455 | Bacteria | 1926 |
| 36 | Ga0070663_100499517 | 3300005455 | Bacteria | 1010 |
| 37 | Ga0070662_100240217 | 3300005457 | Bacteria | 1452 |
| 38 | Ga0070662_100284056 | 3300005457 | Bacteria | 1340 |
| 39 | Ga0068867_100269350 | 3300005459 | Bacteria | 1392 |
| 40 | Ga0070679_100274832 | 3300005530 | Bacteria | 1638 |
| 41 | Ga0070679_100308787 | 3300005530 | Bacteria | 1532 |
| 42 | Ga0070684_100620218 | 3300005535 | Bacteria | 1006 |
| 43 | Ga0070697_100459924 | 3300005536 | Bacteria | 1109 |
| 44 | Ga0068853_100001173 | 3300005539 | Bacteria | 18642 |
| 45 | Ga0068853_100002927 | 3300005539 | Bacteria | 12988 |
| 46 | Ga0068853_100003202 | 3300005539 | Bacteria | 12508 |
| 47 | Ga0068853_100309880 | 3300005539 | Bacteria | 1461 |
| 48 | Ga0068853_100593561 | 3300005539 | Bacteria | 1051 |
| 49 | Ga0068853_100880238 | 3300005539 | Bacteria | 860 |
| 50 | Ga0070695_100517471 | 3300005545 | Bacteria | 925 |
| 51 | Ga0070693_100015338 | 3300005547 | Bacteria | 3943 |
| 52 | Ga0070665_100107953 | 3300005548 | Bacteria | 2786 |
| 53 | Ga0070665_100200420 | 3300005548 | Bacteria | 1996 |
| 54 | Ga0068855_100013555 | 3300005563 | Bacteria | 9833 |
| 55 | Ga0068855_100052706 | 3300005563 | Bacteria | 4789 |
| 56 | Ga0068855_100093399 | 3300005563 | Bacteria | 3469 |
| 57 | Ga0068855_100191116 | 3300005563 | Bacteria | 2309 |
| 58 | Ga0068855_100956500 | 3300005563 | Bacteria | 902 |
| 59 | Ga0068855_100960502 | 3300005563 | Bacteria | 900 |
| 60 | Ga0070664_100082793 | 3300005564 | Bacteria | 2767 |
| 61 | Ga0070664_100179544 | 3300005564 | Bacteria | 1881 |
| 62 | Ga0068854_100001830 | 3300005578 | Bacteria | 12954 |
| 63 | Ga0068854_100013461 | 3300005578 | Bacteria | 5371 |
| 64 | Ga0068856_100035546 | 3300005614 | Bacteria | 4883 |
| 65 | Ga0068856_100039147 | 3300005614 | Bacteria | 4654 |
| 66 | Ga0068856_100040458 | 3300005614 | Bacteria | 4579 |
| 67 | Ga0068856_100067916 | 3300005614 | Bacteria | 3523 |
| 68 | Ga0068856_101083724 | 3300005614 | Bacteria | 819 |
| 69 | Ga0070702_100756809 | 3300005615 | Bacteria | 747 |
| 70 | Ga0068852_100007433 | 3300005616 | Bacteria | 7997 |
| 71 | Ga0068852_100051436 | 3300005616 | Bacteria | 3535 |
| 72 | Ga0068852_100052848 | 3300005616 | Bacteria | 3494 |
| 73 | Ga0068852_100143748 | 3300005616 | Bacteria | 2210 |
| 74 | Ga0068852_100282145 | 3300005616 | Bacteria | 1602 |
| 75 | Ga0068859_102538217 | 3300005617 | Bacteria | 564 |
| 76 | Ga0068851_10010084 | 3300005834 | Bacteria | 4402 |
| 77 | Ga0068858_100179653 | 3300005842 | Bacteria | 1998 |
| 78 | Ga0068860_100428821 | 3300005843 | Bacteria | 1312 |
| 79 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 80 | Ga0075365_10516978 | 3300006038 | Bacteria | 844 |
| 81 | Ga0075368_10104514 | 3300006042 | Bacteria | 1165 |
| 82 | Ga0075363_100114901 | 3300006048 | Bacteria | 1499 |
| 83 | Ga0075364_10036653 | 3300006051 | Bacteria | 3171 |
| 84 | Ga0075364_10156799 | 3300006051 | Bacteria | 1535 |
| 85 | Ga0070715_11036566 | 3300006163 | Bacteria | 513 |
| 86 | Ga0075362_10051336 | 3300006177 | Bacteria | 1845 |
| 87 | Ga0075362_10061657 | 3300006177 | Bacteria | 1697 |
| 88 | Ga0075367_10024872 | 3300006178 | Bacteria | 3379 |
| 89 | Ga0075367_10314133 | 3300006178 | Bacteria | 987 |
| 90 | Ga0075366_10079947 | 3300006195 | Bacteria | 1952 |
| 91 | Ga0097621_100996517 | 3300006237 | Bacteria | 784 |
| 92 | Ga0075370_10054904 | 3300006353 | Bacteria | 2263 |
| 93 | Ga0075370_10086494 | 3300006353 | Bacteria | 1805 |
| 94 | Ga0075370_10172935 | 3300006353 | Bacteria | 1270 |
| 95 | Ga0068871_100076656 | 3300006358 | Bacteria | 2762 |
| 96 | Ga0075428_100004902 | 3300006844 | Bacteria | 14861 |
| 97 | Ga0075430_100108066 | 3300006846 | Bacteria | 2321 |
| 98 | Ga0075431_100000787 | 3300006847 | Bacteria | 27635 |
| 99 | Ga0075429_100009279 | 3300006880 | Bacteria | 8541 |
| 100 | Ga0068865_100223600 | 3300006881 | Bacteria | 1473 |
| 101 | Ga0075436_100412997 | 3300006914 | Bacteria | 979 |
| 102 | Ga0097620_102537981 | 3300006931 | Bacteria | 564 |
| 103 | Ga0079104_1004038 | 3300006946 | Bacteria | 6485 |
| 104 | Ga0105240_10041453 | 3300009093 | Bacteria | 5877 |
| 105 | Ga0105240_10084473 | 3300009093 | Bacteria | 3892 |
| 106 | Ga0105240_10415435 | 3300009093 | Bacteria | 1513 |
| 107 | Ga0105240_10462061 | 3300009093 | Bacteria | 1418 |
| 108 | Ga0111539_10001373 | 3300009094 | Bacteria | 32376 |
| 109 | Ga0105245_10012111 | 3300009098 | Bacteria | 7501 |
| 110 | Ga0105245_10069242 | 3300009098 | Bacteria | 3199 |
| 111 | Ga0105245_10163071 | 3300009098 | Bacteria | 2116 |
| 112 | Ga0105247_10022161 | 3300009101 | Bacteria | 3824 |
| 113 | Ga0105247_10136235 | 3300009101 | Bacteria | 1605 |
| 114 | Ga0114129_10007982 | 3300009147 | Bacteria | 15071 |
| 115 | Ga0105243_10525474 | 3300009148 | Bacteria | 1126 |
| 116 | Ga0105243_10953344 | 3300009148 | Bacteria | 857 |
| 117 | Ga0105243_11131060 | 3300009148 | Bacteria | 793 |
| 118 | Ga0105241_10032260 | 3300009174 | Bacteria | 3926 |
| 119 | Ga0105241_11085542 | 3300009174 | Bacteria | 753 |
| 120 | Ga0105242_10144763 | 3300009176 | Bacteria | 2066 |
| 121 | Ga0105242_10317605 | 3300009176 | Bacteria | 1428 |
| 122 | Ga0105248_10130680 | 3300009177 | Bacteria | 2833 |
| 123 | Ga0105237_10095519 | 3300009545 | Bacteria | 2962 |
| 124 | Ga0105237_10416910 | 3300009545 | Bacteria | 1348 |
| 125 | Ga0105238_10006072 | 3300009551 | Bacteria | 11980 |
| 126 | Ga0105238_10069258 | 3300009551 | Bacteria | 3529 |
| 127 | Ga0105238_10100768 | 3300009551 | Bacteria | 2871 |
| 128 | Ga0105238_10579542 | 3300009551 | Bacteria | 1128 |
| 129 | Ga0105238_10586800 | 3300009551 | Bacteria | 1121 |
| 130 | Ga0105249_10548449 | 3300009553 | Bacteria | 1206 |
| 131 | Ga0105239_10078644 | 3300010375 | Bacteria | 3630 |
| 132 | Ga0105239_10199901 | 3300010375 | Bacteria | 2239 |
| 133 | Ga0105239_10292716 | 3300010375 | Bacteria | 1833 |
| 134 | Ga0105246_10060955 | 3300011119 | Bacteria | 2623 |
| 135 | Ga0157373_10460850 | 3300013100 | Bacteria | 915 |
| 136 | Ga0157370_10008447 | 3300013104 | Bacteria | 11108 |
| 137 | Ga0157370_10061666 | 3300013104 | Bacteria | 3559 |
| 138 | Ga0157370_10339591 | 3300013104 | Bacteria | 1384 |
| 139 | Ga0157374_10150844 | 3300013296 | Bacteria | 2260 |
| 140 | Ga0157378_10113174 | 3300013297 | Bacteria | 2491 |
| 141 | Ga0157378_10217516 | 3300013297 | Bacteria | 1815 |
| 142 | Ga0157378_10248078 | 3300013297 | Bacteria | 1703 |
| 143 | Ga0163162_10045526 | 3300013306 | Bacteria | 4396 |
| 144 | Ga0157372_10055104 | 3300013307 | Bacteria | 4439 |
| 145 | Ga0157372_10188639 | 3300013307 | Bacteria | 2388 |
| 146 | Ga0157375_10150497 | 3300013308 | Bacteria | 2462 |
| 147 | Ga0163163_10272816 | 3300014325 | Bacteria | 1742 |
| 148 | Ga0157376_10640169 | 3300014969 | Bacteria | 1062 |
| 149 | Ga0157376_11126074 | 3300014969 | Bacteria | 811 |
| 150 | Ga0163161_10727928 | 3300017792 | Bacteria | 828 |
| 151 | Ga0207427_105765 | 3300025231 | Bacteria | 1686 |
| 152 | Ga0209233_1000289 | 3300025261 | Bacteria | 65502 |
| 153 | Ga0207656_10001196 | 3300025321 | Bacteria | 8551 |
| 154 | Ga0207692_10541174 | 3300025898 | Bacteria | 743 |
| 155 | Ga0207647_10057394 | 3300025904 | Bacteria | 2386 |
| 156 | Ga0207645_10137989 | 3300025907 | Bacteria | 1588 |
| 157 | Ga0207705_10001959 | 3300025909 | Bacteria | 16054 |
| 158 | Ga0207705_10020597 | 3300025909 | Bacteria | 4709 |
| 159 | Ga0207705_10317311 | 3300025909 | Bacteria | 1197 |
| 160 | Ga0207705_10766058 | 3300025909 | Bacteria | 750 |
| 161 | Ga0207654_10097303 | 3300025911 | Bacteria | 1807 |
| 162 | Ga0207695_10120654 | 3300025913 | Bacteria | 2590 |
| 163 | Ga0207695_10398341 | 3300025913 | Bacteria | 1261 |
| 164 | Ga0207671_10298058 | 3300025914 | Bacteria | 1273 |
| 165 | Ga0207657_10001847 | 3300025919 | Bacteria | 22875 |
| 166 | Ga0207657_10004351 | 3300025919 | Bacteria | 15001 |
| 167 | Ga0207657_10051959 | 3300025919 | Bacteria | 3560 |
| 168 | Ga0207657_10066239 | 3300025919 | Bacteria | 3075 |
| 169 | Ga0207649_10003973 | 3300025920 | Bacteria | 8063 |
| 170 | Ga0207649_10015589 | 3300025920 | Bacteria | 4269 |
| 171 | Ga0207649_10032185 | 3300025920 | Bacteria | 3124 |
| 172 | Ga0207649_10363206 | 3300025920 | Bacteria | 1075 |
| 173 | Ga0207652_10224948 | 3300025921 | Bacteria | 1691 |
| 174 | Ga0207694_10055484 | 3300025924 | Bacteria | 3075 |
| 175 | Ga0207694_10336337 | 3300025924 | Bacteria | 1248 |
| 176 | Ga0207694_10712198 | 3300025924 | Bacteria | 847 |
| 177 | Ga0207700_10157610 | 3300025928 | Bacteria | 1882 |
| 178 | Ga0207690_10101711 | 3300025932 | Bacteria | 2053 |
| 179 | Ga0207690_10214777 | 3300025932 | Bacteria | 1468 |
| 180 | Ga0207690_10292747 | 3300025932 | Bacteria | 1271 |
| 181 | Ga0207690_10978096 | 3300025932 | Bacteria | 704 |
| 182 | Ga0207706_10298011 | 3300025933 | Bacteria | 1405 |
| 183 | Ga0207669_10139710 | 3300025937 | Bacteria | 1679 |
| 184 | Ga0207704_10219561 | 3300025938 | Bacteria | 1405 |
| 185 | Ga0207665_10055079 | 3300025939 | Bacteria | 2683 |
| 186 | Ga0207691_10727445 | 3300025940 | Bacteria | 836 |
| 187 | Ga0207689_10630210 | 3300025942 | Bacteria | 903 |
| 188 | Ga0207661_10349000 | 3300025944 | Bacteria | 1335 |
| 189 | Ga0207679_10011252 | 3300025945 | Bacteria | 5785 |
| 190 | Ga0207679_10484811 | 3300025945 | Bacteria | 1101 |
| 191 | Ga0207667_10004448 | 3300025949 | Bacteria | 17165 |
| 192 | Ga0207667_10010728 | 3300025949 | Bacteria | 10688 |
| 193 | Ga0207667_10025234 | 3300025949 | Bacteria | 6509 |
| 194 | Ga0207667_10054071 | 3300025949 | Bacteria | 4223 |
| 195 | Ga0207667_10086052 | 3300025949 | Bacteria | 3254 |
| 196 | Ga0207667_10092336 | 3300025949 | Bacteria | 3126 |
| 197 | Ga0207667_10688405 | 3300025949 | Bacteria | 1026 |
| 198 | Ga0207667_10707330 | 3300025949 | Bacteria | 1010 |
| 199 | Ga0207651_10021509 | 3300025960 | Bacteria | 3923 |
| 200 | Ga0207651_10581709 | 3300025960 | Bacteria | 977 |
| 201 | Ga0207668_10003263 | 3300025972 | Bacteria | 9508 |
| 202 | Ga0207640_10002261 | 3300025981 | Bacteria | 10370 |
| 203 | Ga0207658_10484292 | 3300025986 | Bacteria | 1100 |
| 204 | Ga0207677_10025220 | 3300026023 | Bacteria | 3705 |
| 205 | Ga0207677_10450054 | 3300026023 | Bacteria | 1103 |
| 206 | Ga0207703_10226009 | 3300026035 | Bacteria | 1676 |
| 207 | Ga0207703_10801966 | 3300026035 | Bacteria | 899 |
| 208 | Ga0207639_10001130 | 3300026041 | Bacteria | 18129 |
| 209 | Ga0207639_10002574 | 3300026041 | Bacteria | 12170 |
| 210 | Ga0207639_10032763 | 3300026041 | Bacteria | 3828 |
| 211 | Ga0207639_10511019 | 3300026041 | Bacteria | 1099 |
| 212 | Ga0207678_10057441 | 3300026067 | Bacteria | 3349 |
| 213 | Ga0207678_10256170 | 3300026067 | Bacteria | 1499 |
| 214 | Ga0207708_10552096 | 3300026075 | Bacteria | 971 |
| 215 | Ga0207702_10019506 | 3300026078 | Bacteria | 5610 |
| 216 | Ga0207702_10025300 | 3300026078 | Bacteria | 4926 |
| 217 | Ga0207702_10100785 | 3300026078 | Bacteria | 2549 |
| 218 | Ga0207702_10249418 | 3300026078 | Bacteria | 1666 |
| 219 | Ga0207641_11477606 | 3300026088 | Bacteria | 681 |
| 220 | Ga0207648_10123021 | 3300026089 | Bacteria | 2281 |
| 221 | Ga0207648_10372850 | 3300026089 | Bacteria | 1289 |
| 222 | Ga0207674_10003697 | 3300026116 | Bacteria | 18675 |
| 223 | Ga0207674_10044178 | 3300026116 | Bacteria | 4591 |
| 224 | Ga0207675_100420490 | 3300026118 | Bacteria | 1320 |
| 225 | Ga0207698_10003276 | 3300026142 | Bacteria | 9727 |
| 226 | Ga0207698_10009033 | 3300026142 | Bacteria | 6330 |
| 227 | Ga0207698_10368344 | 3300026142 | Bacteria | 1363 |
| 228 | Ga0207698_10562800 | 3300026142 | Bacteria | 1119 |
| 229 | Ga0207428_10004254 | 3300027907 | Bacteria | 13701 |
| 230 | Ga0268264_10516332 | 3300028381 | Bacteria | 1167 |
| 231 | Ga0265319_1113913 | 3300028563 | Bacteria | 844 |
| 232 | Ga0265318_10017771 | 3300028577 | Bacteria | 2913 |
| 233 | Ga0265318_10044752 | 3300028577 | Bacteria | 1674 |
| 234 | Ga0265324_10089185 | 3300029957 | Bacteria | 1049 |
| 235 | Ga0265330_10016486 | 3300031235 | Bacteria | 3408 |
| 236 | Ga0265330_10176548 | 3300031235 | Bacteria | 905 |
| 237 | Ga0265330_10206188 | 3300031235 | Bacteria | 831 |
| 238 | Ga0265330_10245333 | 3300031235 | Bacteria | 755 |
| 239 | Ga0265320_10006100 | 3300031240 | Bacteria | 7643 |
| 240 | Ga0265320_10111924 | 3300031240 | Bacteria | 1250 |
| 241 | Ga0265325_10002112 | 3300031241 | Bacteria | 13571 |
| 242 | Ga0265325_10012366 | 3300031241 | Bacteria | 4884 |
| 243 | Ga0265325_10040986 | 3300031241 | Bacteria | 2429 |
| 244 | Ga0265329_10038151 | 3300031242 | Bacteria | 1546 |
| 245 | Ga0265329_10057732 | 3300031242 | Bacteria | 1230 |
| 246 | Ga0265340_10030452 | 3300031247 | Bacteria | 2704 |
| 247 | Ga0265340_10087211 | 3300031247 | Bacteria | 1463 |
| 248 | Ga0265339_10013004 | 3300031249 | Bacteria | 5059 |
| 249 | Ga0265339_10110424 | 3300031249 | Bacteria | 1423 |
| 250 | Ga0265331_10003140 | 3300031250 | Bacteria | 10787 |
| 251 | Ga0265331_10030823 | 3300031250 | Bacteria | 2667 |
| 252 | Ga0265331_10051270 | 3300031250 | Bacteria | 1975 |
| 253 | Ga0265327_10027089 | 3300031251 | Bacteria | 3305 |
| 254 | Ga0265316_10044636 | 3300031344 | Bacteria | 3523 |
| 255 | Ga0265316_10061937 | 3300031344 | Bacteria | 2904 |
| 256 | Ga0265316_10071048 | 3300031344 | Bacteria | 2684 |
| 257 | Ga0265316_10127976 | 3300031344 | Bacteria | 1914 |
| 258 | Ga0265316_10308160 | 3300031344 | Bacteria | 1152 |
| 259 | Ga0265316_10653399 | 3300031344 | Bacteria | 743 |
| 260 | Ga0265313_10000045 | 3300031595 | Bacteria | 114646 |
| 261 | Ga0265313_10010603 | 3300031595 | Bacteria | 5805 |
| 262 | Ga0265313_10081830 | 3300031595 | Bacteria | 1465 |
| 263 | Ga0265313_10122087 | 3300031595 | Bacteria | 1135 |
| 264 | Ga0265314_10004593 | 3300031711 | Bacteria | 12745 |
| 265 | Ga0265314_10025163 | 3300031711 | Bacteria | 4497 |
| 266 | Ga0265314_10040088 | 3300031711 | Bacteria | 3365 |
| 267 | Ga0265314_10176725 | 3300031711 | Bacteria | 1283 |
| 268 | Ga0265314_10222158 | 3300031711 | Bacteria | 1102 |
| 269 | Ga0265342_10008205 | 3300031712 | Bacteria | 7523 |
| 270 | Ga0265342_10052475 | 3300031712 | Bacteria | 2430 |
| 271 | Ga0265342_10193750 | 3300031712 | Bacteria | 1108 |
| 272 | Ga0307516_10051115 | 3300031730 | Bacteria | 4053 |
| 273 | Ga0307413_10031791 | 3300031824 | Bacteria | 2983 |
| 274 | Ga0307413_11426614 | 3300031824 | Bacteria | 610 |
| 275 | Ga0307406_10352149 | 3300031901 | Bacteria | 1151 |
| 276 | Ga0307416_100337168 | 3300032002 | Bacteria | 1519 |
| 277 | Ga0307416_100542504 | 3300032002 | Bacteria | 1235 |
| 278 | Ga0307416_100859959 | 3300032002 | Bacteria | 1005 |
| 279 | Ga0307414_10117444 | 3300032004 | Bacteria | 2038 |
| 280 | Ga0307414_11282262 | 3300032004 | Bacteria | 679 |
| 281 | Ga0307414_11516008 | 3300032004 | Bacteria | 624 |
| 282 | Ga0307411_10234830 | 3300032005 | Bacteria | 1432 |
| 283 | Ga0373934_0006551 | 3300035086 | Bacteria | 4320 |
| 284 | Ga0373934_0070565 | 3300035086 | Bacteria | 1397 |
| 285 | Ga0373923_0020236 | 3300035111 | Bacteria | 2583 |
| 286 | Ga0373936_0000301 | 3300035113 | Bacteria | 16586 |
| 287 | Ga0373941_0215802 | 3300035115 | Bacteria | 735 |
| 288 | Ga0373945_0002637 | 3300035116 | Bacteria | 5617 |
| 289 | Ga0373953_0000709 | 3300035117 | Bacteria | 9221 |
| 290 | Ga0373953_0025327 | 3300035117 | Bacteria | 2265 |
| 291 | Ga0373954_0014897 | 3300035118 | Bacteria | 3469 |
| 292 | Ga0373954_0017055 | 3300035118 | Bacteria | 3257 |
| 293 | Ga0373956_0226136 | 3300035119 | Bacteria | 888 |
| 294 | Ga0373957_0000730 | 3300035120 | Bacteria | 8552 |
| 295 | Ga0373943_0004281 | 3300035170 | Bacteria | 6482 |
| 296 | Ga0373946_0003598 | 3300035171 | Bacteria | 5495 |
| 297 | Ga0373955_0000164 | 3300035172 | Bacteria | 26907 |
| 298 | Ga0373955_0024013 | 3300035172 | Bacteria | 3112 |
| 299 | Ga0373955_0632992 | 3300035172 | Bacteria | 656 |
| 300 | Ga0373924_0012208 | 3300035410 | Bacteria | 3207 |
| 301 | Ga0373924_0016173 | 3300035410 | Bacteria | 2846 |
| 302 | Ga0373935_0000011 | 3300035692 | Bacteria | 89873 |
| 303 | Ga0373935_0063163 | 3300035692 | Bacteria | 2373 |
| 304 | Ga0373927_0025272 | 3300035695 | Bacteria | 3882 |
| 305 | Ga0373927_0168835 | 3300035695 | Bacteria | 1434 |
| 306 | Ga0373927_0187439 | 3300035695 | Bacteria | 1357 |
| 307 | Ga0373933_0000357 | 3300035724 | Bacteria | 29188 |
| 308 | Ga0373933_0005248 | 3300035724 | Bacteria | 7063 |
| 309 | Ga0373947_0000139 | 3300035725 | Bacteria | 37679 |
| 310 | Ga0373937_0000041 | 3300036401 | Bacteria | 108866 |
| 311 | Ga0373937_0001701 | 3300036401 | Bacteria | 18497 |
| 312 | Ga0373937_0473088 | 3300036401 | Bacteria | 1190 |
| 313 | Ga0373925_0000048 | 3300037068 | Bacteria | 129615 |
| 314 | Ga0373925_0519608 | 3300037068 | Bacteria | 978 |
| 315 | Ga0395899_0105789 | 3300037312 | Bacteria | 2026 |
| 316 | Ga0395900_0020719 | 3300037418 | Bacteria | 6719 |
| 317 | Ga0395900_0214754 | 3300037418 | Bacteria | 1941 |
| 318 | Ga0395898_0152891 | 3300037466 | Bacteria | 2207 |
| 319 | Ga0395898_0575036 | 3300037466 | Bacteria | 1069 |
| 320 | Ga0395898_1184543 | 3300037466 | Bacteria | 695 |
| 321 | Ga0436364_0458239 | 3300037853 | Bacteria | 979 |
| 322 | Ga0436364_0515436 | 3300037853 | Bacteria | 1046 |
| 323 | Ga0436364_0624265 | 3300037853 | Bacteria | 1596 |
| 324 | Ga0436364_0855514 | 3300037853 | Bacteria | 1389 |
| 325 | Ga0436364_1069039 | 3300037853 | Bacteria | 847 |
| 326 | Ga0395901_0137719 | 3300038443 | Bacteria | 2565 |
| 327 | Ga0395901_0289566 | 3300038443 | Bacteria | 1700 |
| 328 | Ga0395901_0613888 | 3300038443 | Bacteria | 1095 |
| 329 | Ga0436360_1039408 | 3300039438 | Bacteria | 665 |
| 330 | Ga0436360_1094690 | 3300039438 | Bacteria | 1018 |
| 331 | Ga0436361_0500655 | 3300039447 | Bacteria | 1595 |
| 332 | Ga0436361_1192758 | 3300039447 | Bacteria | 1309 |
| 333 | Ga0436363_0122028 | 3300039450 | Bacteria | 1223 |
| 334 | Ga0436363_0779060 | 3300039450 | Bacteria | 1804 |
| 335 | Ga0436363_1435802 | 3300039450 | Bacteria | 3095 |
| 336 | Ga0436363_1499860 | 3300039450 | Bacteria | 1177 |
| 337 | Ga0439453_0011377 | 3300041408 | Bacteria | 1483 |
| 338 | Ga0439465_0123910 | 3300041413 | Bacteria | 908 |
| 339 | Ga0439465_0210228 | 3300041413 | Bacteria | 711 |
| 340 | Ga0451797_0836775 | 3300041453 | Bacteria | 1065 |
| 341 | Ga0439452_055480 | 3300042010 | Bacteria | 898 |
| 342 | Ga0439435_0047181 | 3300042436 | Bacteria | 1222 |
| 343 | Ga0466969_0073012 | 3300044656 | Bacteria | 1647 |
| 344 | Ga0466965_0637856 | 3300044683 | Bacteria | 607 |
| 345 | Ga0466961_0220119 | 3300044693 | Bacteria | 1170 |
| 346 | Ga0466963_0835753 | 3300044694 | Bacteria | 649 |
| 347 | Ga0466957_0111625 | 3300044842 | Bacteria | 1734 |
| 348 | Ga0466959_0111959 | 3300045049 | Bacteria | 1947 |
| 349 | Ga0451576_0007905 | 3300045051 | Bacteria | 12600 |
| 350 | Ga0466958_0268200 | 3300045836 | Bacteria | 1093 |
| 351 | Ga0495592_0000074 | 3300046454 | Bacteria | 89381 |
| 352 | Ga0495592_0002150 | 3300046454 | Bacteria | 13878 |
| 353 | Ga0495629_0038627 | 3300046459 | Bacteria | 3361 |
| 354 | Ga0495651_0000304 | 3300046462 | Bacteria | 38409 |
| 355 | Ga0495651_0002729 | 3300046462 | Bacteria | 13687 |
| 356 | Ga0495653_0000738 | 3300046463 | Bacteria | 24961 |
| 357 | Ga0495653_0136485 | 3300046463 | Bacteria | 1730 |
| 358 | Ga0495605_0428156 | 3300046474 | Bacteria | 547 |
| 359 | Ga0495662_0004174 | 3300046476 | Bacteria | 7279 |
| 360 | Ga0495664_0000008 | 3300046477 | Bacteria | 307158 |
| 361 | Ga0495664_0007653 | 3300046477 | Bacteria | 6007 |
| 362 | Ga0495608_0000014 | 3300046511 | Bacteria | 221042 |
| 363 | Ga0495608_0000943 | 3300046511 | Bacteria | 20472 |
| 364 | Ga0495618_0000013 | 3300046514 | Bacteria | 168671 |
| 365 | Ga0495618_0001029 | 3300046514 | Bacteria | 19114 |
| 366 | Ga0495628_0000008 | 3300046516 | Bacteria | 284313 |
| 367 | Ga0495628_0003985 | 3300046516 | Bacteria | 13155 |
| 368 | Ga0495630_0001180 | 3300046517 | Bacteria | 18008 |
| 369 | Ga0495630_0020549 | 3300046517 | Bacteria | 4868 |
| 370 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 371 | Ga0495652_0011331 | 3300046529 | Bacteria | 8065 |
| 372 | Ga0495640_0000020 | 3300046533 | Bacteria | 116618 |
| 373 | Ga0495640_0012379 | 3300046533 | Bacteria | 6520 |
| 374 | Ga0495586_0003355 | 3300046535 | Bacteria | 8583 |
| 375 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 376 | Ga0495587_0001771 | 3300046536 | Bacteria | 14440 |
| 377 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 378 | Ga0495645_0073187 | 3300046543 | Bacteria | 2468 |
| 379 | Ga0495667_0000012 | 3300046559 | Bacteria | 220967 |
| 380 | Ga0495667_0005482 | 3300046559 | Bacteria | 8572 |
| 381 | Ga0495634_0000052 | 3300046642 | Bacteria | 91494 |
| 382 | Ga0495634_0128754 | 3300046642 | Bacteria | 1615 |
| 383 | Ga0495635_0000010 | 3300046663 | Bacteria | 246385 |
| 384 | Ga0495635_0030151 | 3300046663 | Bacteria | 3770 |
| 385 | Ga0495657_0000052 | 3300046675 | Bacteria | 101480 |
| 386 | Ga0495599_0000031 | 3300046678 | Bacteria | 109567 |
| 387 | Ga0495599_0015430 | 3300046678 | Bacteria | 4740 |
| 388 | Ga0495623_0000031 | 3300046679 | Bacteria | 84524 |
| 389 | Ga0495623_0000055 | 3300046679 | Bacteria | 69548 |
| 390 | Ga0495646_0000012 | 3300046680 | Bacteria | 185805 |
| 391 | Ga0495646_0001170 | 3300046680 | Bacteria | 15326 |
| 392 | Ga0495647_0119256 | 3300046681 | Bacteria | 1108 |
| 393 | Ga0495613_0020669 | 3300046689 | Bacteria | 4908 |
| 394 | Ga0495613_0027248 | 3300046689 | Bacteria | 4252 |
| 395 | Ga0495624_0029301 | 3300046690 | Bacteria | 3592 |
| 396 | Ga0495600_0000016 | 3300046809 | Bacteria | 111762 |
| 397 | Ga0495600_0003351 | 3300046809 | Bacteria | 9420 |
| 398 | Ga0495581_0060989 | 3300047315 | Bacteria | 2179 |
| 399 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 400 | Ga0495604_0001634 | 3300047317 | Bacteria | 18463 |
| 401 | Ga0495674_0000012 | 3300047319 | Bacteria | 270651 |
| 402 | Ga0495674_0006479 | 3300047319 | Bacteria | 11224 |
| 403 | Ga0495680_0000150 | 3300047322 | Bacteria | 70458 |
| 404 | Ga0495680_0001836 | 3300047322 | Bacteria | 22387 |
| 405 | Ga0495675_0000108 | 3300047444 | Bacteria | 59810 |
| 406 | Ga0495675_0002106 | 3300047444 | Bacteria | 11865 |
| 407 | Ga0495684_0000021 | 3300047471 | Bacteria | 144901 |
| 408 | Ga0495684_0015714 | 3300047471 | Bacteria | 5825 |
| 409 | Ga0495686_0385619 | 3300047472 | Bacteria | 755 |
| 410 | Ga0495593_0002268 | 3300047673 | Bacteria | 11530 |
| 411 | Ga0495593_0054865 | 3300047673 | Bacteria | 2099 |
| 412 | Ga0495602_0000031 | 3300048088 | Bacteria | 141518 |
| 413 | Ga0495602_0006837 | 3300048088 | Bacteria | 11980 |
| 414 | Ga0496100_0196526 | 3300048903 | Bacteria | 1467 |
| 415 | Ga0496101_0007392 | 3300048904 | Bacteria | 7116 |
| 416 | Ga0496102_0464099 | 3300048905 | Bacteria | 1187 |
| 417 | Ga0496105_0025099 | 3300048908 | Bacteria | 4847 |
| 418 | Ga0496106_0288522 | 3300048909 | Bacteria | 1315 |
| 419 | Ga0496107_0035951 | 3300048910 | Bacteria | 3552 |
| 420 | Ga0496108_0043176 | 3300048911 | Bacteria | 3766 |
| 421 | Ga0496109_0028458 | 3300048912 | Bacteria | 4998 |
| 422 | Ga0496110_0352088 | 3300048913 | Bacteria | 1341 |
| 423 | Ga0496114_0016267 | 3300048917 | Bacteria | 5991 |
| 424 | Ga0496115_0018462 | 3300048918 | Bacteria | 5354 |
| 425 | Ga0496120_0400429 | 3300048923 | Bacteria | 606 |
| 426 | Ga0496121_0289732 | 3300048924 | Bacteria | 1116 |
| 427 | Ga0496124_0466321 | 3300048927 | Bacteria | 857 |
| 428 | Ga0496125_0278121 | 3300048928 | Bacteria | 1039 |
| 429 | Ga0496126_0077521 | 3300048929 | Bacteria | 2946 |
| 430 | Ga0496126_0282094 | 3300048929 | Bacteria | 1376 |
| 431 | Ga0496126_0419342 | 3300048929 | Bacteria | 1082 |
| 432 | Ga0501031_0006162 | 3300049568 | Bacteria | 7830 |
| 433 | Ga0501031_0129105 | 3300049568 | Bacteria | 1651 |
| 434 | Ga0501032_0075461 | 3300049569 | Bacteria | 2245 |
| 435 | Ga0501032_0123097 | 3300049569 | Bacteria | 1714 |
| 436 | Ga0501033_0091951 | 3300049570 | Bacteria | 2219 |
| 437 | Ga0501034_0000166 | 3300049571 | Bacteria | 122782 |
| 438 | Ga0501034_0036544 | 3300049571 | Bacteria | 4975 |
| 439 | Ga0501034_0041418 | 3300049571 | Bacteria | 4660 |
| 440 | Ga0501034_0087279 | 3300049571 | Bacteria | 3119 |
| 441 | Ga0501034_0098246 | 3300049571 | Bacteria | 2923 |
| 442 | Ga0501034_0156779 | 3300049571 | Bacteria | 2250 |
| 443 | Ga0501034_0159232 | 3300049571 | Bacteria | 2230 |
| 444 | Ga0501034_0186294 | 3300049571 | Bacteria | 2039 |
| 445 | Ga0501034_0244305 | 3300049571 | Bacteria | 1740 |
| 446 | Ga0501034_0391075 | 3300049571 | Bacteria | 1314 |
| 447 | Ga0501034_0469564 | 3300049571 | Bacteria | 1174 |
| 448 | Ga0501034_0655114 | 3300049571 | Bacteria | 951 |
| 449 | Ga0501034_0982294 | 3300049571 | Bacteria | 729 |
| 450 | Ga0501034_1307360 | 3300049571 | Bacteria | 602 |
| 451 | Ga0501036_0082223 | 3300049572 | Bacteria | 2722 |
| 452 | Ga0501036_0244952 | 3300049572 | Bacteria | 1503 |
| 453 | Ga0501036_0642727 | 3300049572 | Bacteria | 878 |
| 454 | Ga0501036_0917774 | 3300049572 | Bacteria | 718 |
| 455 | Ga0501037_0003204 | 3300049573 | Bacteria | 11860 |
| 456 | Ga0501037_0011787 | 3300049573 | Bacteria | 6438 |
| 457 | Ga0501037_0186976 | 3300049573 | Bacteria | 1468 |
| 458 | Ga0501037_0202313 | 3300049573 | Bacteria | 1403 |
| 459 | Ga0501037_0247612 | 3300049573 | Bacteria | 1248 |
| 460 | Ga0501038_0019570 | 3300049574 | Bacteria | 6100 |
| 461 | Ga0501038_0038986 | 3300049574 | Bacteria | 4158 |
| 462 | Ga0501038_0627069 | 3300049574 | Bacteria | 811 |
| 463 | Ga0501038_0880060 | 3300049574 | Bacteria | 662 |
| 464 | Ga0501039_0000452 | 3300049575 | Bacteria | 29793 |
| 465 | Ga0501039_0090218 | 3300049575 | Bacteria | 2388 |
| 466 | Ga0501039_0513990 | 3300049575 | Bacteria | 940 |
| 467 | Ga0501039_0745331 | 3300049575 | Bacteria | 765 |
| 468 | Ga0501040_0026878 | 3300049576 | Bacteria | 3872 |
| 469 | Ga0501041_0088198 | 3300049577 | Bacteria | 1915 |
| 470 | Ga0501042_0170498 | 3300049578 | Bacteria | 1570 |
| 471 | Ga0501043_0440030 | 3300049579 | Bacteria | 981 |
| 472 | Ga0501046_0000224 | 3300049580 | Bacteria | 58986 |
| 473 | Ga0501046_0008529 | 3300049580 | Bacteria | 8925 |
| 474 | Ga0501046_0012397 | 3300049580 | Bacteria | 7258 |
| 475 | Ga0501046_0058059 | 3300049580 | Bacteria | 3034 |
| 476 | Ga0501046_0223029 | 3300049580 | Bacteria | 1395 |
| 477 | Ga0501046_0354426 | 3300049580 | Bacteria | 1065 |
| 478 | Ga0501047_0000283 | 3300049581 | Bacteria | 58613 |
| 479 | Ga0501047_0044435 | 3300049581 | Bacteria | 4292 |
| 480 | Ga0501047_0354254 | 3300049581 | Bacteria | 1304 |
| 481 | Ga0501047_0978059 | 3300049581 | Bacteria | 659 |
| 482 | Ga0501048_0845951 | 3300049582 | Bacteria | 658 |
| 483 | Ga0501067_0002361 | 3300049583 | Bacteria | 10450 |
| 484 | Ga0501068_0087963 | 3300049584 | Bacteria | 1914 |
| 485 | Ga0501069_0397843 | 3300049585 | Bacteria | 815 |
| 486 | Ga0501070_0016940 | 3300049586 | Bacteria | 6115 |
| 487 | Ga0501070_0197439 | 3300049586 | Bacteria | 1652 |
| 488 | Ga0501070_0463743 | 3300049586 | Bacteria | 1020 |
| 489 | Ga0501073_0030558 | 3300049589 | Bacteria | 3845 |
| 490 | Ga0501073_0202136 | 3300049589 | Bacteria | 1374 |
| 491 | Ga0501076_0153776 | 3300049592 | Bacteria | 1872 |
| 492 | Ga0501076_0219673 | 3300049592 | Bacteria | 1553 |
| 493 | Ga0501077_0689095 | 3300049593 | Bacteria | 657 |
| 494 | Ga0501079_0041609 | 3300049741 | Bacteria | 3548 |
| 495 | Ga0501080_0000315 | 3300049742 | Bacteria | 37063 |
| 496 | Ga0501080_0384644 | 3300049742 | Bacteria | 1264 |
| 497 | Ga0501080_0479936 | 3300049742 | Bacteria | 1112 |
| 498 | Ga0501080_0624692 | 3300049742 | Bacteria | 955 |
| 499 | Ga0501081_0560056 | 3300049743 | Bacteria | 854 |
| 500 | Ga0501083_0193114 | 3300049744 | Bacteria | 1329 |
| 501 | Ga0501083_0206892 | 3300049744 | Bacteria | 1280 |
| 502 | Ga0501280_000972 | 3300049776 | Bacteria | 5988 |
| 503 | Ga0501035_0000084 | 3300049822 | Bacteria | 116222 |
| 504 | Ga0501035_0010130 | 3300049822 | Bacteria | 8749 |
| 505 | Ga0501035_0109246 | 3300049822 | Bacteria | 2424 |
| 506 | Ga0501035_0178158 | 3300049822 | Bacteria | 1833 |
| 507 | Ga0501035_0315020 | 3300049822 | Bacteria | 1316 |
| 508 | Ga0501035_1443159 | 3300049822 | Bacteria | 526 |
| 509 | Ga0501044_0000073 | 3300049823 | Bacteria | 122507 |
| 510 | Ga0501044_0023883 | 3300049823 | Bacteria | 6498 |
| 511 | Ga0501044_0041207 | 3300049823 | Bacteria | 4808 |
| 512 | Ga0501044_0069139 | 3300049823 | Bacteria | 3595 |
| 513 | Ga0501044_0121685 | 3300049823 | Bacteria | 2610 |
| 514 | Ga0501044_0256254 | 3300049823 | Bacteria | 1689 |
| 515 | Ga0501044_1259193 | 3300049823 | Bacteria | 607 |
| 516 | Ga0501044_1451795 | 3300049823 | Bacteria | 551 |
| 517 | Ga0501045_0144796 | 3300049824 | Bacteria | 1767 |
| 518 | nmdc:mga03683_303664_c1 | 3300050489 | Bacteria | 749 |
| 519 | nmdc:mga03683_74518_c2 | 3300050489 | Bacteria | 1133 |
| 520 | nmdc:mga00v17_272356_c1 | 3300050491 | Bacteria | 1098 |
| 521 | nmdc:mga00v17_89_c1 | 3300050491 | Bacteria | 55686 |
| 522 | nmdc:mga06z11_565336_c1 | 3300050494 | Bacteria | 691 |
| 523 | nmdc:mga06z11_68675_c1 | 3300050494 | Bacteria | 1868 |
| 524 | nmdc:mga04h51_48320_c1 | 3300050495 | Bacteria | 1417 |
| 525 | nmdc:mga05p37_916_c1 | 3300050507 | Bacteria | 33331 |
| 526 | nmdc:mga09592_20568_c1 | 3300050508 | Bacteria | 5429 |
| 527 | nmdc:mga0qj67_2642_c2 | 3300050509 | Bacteria | 11550 |
| 528 | nmdc:mga06r32_1826_c1 | 3300050510 | Bacteria | 19014 |
| 529 | nmdc:mga08y16_325_c1 | 3300050511 | Bacteria | 43258 |
| 530 | Ga0495601_0000011 | 3300053077 | Bacteria | 264937 |
| 531 | Ga0495601_0004198 | 3300053077 | Bacteria | 8307 |
| 532 | Ga0495612_0000006 | 3300053078 | Bacteria | 269278 |
| 533 | Ga0495612_0003202 | 3300053078 | Bacteria | 6784 |
| 534 | Ga0495595_0000235 | 3300053084 | Bacteria | 21997 |
| 535 | Ga0495595_0000782 | 3300053084 | Bacteria | 12064 |
| 536 | Ga0495619_0000013 | 3300053085 | Bacteria | 264865 |
| 537 | Ga0495619_0036570 | 3300053085 | Bacteria | 3197 |
| 538 | Ga0500604_0000120 | 3300053151 | Bacteria | 23719 |
| 539 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 540 | Ga0500616_0038755 | 3300053153 | Bacteria | 2572 |
| 541 | Ga0500638_177050 | 3300053162 | Bacteria | 924 |
| 542 | Ga0500637_0199348 | 3300053178 | Bacteria | 1140 |
| 543 | Ga0500645_010737 | 3300053730 | Bacteria | 3013 |
| 544 | Ga0501084_0663509 | 3300054114 | Bacteria | 880 |
| 545 | Ga0501082_0001711 | 3300060353 | Bacteria | 19341 |
| 546 | Ga0501082_0163984 | 3300060353 | Bacteria | 1931 |
| 547 | Ga0501082_0210983 | 3300060353 | Bacteria | 1689 |
| 548 | Ga0501082_0570253 | 3300060353 | Bacteria | 990 |
| 549 | 2861692264 | 2861691609 | Bacteria | 5628931 |
| 550 | 2643814862 | 2643221558 | Bacteria | 5460675 |
| 551 | 2644165158 | 2643221629 | Bacteria | 5850260 |
| 552 | 2644351040 | 2643221662 | Bacteria | 5851492 |
| 553 | 2644412417 | 2643221674 | Bacteria | 3919126 |
| 554 | 2720615312 | 2718218232 | Bacteria | 6720332 |
| 555 | 2738746346 | 2738541281 | Bacteria | 5112672 |
| 556 | 2739355576 | 2738543032 | Bacteria | 5115625 |
| 557 | 2757571057 | 2757320392 | Bacteria | 3737298 |
| 558 | 2829747586 | 2829745981 | Bacteria | 5406054 |
| 559 | 2842700918 | 2842698319 | Bacteria | 5190321 |
| 560 | 2889791498 | 2889790730 | Bacteria | 5689708 |
| 561 | 2889916443 | 2889914905 | Bacteria | 5702301 |
| 562 | 2894821109 | 2894817345 | Bacteria | 4892941 |
| 563 | 2902406181 | 2902405164 | Bacteria | 6784948 |
| 564 | 2917554925 | 2917554339 | Bacteria | 4987857 |
| 565 | 2921290303 | 2921289301 | Bacteria | 7316391 |
| 566 | 2924220546 | 2924214083 | Bacteria | 7080103 |
| 567 | 2928126820 | 2928125067 | Bacteria | 5937560 |
| 568 | 2939674248 | 2939669807 | Bacteria | 5028511 |
| 569 | JGI24737J22298_10049266 | |||
| 570 | JGI25165J46597_1002342 | |||
| 571 | rootH1_10110309 | |||
| 572 | rootH2_10023430 | |||
| 573 | rootH2_10163117 | |||
| 574 | rootH1_10133252 | |||
| 575 | Ga0070683_100076546 | |||
| 576 | Ga0070683_100151361 | |||
| 577 | Ga0068869_100637772 | |||
| 578 | Ga0070682_100740058 | |||
| 579 | Ga0068868_100061013 | |||
| 580 | Ga0070660_100005035 | |||
| 581 | Ga0070660_100043481 | |||
| 582 | Ga0070660_100044272 | |||
| 583 | Ga0070660_100109586 | |||
| 584 | Ga0070691_10434919 | |||
| 585 | Ga0070661_100002138 | |||
| 586 | Ga0070661_100030582 | |||
| 587 | Ga0070661_100038380 | |||
| 588 | Ga0070661_100050194 | |||
| 589 | Ga0070661_100092182 | |||
| 590 | Ga0070668_100002867 | |||
| 591 | Ga0070669_100653300 | |||
| 592 | Ga0070675_100239206 | |||
| 593 | Ga0070675_100389819 | |||
| 594 | Ga0070674_100019581 | |||
| 595 | Ga0070673_100002917 | |||
| 596 | Ga0070688_100773022 | |||
| 597 | Ga0070659_100151544 | |||
| 598 | Ga0070667_100221079 | |||
| 599 | Ga0070710_10245030 | |||
| 600 | Ga0070711_100960762 | |||
| 601 | Ga0070663_100051249 | |||
| 602 | Ga0070663_100103447 | |||
| 603 | Ga0070663_100127923 | |||
| 604 | Ga0070663_100499517 | |||
| 605 | Ga0070662_100240217 | |||
| 606 | Ga0070662_100284056 | |||
| 607 | Ga0068867_100269350 | |||
| 608 | Ga0070679_100274832 | |||
| 609 | Ga0070679_100308787 | |||
| 610 | Ga0070684_100620218 | |||
| 611 | Ga0070697_100459924 | |||
| 612 | Ga0068853_100001173 | |||
| 613 | Ga0068853_100002927 | |||
| 614 | Ga0068853_100003202 | |||
| 615 | Ga0068853_100309880 | |||
| 616 | Ga0068853_100593561 | |||
| 617 | Ga0068853_100880238 | |||
| 618 | Ga0070695_100517471 | |||
| 619 | Ga0070693_100015338 | |||
| 620 | Ga0070665_100107953 | |||
| 621 | Ga0070665_100200420 | |||
| 622 | Ga0068855_100013555 | |||
| 623 | Ga0068855_100052706 | |||
| 624 | Ga0068855_100093399 | |||
| 625 | Ga0068855_100191116 | |||
| 626 | Ga0068855_100956500 | |||
| 627 | Ga0068855_100960502 | |||
| 628 | Ga0070664_100082793 | |||
| 629 | Ga0070664_100179544 | |||
| 630 | Ga0068854_100001830 | |||
| 631 | Ga0068854_100013461 | |||
| 632 | Ga0068856_100035546 | |||
| 633 | Ga0068856_100039147 | |||
| 634 | Ga0068856_100040458 | |||
| 635 | Ga0068856_100067916 | |||
| 636 | Ga0068856_101083724 | |||
| 637 | Ga0070702_100756809 | |||
| 638 | Ga0068852_100007433 | |||
| 639 | Ga0068852_100051436 | |||
| 640 | Ga0068852_100052848 | |||
| 641 | Ga0068852_100143748 | |||
| 642 | Ga0068852_100282145 | |||
| 643 | Ga0068859_102538217 | |||
| 644 | Ga0068851_10010084 | |||
| 645 | Ga0068858_100179653 | |||
| 646 | Ga0068860_100428821 | |||
| 647 | Ga0081455_10000002 | |||
| 648 | Ga0075365_10516978 | |||
| 649 | Ga0075368_10104514 | |||
| 650 | Ga0075363_100114901 | |||
| 651 | Ga0075364_10036653 | |||
| 652 | Ga0075364_10156799 | |||
| 653 | Ga0070715_11036566 | |||
| 654 | Ga0075362_10051336 | |||
| 655 | Ga0075362_10061657 | |||
| 656 | Ga0075367_10024872 | |||
| 657 | Ga0075367_10314133 | |||
| 658 | Ga0075366_10079947 | |||
| 659 | Ga0097621_100996517 | |||
| 660 | Ga0075370_10054904 | |||
| 661 | Ga0075370_10086494 | |||
| 662 | Ga0075370_10172935 | |||
| 663 | Ga0068871_100076656 | |||
| 664 | Ga0075428_100004902 | |||
| 665 | Ga0075430_100108066 | |||
| 666 | Ga0075431_100000787 | |||
| 667 | Ga0075429_100009279 | |||
| 668 | Ga0068865_100223600 | |||
| 669 | Ga0075436_100412997 | |||
| 670 | Ga0097620_102537981 | |||
| 671 | Ga0079104_1004038 | |||
| 672 | Ga0105240_10041453 | |||
| 673 | Ga0105240_10084473 | |||
| 674 | Ga0105240_10415435 | |||
| 675 | Ga0105240_10462061 | |||
| 676 | Ga0111539_10001373 | |||
| 677 | Ga0105245_10012111 | |||
| 678 | Ga0105245_10069242 | |||
| 679 | Ga0105245_10163071 | |||
| 680 | Ga0105247_10022161 | |||
| 681 | Ga0105247_10136235 | |||
| 682 | Ga0114129_10007982 | |||
| 683 | Ga0105243_10525474 | |||
| 684 | Ga0105243_10953344 | |||
| 685 | Ga0105243_11131060 | |||
| 686 | Ga0105241_10032260 | |||
| 687 | Ga0105241_11085542 | |||
| 688 | Ga0105242_10144763 | |||
| 689 | Ga0105242_10317605 | |||
| 690 | Ga0105248_10130680 | |||
| 691 | Ga0105237_10095519 | |||
| 692 | Ga0105237_10416910 | |||
| 693 | Ga0105238_10006072 | |||
| 694 | Ga0105238_10069258 | |||
| 695 | Ga0105238_10100768 | |||
| 696 | Ga0105238_10579542 | |||
| 697 | Ga0105238_10586800 | |||
| 698 | Ga0105249_10548449 | |||
| 699 | Ga0105239_10078644 | |||
| 700 | Ga0105239_10199901 | |||
| 701 | Ga0105239_10292716 | |||
| 702 | Ga0105246_10060955 | |||
| 703 | Ga0157373_10460850 | |||
| 704 | Ga0157370_10008447 | |||
| 705 | Ga0157370_10061666 | |||
| 706 | Ga0157370_10339591 | |||
| 707 | Ga0157374_10150844 | |||
| 708 | Ga0157378_10113174 | |||
| 709 | Ga0157378_10217516 | |||
| 710 | Ga0157378_10248078 | |||
| 711 | Ga0163162_10045526 | |||
| 712 | Ga0157372_10055104 | |||
| 713 | Ga0157372_10188639 | |||
| 714 | Ga0157375_10150497 | |||
| 715 | Ga0163163_10272816 | |||
| 716 | Ga0157376_10640169 | |||
| 717 | Ga0157376_11126074 | |||
| 718 | Ga0163161_10727928 | |||
| 719 | Ga0207427_105765 | |||
| 720 | Ga0209233_1000289 | |||
| 721 | Ga0207656_10001196 | |||
| 722 | Ga0207692_10541174 | |||
| 723 | Ga0207647_10057394 | |||
| 724 | Ga0207645_10137989 | |||
| 725 | Ga0207705_10001959 | |||
| 726 | Ga0207705_10020597 | |||
| 727 | Ga0207705_10317311 | |||
| 728 | Ga0207705_10766058 | |||
| 729 | Ga0207654_10097303 | |||
| 730 | Ga0207695_10120654 | |||
| 731 | Ga0207695_10398341 | |||
| 732 | Ga0207671_10298058 | |||
| 733 | Ga0207657_10001847 | |||
| 734 | Ga0207657_10004351 | |||
| 735 | Ga0207657_10051959 | |||
| 736 | Ga0207657_10066239 | |||
| 737 | Ga0207649_10003973 | |||
| 738 | Ga0207649_10015589 | |||
| 739 | Ga0207649_10032185 | |||
| 740 | Ga0207649_10363206 | |||
| 741 | Ga0207652_10224948 | |||
| 742 | Ga0207694_10055484 | |||
| 743 | Ga0207694_10336337 | |||
| 744 | Ga0207694_10712198 | |||
| 745 | Ga0207700_10157610 | |||
| 746 | Ga0207690_10101711 | |||
| 747 | Ga0207690_10214777 | |||
| 748 | Ga0207690_10292747 | |||
| 749 | Ga0207690_10978096 | |||
| 750 | Ga0207706_10298011 | |||
| 751 | Ga0207669_10139710 | |||
| 752 | Ga0207704_10219561 | |||
| 753 | Ga0207665_10055079 | |||
| 754 | Ga0207691_10727445 | |||
| 755 | Ga0207689_10630210 | |||
| 756 | Ga0207661_10349000 | |||
| 757 | Ga0207679_10011252 | |||
| 758 | Ga0207679_10484811 | |||
| 759 | Ga0207667_10004448 | |||
| 760 | Ga0207667_10010728 | |||
| 761 | Ga0207667_10025234 | |||
| 762 | Ga0207667_10054071 | |||
| 763 | Ga0207667_10086052 | |||
| 764 | Ga0207667_10092336 | |||
| 765 | Ga0207667_10688405 | |||
| 766 | Ga0207667_10707330 | |||
| 767 | Ga0207651_10021509 | |||
| 768 | Ga0207651_10581709 | |||
| 769 | Ga0207668_10003263 | |||
| 770 | Ga0207640_10002261 | |||
| 771 | Ga0207658_10484292 | |||
| 772 | Ga0207677_10025220 | |||
| 773 | Ga0207677_10450054 | |||
| 774 | Ga0207703_10226009 | |||
| 775 | Ga0207703_10801966 | |||
| 776 | Ga0207639_10001130 | |||
| 777 | Ga0207639_10002574 | |||
| 778 | Ga0207639_10032763 | |||
| 779 | Ga0207639_10511019 | |||
| 780 | Ga0207678_10057441 | |||
| 781 | Ga0207678_10256170 | |||
| 782 | Ga0207708_10552096 | |||
| 783 | Ga0207702_10019506 | |||
| 784 | Ga0207702_10025300 | |||
| 785 | Ga0207702_10100785 | |||
| 786 | Ga0207702_10249418 | |||
| 787 | Ga0207641_11477606 | |||
| 788 | Ga0207648_10123021 | |||
| 789 | Ga0207648_10372850 | |||
| 790 | Ga0207674_10003697 | |||
| 791 | Ga0207674_10044178 | |||
| 792 | Ga0207675_100420490 | |||
| 793 | Ga0207698_10003276 | |||
| 794 | Ga0207698_10009033 | |||
| 795 | Ga0207698_10368344 | |||
| 796 | Ga0207698_10562800 | |||
| 797 | Ga0207428_10004254 | |||
| 798 | Ga0268264_10516332 | |||
| 799 | Ga0265319_1113913 | |||
| 800 | Ga0265318_10017771 | |||
| 801 | Ga0265318_10044752 | |||
| 802 | Ga0265324_10089185 | |||
| 803 | Ga0265330_10016486 | |||
| 804 | Ga0265330_10176548 | |||
| 805 | Ga0265330_10206188 | |||
| 806 | Ga0265330_10245333 | |||
| 807 | Ga0265320_10006100 | |||
| 808 | Ga0265320_10111924 | |||
| 809 | Ga0265325_10002112 | |||
| 810 | Ga0265325_10012366 | |||
| 811 | Ga0265325_10040986 | |||
| 812 | Ga0265329_10038151 | |||
| 813 | Ga0265329_10057732 | |||
| 814 | Ga0265340_10030452 | |||
| 815 | Ga0265340_10087211 | |||
| 816 | Ga0265339_10013004 | |||
| 817 | Ga0265339_10110424 | |||
| 818 | Ga0265331_10003140 | |||
| 819 | Ga0265331_10030823 | |||
| 820 | Ga0265331_10051270 | |||
| 821 | Ga0265327_10027089 | |||
| 822 | Ga0265316_10044636 | |||
| 823 | Ga0265316_10061937 | |||
| 824 | Ga0265316_10071048 | |||
| 825 | Ga0265316_10127976 | |||
| 826 | Ga0265316_10308160 | |||
| 827 | Ga0265316_10653399 | |||
| 828 | Ga0265313_10000045 | |||
| 829 | Ga0265313_10010603 | |||
| 830 | Ga0265313_10081830 | |||
| 831 | Ga0265313_10122087 | |||
| 832 | Ga0265314_10004593 | |||
| 833 | Ga0265314_10025163 | |||
| 834 | Ga0265314_10040088 | |||
| 835 | Ga0265314_10176725 | |||
| 836 | Ga0265314_10222158 | |||
| 837 | Ga0265342_10008205 | |||
| 838 | Ga0265342_10052475 | |||
| 839 | Ga0265342_10193750 | |||
| 840 | Ga0307516_10051115 | |||
| 841 | Ga0307413_10031791 | |||
| 842 | Ga0307413_11426614 | |||
| 843 | Ga0307406_10352149 | |||
| 844 | Ga0307416_100337168 | |||
| 845 | Ga0307416_100542504 | |||
| 846 | Ga0307416_100859959 | |||
| 847 | Ga0307414_10117444 | |||
| 848 | Ga0307414_11282262 | |||
| 849 | Ga0307414_11516008 | |||
| 850 | Ga0307411_10234830 | |||
| 851 | Ga0373934_0006551 | |||
| 852 | Ga0373934_0070565 | |||
| 853 | Ga0373923_0020236 | |||
| 854 | Ga0373936_0000301 | |||
| 855 | Ga0373941_0215802 | |||
| 856 | Ga0373945_0002637 | |||
| 857 | Ga0373953_0000709 | |||
| 858 | Ga0373953_0025327 | |||
| 859 | Ga0373954_0014897 | |||
| 860 | Ga0373954_0017055 | |||
| 861 | Ga0373956_0226136 | |||
| 862 | Ga0373957_0000730 | |||
| 863 | Ga0373943_0004281 | |||
| 864 | Ga0373946_0003598 | |||
| 865 | Ga0373955_0000164 | |||
| 866 | Ga0373955_0024013 | |||
| 867 | Ga0373955_0632992 | |||
| 868 | Ga0373924_0012208 | |||
| 869 | Ga0373924_0016173 | |||
| 870 | Ga0373935_0000011 | |||
| 871 | Ga0373935_0063163 | |||
| 872 | Ga0373927_0025272 | |||
| 873 | Ga0373927_0168835 | |||
| 874 | Ga0373927_0187439 | |||
| 875 | Ga0373933_0000357 | |||
| 876 | Ga0373933_0005248 | |||
| 877 | Ga0373947_0000139 | |||
| 878 | Ga0373937_0000041 | |||
| 879 | Ga0373937_0001701 | |||
| 880 | Ga0373937_0473088 | |||
| 881 | Ga0373925_0000048 | |||
| 882 | Ga0373925_0519608 | |||
| 883 | Ga0395899_0105789 | |||
| 884 | Ga0395900_0020719 | |||
| 885 | Ga0395900_0214754 | |||
| 886 | Ga0395898_0152891 | |||
| 887 | Ga0395898_0575036 | |||
| 888 | Ga0395898_1184543 | |||
| 889 | Ga0436364_0458239 | |||
| 890 | Ga0436364_0515436 | |||
| 891 | Ga0436364_0624265 | |||
| 892 | Ga0436364_0855514 | |||
| 893 | Ga0436364_1069039 | |||
| 894 | Ga0395901_0137719 | |||
| 895 | Ga0395901_0289566 | |||
| 896 | Ga0395901_0613888 | |||
| 897 | Ga0436360_1039408 | |||
| 898 | Ga0436360_1094690 | |||
| 899 | Ga0436361_0500655 | |||
| 900 | Ga0436361_1192758 | |||
| 901 | Ga0436363_0122028 | |||
| 902 | Ga0436363_0779060 | |||
| 903 | Ga0436363_1435802 | |||
| 904 | Ga0436363_1499860 | |||
| 905 | Ga0439453_0011377 | |||
| 906 | Ga0439465_0123910 | |||
| 907 | Ga0439465_0210228 | |||
| 908 | Ga0451797_0836775 | |||
| 909 | Ga0439452_055480 | |||
| 910 | Ga0439435_0047181 | |||
| 911 | Ga0466969_0073012 | |||
| 912 | Ga0466965_0637856 | |||
| 913 | Ga0466961_0220119 | |||
| 914 | Ga0466963_0835753 | |||
| 915 | Ga0466957_0111625 | |||
| 916 | Ga0466959_0111959 | |||
| 917 | Ga0451576_0007905 | |||
| 918 | Ga0466958_0268200 | |||
| 919 | Ga0495592_0000074 | |||
| 920 | Ga0495592_0002150 | |||
| 921 | Ga0495629_0038627 | |||
| 922 | Ga0495651_0000304 | |||
| 923 | Ga0495651_0002729 | |||
| 924 | Ga0495653_0000738 | |||
| 925 | Ga0495653_0136485 | |||
| 926 | Ga0495605_0428156 | |||
| 927 | Ga0495662_0004174 | |||
| 928 | Ga0495664_0000008 | |||
| 929 | Ga0495664_0007653 | |||
| 930 | Ga0495608_0000014 | |||
| 931 | Ga0495608_0000943 | |||
| 932 | Ga0495618_0000013 | |||
| 933 | Ga0495618_0001029 | |||
| 934 | Ga0495628_0000008 | |||
| 935 | Ga0495628_0003985 | |||
| 936 | Ga0495630_0001180 | |||
| 937 | Ga0495630_0020549 | |||
| 938 | Ga0495652_0000005 | |||
| 939 | Ga0495652_0011331 | |||
| 940 | Ga0495640_0000020 | |||
| 941 | Ga0495640_0012379 | |||
| 942 | Ga0495586_0003355 | |||
| 943 | Ga0495587_0000005 | |||
| 944 | Ga0495587_0001771 | |||
| 945 | Ga0495645_0000007 | |||
| 946 | Ga0495645_0073187 | |||
| 947 | Ga0495667_0000012 | |||
| 948 | Ga0495667_0005482 | |||
| 949 | Ga0495634_0000052 | |||
| 950 | Ga0495634_0128754 | |||
| 951 | Ga0495635_0000010 | |||
| 952 | Ga0495635_0030151 | |||
| 953 | Ga0495657_0000052 | |||
| 954 | Ga0495599_0000031 | |||
| 955 | Ga0495599_0015430 | |||
| 956 | Ga0495623_0000031 | |||
| 957 | Ga0495623_0000055 | |||
| 958 | Ga0495646_0000012 | |||
| 959 | Ga0495646_0001170 | |||
| 960 | Ga0495647_0119256 | |||
| 961 | Ga0495613_0020669 | |||
| 962 | Ga0495613_0027248 | |||
| 963 | Ga0495624_0029301 | |||
| 964 | Ga0495600_0000016 | |||
| 965 | Ga0495600_0003351 | |||
| 966 | Ga0495581_0060989 | |||
| 967 | Ga0495604_0000001 | |||
| 968 | Ga0495604_0001634 | |||
| 969 | Ga0495674_0000012 | |||
| 970 | Ga0495674_0006479 | |||
| 971 | Ga0495680_0000150 | |||
| 972 | Ga0495680_0001836 | |||
| 973 | Ga0495675_0000108 | |||
| 974 | Ga0495675_0002106 | |||
| 975 | Ga0495684_0000021 | |||
| 976 | Ga0495684_0015714 | |||
| 977 | Ga0495686_0385619 | |||
| 978 | Ga0495593_0002268 | |||
| 979 | Ga0495593_0054865 | |||
| 980 | Ga0495602_0000031 | |||
| 981 | Ga0495602_0006837 | |||
| 982 | Ga0496100_0196526 | |||
| 983 | Ga0496101_0007392 | |||
| 984 | Ga0496102_0464099 | |||
| 985 | Ga0496105_0025099 | |||
| 986 | Ga0496106_0288522 | |||
| 987 | Ga0496107_0035951 | |||
| 988 | Ga0496108_0043176 | |||
| 989 | Ga0496109_0028458 | |||
| 990 | Ga0496110_0352088 | |||
| 991 | Ga0496114_0016267 | |||
| 992 | Ga0496115_0018462 | |||
| 993 | Ga0496120_0400429 | |||
| 994 | Ga0496121_0289732 | |||
| 995 | Ga0496124_0466321 | |||
| 996 | Ga0496125_0278121 | |||
| 997 | Ga0496126_0077521 | |||
| 998 | Ga0496126_0282094 | |||
| 999 | Ga0496126_0419342 | |||
| 1000 | Ga0501031_0006162 | |||
| 1001 | Ga0501031_0129105 | |||
| 1002 | Ga0501032_0075461 | |||
| 1003 | Ga0501032_0123097 | |||
| 1004 | Ga0501033_0091951 | |||
| 1005 | Ga0501034_0000166 | |||
| 1006 | Ga0501034_0036544 | |||
| 1007 | Ga0501034_0041418 | |||
| 1008 | Ga0501034_0087279 | |||
| 1009 | Ga0501034_0098246 | |||
| 1010 | Ga0501034_0156779 | |||
| 1011 | Ga0501034_0159232 | |||
| 1012 | Ga0501034_0186294 | |||
| 1013 | Ga0501034_0244305 | |||
| 1014 | Ga0501034_0391075 | |||
| 1015 | Ga0501034_0469564 | |||
| 1016 | Ga0501034_0655114 | |||
| 1017 | Ga0501034_0982294 | |||
| 1018 | Ga0501034_1307360 | |||
| 1019 | Ga0501036_0082223 | |||
| 1020 | Ga0501036_0244952 | |||
| 1021 | Ga0501036_0642727 | |||
| 1022 | Ga0501036_0917774 | |||
| 1023 | Ga0501037_0003204 | |||
| 1024 | Ga0501037_0011787 | |||
| 1025 | Ga0501037_0186976 | |||
| 1026 | Ga0501037_0202313 | |||
| 1027 | Ga0501037_0247612 | |||
| 1028 | Ga0501038_0019570 | |||
| 1029 | Ga0501038_0038986 | |||
| 1030 | Ga0501038_0627069 | |||
| 1031 | Ga0501038_0880060 | |||
| 1032 | Ga0501039_0000452 | |||
| 1033 | Ga0501039_0090218 | |||
| 1034 | Ga0501039_0513990 | |||
| 1035 | Ga0501039_0745331 | |||
| 1036 | Ga0501040_0026878 | |||
| 1037 | Ga0501041_0088198 | |||
| 1038 | Ga0501042_0170498 | |||
| 1039 | Ga0501043_0440030 | |||
| 1040 | Ga0501046_0000224 | |||
| 1041 | Ga0501046_0008529 | |||
| 1042 | Ga0501046_0012397 | |||
| 1043 | Ga0501046_0058059 | |||
| 1044 | Ga0501046_0223029 | |||
| 1045 | Ga0501046_0354426 | |||
| 1046 | Ga0501047_0000283 | |||
| 1047 | Ga0501047_0044435 | |||
| 1048 | Ga0501047_0354254 | |||
| 1049 | Ga0501047_0978059 | |||
| 1050 | Ga0501048_0845951 | |||
| 1051 | Ga0501067_0002361 | |||
| 1052 | Ga0501068_0087963 | |||
| 1053 | Ga0501069_0397843 | |||
| 1054 | Ga0501070_0016940 | |||
| 1055 | Ga0501070_0197439 | |||
| 1056 | Ga0501070_0463743 | |||
| 1057 | Ga0501073_0030558 | |||
| 1058 | Ga0501073_0202136 | |||
| 1059 | Ga0501076_0153776 | |||
| 1060 | Ga0501076_0219673 | |||
| 1061 | Ga0501077_0689095 | |||
| 1062 | Ga0501079_0041609 | |||
| 1063 | Ga0501080_0000315 | |||
| 1064 | Ga0501080_0384644 | |||
| 1065 | Ga0501080_0479936 | |||
| 1066 | Ga0501080_0624692 | |||
| 1067 | Ga0501081_0560056 | |||
| 1068 | Ga0501083_0193114 | |||
| 1069 | Ga0501083_0206892 | |||
| 1070 | Ga0501280_000972 | |||
| 1071 | Ga0501035_0000084 | |||
| 1072 | Ga0501035_0010130 | |||
| 1073 | Ga0501035_0109246 | |||
| 1074 | Ga0501035_0178158 | |||
| 1075 | Ga0501035_0315020 | |||
| 1076 | Ga0501035_1443159 | |||
| 1077 | Ga0501044_0000073 | |||
| 1078 | Ga0501044_0023883 | |||
| 1079 | Ga0501044_0041207 | |||
| 1080 | Ga0501044_0069139 | |||
| 1081 | Ga0501044_0121685 | |||
| 1082 | Ga0501044_0256254 | |||
| 1083 | Ga0501044_1259193 | |||
| 1084 | Ga0501044_1451795 | |||
| 1085 | Ga0501045_0144796 | |||
| 1086 | nmdc:mga03683_303664_c1 | |||
| 1087 | nmdc:mga03683_74518_c2 | |||
| 1088 | nmdc:mga00v17_272356_c1 | |||
| 1089 | nmdc:mga00v17_89_c1 | |||
| 1090 | nmdc:mga06z11_565336_c1 | |||
| 1091 | nmdc:mga06z11_68675_c1 | |||
| 1092 | nmdc:mga04h51_48320_c1 | |||
| 1093 | nmdc:mga05p37_916_c1 | |||
| 1094 | nmdc:mga09592_20568_c1 | |||
| 1095 | nmdc:mga0qj67_2642_c2 | |||
| 1096 | nmdc:mga06r32_1826_c1 | |||
| 1097 | nmdc:mga08y16_325_c1 | |||
| 1098 | Ga0495601_0000011 | |||
| 1099 | Ga0495601_0004198 | |||
| 1100 | Ga0495612_0000006 | |||
| 1101 | Ga0495612_0003202 | |||
| 1102 | Ga0495595_0000235 | |||
| 1103 | Ga0495595_0000782 | |||
| 1104 | Ga0495619_0000013 | |||
| 1105 | Ga0495619_0036570 | |||
| 1106 | Ga0500604_0000120 | |||
| 1107 | Ga0500616_0000001 | |||
| 1108 | Ga0500616_0038755 | |||
| 1109 | Ga0500638_177050 | |||
| 1110 | Ga0500637_0199348 | |||
| 1111 | Ga0500645_010737 | |||
| 1112 | Ga0501084_0663509 | |||
| 1113 | Ga0501082_0001711 | |||
| 1114 | Ga0501082_0163984 | |||
| 1115 | Ga0501082_0210983 | |||
| 1116 | Ga0501082_0570253 | |||
| 1117 | 2861692264 | |||
| 1118 | 2643814862 | |||
| 1119 | 2644165158 | |||
| 1120 | 2644351040 | |||
| 1121 | 2644412417 | |||
| 1122 | 2720615312 | |||
| 1123 | 2738746346 | |||
| 1124 | 2739355576 | |||
| 1125 | 2757571057 | |||
| 1126 | 2829747586 | |||
| 1127 | 2842700918 | |||
| 1128 | 2889791498 | |||
| 1129 | 2889916443 | |||
| 1130 | 2894821109 | |||
| 1131 | 2902406181 | |||
| 1132 | 2917554925 | |||
| 1133 | 2921290303 | |||
| 1134 | 2924220546 | |||
| 1135 | 2928126820 | |||
| 1136 | 2939674248 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sp3-assembly1.cif.gz_A | e. coli rpph bound to ap4a | 0.9255 | 11 | 175 |
| 4s2y-assembly1.cif.gz_A | structure of e. coli rpph bound to rna and three magnesium ions | 0.9243 | 11 | 175 |
| 6vcn-assembly1.cif.gz_A | crystal structure of e.coli rpph in complex with ppcpg | 0.9065 | 11 | 174 |
| 6vcp-assembly1.cif.gz_A | crystal structure of e.coli rpph in complex with utp | 0.9057 | 11 | 174 |
| 6vco-assembly1.cif.gz_A | crystal structure of e.coli rpph in complex with ppcpa | 0.9002 | 11 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4s2yA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9243 | 11 | 175 | 3.90.79.10 |
| af_A0A0R0I796_20_164_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8892 | 27 | 168 | 3.90.79.10 |
| af_C6SXU5_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8869 | 1 | 168 | 3.90.79.10 |
| 4s2yA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8786 | 11 | 175 | 3.90.79.10 |
| af_C6SXU5_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8655 | 1 | 168 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529K4I9-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) | 0.9754 | 49 | 170 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A6M1SQ27-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.9737 | 4 | 174 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A530QHP3-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) | 0.9712 | 66 | 170 |
GO:0016787
|
| AF-A0A2D7ACW3-F1-model_v4 | RNA pyrophosphohydrolase | 0.9675 | 4 | 177 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A257ZH96-F1-model_v4 | RNA pyrophosphohydrolase | 0.9642 | 47 | 169 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |