F464684
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 568 | 522 | 1136 | 279 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3004195979|3004196672 |
| Length | 307 |
| Sequence | GMGELHLDIIVDRMRREFKVEANVGAPQVAYRETITRKHEQDYTHKKQTGGTGQFARVKILFEPNPDSSEFEFDTKIVGGAVPIGSPLQLEAIKPTGTKGFLDRRELIAVNIGGVGVITTGGQSFELQARDMLYLGMGTQDVSFASADEGAPAKFYLLSAPAHLAHPSRLIRIGDAKRLDLGSKDACNERSIFQFIHADGAKTCQLVVGMTQLAPGSIWNTMPCHVHDRRMEAYLYFDLAETARVFHFMGEPDETRHIVMANEEAVLSPGWSIHSGAGTSNYAFIWAMAGDNVDYTDVDPVALGDLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 13 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 15 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 16 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 17 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 18 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 19 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 20 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 23 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 24 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 26 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 27 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 28 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 29 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 30 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 31 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 32 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 33 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 34 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 35 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 36 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 38 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 45 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 46 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 49 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 50 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 51 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 52 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 53 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 54 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 55 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 56 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 57 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 58 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 59 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 60 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 61 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 62 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 63 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 64 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 65 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 66 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 67 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 70 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 71 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 72 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 73 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 74 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 75 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 76 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 77 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 78 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 79 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 80 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 81 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 82 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 83 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 84 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 85 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 86 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 87 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 88 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 89 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 90 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 91 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 92 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 93 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 94 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 96 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 102 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 103 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 107 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 108 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 109 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 110 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 111 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 112 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 113 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 114 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 115 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 116 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 117 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 118 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 119 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 120 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 121 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 122 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 123 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 124 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 125 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 126 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 127 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 128 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 129 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 130 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 131 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 132 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 133 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 134 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 135 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 136 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 137 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 138 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 139 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 140 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 141 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 142 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 143 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 144 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 145 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 146 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 147 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 148 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 149 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 150 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 151 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 152 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 153 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 154 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 155 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 156 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 157 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 158 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 159 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 160 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 161 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 162 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 163 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 164 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 165 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 166 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 167 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 168 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 169 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 170 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 171 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 172 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 173 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 174 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 175 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 176 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 177 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 178 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 179 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 180 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 181 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 182 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 183 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 184 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 185 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 186 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 187 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 188 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 189 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 190 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 191 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 192 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 193 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 194 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 195 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 196 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 197 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 198 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 199 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 200 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 201 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 202 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 203 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 204 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 205 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 206 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 207 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 208 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 209 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 210 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 211 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 212 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 213 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 214 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 215 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 216 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 217 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 218 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 219 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 220 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 221 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 222 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 223 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 224 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 225 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 226 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 227 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 228 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 229 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 230 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 231 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 232 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 233 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 234 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 235 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 236 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 237 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 238 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 239 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 240 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 241 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 242 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 243 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 244 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 245 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 246 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 247 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 248 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 249 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 250 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 251 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 252 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 253 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 254 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 255 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 256 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 257 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 258 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 259 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 260 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 261 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 262 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 263 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 264 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 265 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 266 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 267 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 268 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 269 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 270 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 271 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 272 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 273 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 274 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 275 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 276 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 277 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 278 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 279 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 280 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 281 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 282 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 283 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 284 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 285 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 286 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 287 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 288 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 289 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 290 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 291 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 292 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 293 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 294 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 295 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 296 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 297 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 298 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 299 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 300 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 301 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 302 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 303 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 304 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 305 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 306 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 307 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 308 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 309 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 310 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 311 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 312 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 313 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 314 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 315 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 316 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 317 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 318 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 319 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 320 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 321 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 322 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 323 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 324 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 325 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 326 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 327 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 328 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 329 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 330 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 331 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 332 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 333 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 334 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 335 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 336 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 337 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 338 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 339 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 340 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 341 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 342 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 343 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 344 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 345 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 346 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 347 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 348 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 349 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 350 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 351 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 352 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 353 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 354 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 355 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 356 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 357 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 358 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 359 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 360 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 361 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 362 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 363 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 364 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 365 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 366 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 367 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 368 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 369 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 370 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 371 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 372 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 373 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 374 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 375 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 376 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 377 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 378 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 379 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 380 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 381 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 382 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 383 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 384 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 385 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 386 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 387 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 388 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 389 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 390 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 391 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 392 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 393 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 394 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 395 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 396 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 397 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 398 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 399 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 400 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 401 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 402 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 403 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 404 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 405 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 406 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 407 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 408 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 409 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 410 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 411 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 412 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 413 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 414 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 415 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 416 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 417 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 418 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 419 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 420 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 421 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 422 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 423 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 424 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 425 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 426 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 427 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 428 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 429 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 430 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 431 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 432 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 433 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 434 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 435 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 436 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 437 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 438 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 439 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 440 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 441 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 442 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 443 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 444 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 445 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 446 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 447 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 448 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 449 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 450 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 451 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 452 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 453 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 454 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 455 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 456 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 457 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 458 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 459 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 460 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 461 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 462 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 463 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 464 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 465 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 466 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 467 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 468 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 469 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 470 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 471 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 472 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 473 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 474 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 475 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 476 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 477 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 478 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 479 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 480 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 481 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 482 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 483 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 484 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 485 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 486 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 487 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 488 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 489 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 490 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 491 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 492 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 493 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 494 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 495 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 496 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 497 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 498 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 499 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 500 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 501 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 502 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 503 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 504 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 505 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 506 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 507 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 508 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 509 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 510 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 511 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 512 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 513 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 514 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 515 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 516 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 517 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 518 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 519 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 520 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 521 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 522 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 28.52 |
| Metatranscriptomes | 0 |
| Isolates | 71.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.33 |
| Nodule | 64.79 |
| Rhizoplane | 2.29 |
| Rhizosphere | 13.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1003336 | 3300002741 | Bacteria | 3326 |
| 2 | JGI25152J39213_1005341 | 3300002773 | Bacteria | 3776 |
| 3 | JGI25406J46586_10013564 | 3300003203 | Bacteria | 3494 |
| 4 | rootH2_10005148 | 3300003320 | Bacteria | 8399 |
| 5 | Ga0055526_1000049 | 3300003771 | Bacteria | 118394 |
| 6 | Ga0055526_1008287 | 3300003771 | Bacteria | 5214 |
| 7 | Ga0055526_1017562 | 3300003771 | Bacteria | 2726 |
| 8 | Ga0055524_1004345 | 3300003775 | Bacteria | 6556 |
| 9 | Ga0055524_1014834 | 3300003775 | Bacteria | 2869 |
| 10 | Ga0055528_1025676 | 3300003790 | Bacteria | 1719 |
| 11 | Ga0055540_1002996 | 3300003792 | Bacteria | 8457 |
| 12 | Ga0055531_10028500 | 3300003794 | Bacteria | 1924 |
| 13 | Ga0070682_100025925 | 3300005337 | Bacteria | 3503 |
| 14 | Ga0070672_100001180 | 3300005543 | Bacteria | 15977 |
| 15 | Ga0068856_100040848 | 3300005614 | Bacteria | 4557 |
| 16 | Ga0081539_10008993 | 3300005985 | Bacteria | 8493 |
| 17 | Ga0075365_10089230 | 3300006038 | Bacteria | 2099 |
| 18 | Ga0075368_10118050 | 3300006042 | Bacteria | 1097 |
| 19 | Ga0075364_10012341 | 3300006051 | Bacteria | 5222 |
| 20 | Ga0075364_10024204 | 3300006051 | Bacteria | 3852 |
| 21 | Ga0075362_10021063 | 3300006177 | Bacteria | 2731 |
| 22 | Ga0075367_10002312 | 3300006178 | Bacteria | 8657 |
| 23 | Ga0075366_10035368 | 3300006195 | Bacteria | 2945 |
| 24 | Ga0105251_10051426 | 3300009011 | Bacteria | 1965 |
| 25 | Ga0105249_10091909 | 3300009553 | Bacteria | 2840 |
| 26 | Ga0123342_1024199 | 3300009766 | Bacteria | 3834 |
| 27 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 28 | Ga0163163_10130050 | 3300014325 | Bacteria | 2558 |
| 29 | Ga0183363_1046 | 3300015690 | Bacteria | 40582 |
| 30 | Ga0214543_1000018 | 3300021327 | Bacteria | 272335 |
| 31 | Ga0228711_1028457 | 3300022739 | Bacteria | 3225 |
| 32 | Ga0228711_1028458 | 3300022739 | Bacteria | 3225 |
| 33 | Ga0228710_1008201 | 3300022740 | Bacteria | 15068 |
| 34 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 35 | Ga0209759_1000500 | 3300025256 | Bacteria | 43016 |
| 36 | Ga0209129_1000690 | 3300025258 | Bacteria | 22130 |
| 37 | Ga0209673_1008881 | 3300025273 | Bacteria | 4421 |
| 38 | Ga0209673_1016543 | 3300025273 | Bacteria | 2752 |
| 39 | Ga0209675_1001412 | 3300025291 | Bacteria | 13878 |
| 40 | Ga0209675_1004432 | 3300025291 | Bacteria | 6237 |
| 41 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 42 | Ga0209025_1000187 | 3300025294 | Bacteria | 154788 |
| 43 | Ga0209025_1005866 | 3300025294 | Bacteria | 9819 |
| 44 | Ga0209025_1027939 | 3300025294 | Bacteria | 2780 |
| 45 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 46 | Ga0209564_1000035 | 3300025295 | Bacteria | 442446 |
| 47 | Ga0209564_1000052 | 3300025295 | Bacteria | 356578 |
| 48 | Ga0209564_1001102 | 3300025295 | Bacteria | 32029 |
| 49 | Ga0209758_1058673 | 3300025297 | Bacteria | 1286 |
| 50 | Ga0209256_1000025 | 3300025299 | Bacteria | 442449 |
| 51 | Ga0209256_1000099 | 3300025299 | Bacteria | 203782 |
| 52 | Ga0209256_1000240 | 3300025299 | Bacteria | 97229 |
| 53 | Ga0209256_1000260 | 3300025299 | Bacteria | 93956 |
| 54 | Ga0209256_1007658 | 3300025299 | Bacteria | 5252 |
| 55 | Ga0209256_1024693 | 3300025299 | Bacteria | 1765 |
| 56 | Ga0209256_1034990 | 3300025299 | Bacteria | 1331 |
| 57 | Ga0209051_1001177 | 3300025303 | Bacteria | 23706 |
| 58 | Ga0209257_1004297 | 3300025304 | Bacteria | 11202 |
| 59 | Ga0207695_10033428 | 3300025913 | Bacteria | 5608 |
| 60 | Ga0207691_10003007 | 3300025940 | Bacteria | 16461 |
| 61 | Ga0207668_10086436 | 3300025972 | Bacteria | 2291 |
| 62 | Ga0207674_10056000 | 3300026116 | Bacteria | 4005 |
| 63 | Ga0209281_1000087 | 3300027111 | Bacteria | 246142 |
| 64 | Ga0209281_1000188 | 3300027111 | Bacteria | 141823 |
| 65 | Ga0209281_1001780 | 3300027111 | Bacteria | 10880 |
| 66 | Ga0209282_1000008 | 3300027666 | Bacteria | 248526 |
| 67 | Ga0268266_10123917 | 3300028379 | Bacteria | 2303 |
| 68 | Ga0268265_10088971 | 3300028380 | Bacteria | 2462 |
| 69 | Ga0307517_10234158 | 3300028786 | Bacteria | 1098 |
| 70 | Ga0307410_10144361 | 3300031852 | Bacteria | 1765 |
| 71 | Ga0307406_10008302 | 3300031901 | Bacteria | 5787 |
| 72 | Ga0315914_1000011 | 3300031967 | Bacteria | 170175 |
| 73 | Ga0307416_100296756 | 3300032002 | Bacteria | 1604 |
| 74 | Ga0307416_100817271 | 3300032002 | Bacteria | 1029 |
| 75 | Ga0307414_10117631 | 3300032004 | Bacteria | 2037 |
| 76 | Ga0315913_1000008 | 3300033430 | Bacteria | 155397 |
| 77 | Ga0315915_1000009 | 3300033464 | Bacteria | 252178 |
| 78 | Ga0400484_09109 | 3300038725 | Bacteria | 1368 |
| 79 | Ga0400490_25049 | 3300038726 | Bacteria | 1245 |
| 80 | Ga0400483_099725 | 3300039062 | Bacteria | 3786 |
| 81 | Ga0439436_0012751 | 3300041404 | Bacteria | 2549 |
| 82 | Ga0439465_0114268 | 3300041413 | Bacteria | 942 |
| 83 | Ga0451795_1228475 | 3300041456 | Bacteria | 867 |
| 84 | Ga0451807_2668761 | 3300041486 | Bacteria | 886 |
| 85 | Ga0451853_0966572 | 3300041512 | Bacteria | 1108 |
| 86 | Ga0439445_0022790 | 3300042004 | Bacteria | 1582 |
| 87 | Ga0439449_0061999 | 3300042007 | Bacteria | 1380 |
| 88 | Ga0450918_010596 | 3300042531 | Bacteria | 1609 |
| 89 | Ga0495638_0013394 | 3300046460 | Bacteria | 5583 |
| 90 | Ga0495687_063284 | 3300047443 | Bacteria | 1515 |
| 91 | Ga0496102_0212052 | 3300048905 | Bacteria | 1826 |
| 92 | Ga0496104_0044391 | 3300048907 | Bacteria | 4176 |
| 93 | Ga0496105_0001811 | 3300048908 | Bacteria | 15296 |
| 94 | Ga0496108_0261487 | 3300048911 | Bacteria | 1506 |
| 95 | Ga0496109_0274790 | 3300048912 | Bacteria | 1588 |
| 96 | Ga0496111_0123075 | 3300048914 | Bacteria | 1916 |
| 97 | Ga0496113_0124718 | 3300048916 | Bacteria | 2016 |
| 98 | Ga0496114_0010906 | 3300048917 | Bacteria | 7241 |
| 99 | Ga0496117_0103533 | 3300048920 | Bacteria | 1794 |
| 100 | Ga0496117_0153043 | 3300048920 | Bacteria | 1362 |
| 101 | Ga0496119_0001603 | 3300048922 | Bacteria | 26894 |
| 102 | Ga0496119_0049344 | 3300048922 | Bacteria | 2603 |
| 103 | Ga0496120_0065603 | 3300048923 | Bacteria | 2010 |
| 104 | Ga0496121_0000710 | 3300048924 | Bacteria | 61765 |
| 105 | Ga0496121_0035067 | 3300048924 | Bacteria | 4502 |
| 106 | Ga0496121_0283281 | 3300048924 | Bacteria | 1132 |
| 107 | Ga0496122_0065842 | 3300048925 | Bacteria | 2623 |
| 108 | Ga0496122_0099732 | 3300048925 | Bacteria | 1946 |
| 109 | Ga0496123_0009553 | 3300048926 | Bacteria | 8718 |
| 110 | Ga0496123_0059400 | 3300048926 | Bacteria | 2472 |
| 111 | Ga0496124_0000929 | 3300048927 | Bacteria | 47255 |
| 112 | Ga0496124_0228362 | 3300048927 | Bacteria | 1394 |
| 113 | Ga0501031_0000064 | 3300049568 | Bacteria | 56925 |
| 114 | Ga0501031_0045601 | 3300049568 | Bacteria | 2860 |
| 115 | Ga0501032_0002801 | 3300049569 | Bacteria | 13564 |
| 116 | Ga0501032_0328443 | 3300049569 | Bacteria | 986 |
| 117 | Ga0501033_0000053 | 3300049570 | Bacteria | 109042 |
| 118 | Ga0501033_0035020 | 3300049570 | Bacteria | 3763 |
| 119 | Ga0501033_0042295 | 3300049570 | Bacteria | 3397 |
| 120 | Ga0501034_0000030 | 3300049571 | Bacteria | 248180 |
| 121 | Ga0501036_0002921 | 3300049572 | Bacteria | 13571 |
| 122 | Ga0501036_0106781 | 3300049572 | Bacteria | 2367 |
| 123 | Ga0501036_0116982 | 3300049572 | Bacteria | 2251 |
| 124 | Ga0501037_0002386 | 3300049573 | Bacteria | 13559 |
| 125 | Ga0501037_0018615 | 3300049573 | Bacteria | 5117 |
| 126 | Ga0501037_0293090 | 3300049573 | Bacteria | 1131 |
| 127 | Ga0501038_0004075 | 3300049574 | Bacteria | 13587 |
| 128 | Ga0501038_0382560 | 3300049574 | Bacteria | 1091 |
| 129 | Ga0501039_0000008 | 3300049575 | Bacteria | 274778 |
| 130 | Ga0501040_0046065 | 3300049576 | Bacteria | 2976 |
| 131 | Ga0501040_0051941 | 3300049576 | Bacteria | 2805 |
| 132 | Ga0501042_0038606 | 3300049578 | Bacteria | 3390 |
| 133 | Ga0501043_0003198 | 3300049579 | Bacteria | 13545 |
| 134 | Ga0501046_0154085 | 3300049580 | Bacteria | 1732 |
| 135 | Ga0501047_0003942 | 3300049581 | Bacteria | 13947 |
| 136 | Ga0501047_0135346 | 3300049581 | Bacteria | 2344 |
| 137 | Ga0501048_0026586 | 3300049582 | Bacteria | 4212 |
| 138 | Ga0501068_0004893 | 3300049584 | Bacteria | 7296 |
| 139 | Ga0501070_0072570 | 3300049586 | Bacteria | 2849 |
| 140 | Ga0501073_0111707 | 3300049589 | Bacteria | 1895 |
| 141 | Ga0501074_0103694 | 3300049590 | Bacteria | 2036 |
| 142 | Ga0501282_009526 | 3300049778 | Bacteria | 1042 |
| 143 | Ga0501035_0000031 | 3300049822 | Bacteria | 175591 |
| 144 | Ga0501044_0000008 | 3300049823 | Bacteria | 274778 |
| 145 | Ga0501044_0055728 | 3300049823 | Bacteria | 4060 |
| 146 | Ga0501044_0164078 | 3300049823 | Bacteria | 2196 |
| 147 | Ga0501045_0077958 | 3300049824 | Bacteria | 2442 |
| 148 | nmdc:mga03683_67621_c1 | 3300050489 | Bacteria | 1521 |
| 149 | nmdc:mga00v17_1012_c1 | 3300050491 | Bacteria | 15037 |
| 150 | nmdc:mga00v17_169786_c1 | 3300050491 | Bacteria | 1406 |
| 151 | nmdc:mga00v17_17227_c1 | 3300050491 | Bacteria | 4085 |
| 152 | nmdc:mga00v17_376150_c1 | 3300050491 | Bacteria | 923 |
| 153 | nmdc:mga0yw44_216871_c1 | 3300050492 | Bacteria | 1267 |
| 154 | nmdc:mga0k408_45228_c1 | 3300050493 | Bacteria | 2540 |
| 155 | nmdc:mga06z11_91874_c1 | 3300050494 | Bacteria | 1649 |
| 156 | nmdc:mga0sz30_21463_c2 | 3300050516 | Bacteria | 1638 |
| 157 | Ga0500643_018082 | 3300053087 | Bacteria | 2347 |
| 158 | Ga0500572_001986 | 3300053111 | Bacteria | 5108 |
| 159 | Ga0500568_0000357 | 3300053139 | Bacteria | 35510 |
| 160 | Ga0500620_000440 | 3300053155 | Bacteria | 7553 |
| 161 | Ga0500636_0000656 | 3300053177 | Bacteria | 18686 |
| 162 | Ga0501082_0287237 | 3300060353 | Bacteria | 1432 |
| 163 | 3004196672 | 3004195979 | Bacteria | 6776956 |
| 164 | 2503199225 | 2503198000 | Bacteria | 6884444 |
| 165 | 2509117216 | 2508501123 | Bacteria | 6283661 |
| 166 | 2509144236 | 2508501127 | Bacteria | 7037543 |
| 167 | 2509371726 | 2509276018 | Bacteria | 6910194 |
| 168 | 2509378472 | 2509276019 | Bacteria | 6802256 |
| 169 | 2509394162 | 2509276022 | Bacteria | 6200534 |
| 170 | 2510303873 | 2510065057 | Bacteria | 6649661 |
| 171 | 2510318145 | 2510065059 | Bacteria | 6847884 |
| 172 | 2510840777 | 2510461069 | Bacteria | 5505000 |
| 173 | 2511184932 | 2510917028 | Bacteria | 6185411 |
| 174 | 2511390418 | 2511231027 | Bacteria | 5013807 |
| 175 | 2511498003 | 2511231052 | Bacteria | 6974333 |
| 176 | 2512529161 | 2512047086 | Bacteria | 6850303 |
| 177 | 2513583767 | 2513237086 | Bacteria | 7265287 |
| 178 | 2513595901 | 2513237088 | Bacteria | 6927906 |
| 179 | 2513604878 | 2513237089 | Bacteria | 6553624 |
| 180 | 2513610460 | 2513237090 | Bacteria | 7096802 |
| 181 | 2513617290 | 2513237091 | Bacteria | 6900273 |
| 182 | 2513882473 | 2513237140 | Bacteria | 7076289 |
| 183 | 2513904092 | 2513237143 | Bacteria | 6664116 |
| 184 | 2513983728 | 2513237156 | Bacteria | 6402557 |
| 185 | 2514002168 | 2513237159 | Bacteria | 6810126 |
| 186 | 2514006589 | 2513237160 | Bacteria | 6650282 |
| 187 | 2514588511 | 2513237351 | Bacteria | 6968952 |
| 188 | 2515612558 | 2515154107 | Bacteria | 6795637 |
| 189 | 2516896352 | 2516653046 | Bacteria | 6989037 |
| 190 | 2517565796 | 2517487022 | Bacteria | 7227575 |
| 191 | 2524449783 | 2524023207 | Bacteria | 6813453 |
| 192 | 2535520441 | 2534681796 | Bacteria | 7146037 |
| 193 | 2551676169 | 2551306084 | Bacteria | 8942552 |
| 194 | 2551685636 | 2551306085 | Bacteria | 7347181 |
| 195 | 2551695207 | 2551306086 | Bacteria | 6843938 |
| 196 | 2551700582 | 2551306087 | Bacteria | 7351905 |
| 197 | 2551709980 | 2551306089 | Bacteria | 7162724 |
| 198 | 2551723380 | 2551306090 | Bacteria | 7953713 |
| 199 | 2551726651 | 2551306091 | Bacteria | 7086830 |
| 200 | 2551732412 | 2551306092 | Bacteria | 6992595 |
| 201 | 2551741870 | 2551306093 | Bacteria | 7064773 |
| 202 | 2558861862 | 2558860100 | Bacteria | 8458965 |
| 203 | 2558865482 | 2558860100 | Bacteria | 8458965 |
| 204 | 2585167306 | 2582581283 | Bacteria | 6030556 |
| 205 | 2585402919 | 2582581867 | Bacteria | 7184437 |
| 206 | 2585820105 | 2585427590 | Bacteria | 6824633 |
| 207 | 2597811724 | 2597489875 | Bacteria | 7010078 |
| 208 | 2599937140 | 2599185301 | Bacteria | 6161860 |
| 209 | 2643809544 | 2643221557 | Bacteria | 7184309 |
| 210 | 2643988327 | 2643221595 | Bacteria | 6565519 |
| 211 | 2644154756 | 2643221627 | Bacteria | 6761570 |
| 212 | 2644375885 | 2643221668 | Bacteria | 7306521 |
| 213 | 2644738062 | 2643221734 | Bacteria | 5365412 |
| 214 | 2688596506 | 2687453392 | Bacteria | 6880454 |
| 215 | 2694631674 | 2693429783 | Bacteria | 7019804 |
| 216 | 2694638083 | 2693429784 | Bacteria | 7241525 |
| 217 | 2739306938 | 2738543024 | Bacteria | 5603683 |
| 218 | 2765464146 | 2765235802 | Bacteria | 5618596 |
| 219 | 2770196446 | 2767802442 | Bacteria | 5747986 |
| 220 | 2776272737 | 2775506902 | Bacteria | 6208009 |
| 221 | 2776284680 | 2775506904 | Bacteria | 5954060 |
| 222 | 2791923099 | 2791354903 | Bacteria | 4937680 |
| 223 | 2792619725 | 2791355091 | Bacteria | 6135441 |
| 224 | 2792627500 | 2791355092 | Bacteria | 6248105 |
| 225 | 2792747764 | 2791355123 | Bacteria | 8049106 |
| 226 | 2802721411 | 2802428858 | Bacteria | 6636079 |
| 227 | 2802726681 | 2802428859 | Bacteria | 6667919 |
| 228 | 2802732575 | 2802428860 | Bacteria | 6525526 |
| 229 | 2802739696 | 2802428861 | Bacteria | 6534206 |
| 230 | 2802747117 | 2802428862 | Bacteria | 6633353 |
| 231 | 2802748827 | 2802428863 | Bacteria | 6410669 |
| 232 | 2819721515 | 2818991467 | Bacteria | 5893227 |
| 233 | 2838077648 | 2838074704 | Bacteria | 6785777 |
| 234 | 2840768405 | 2840764183 | Bacteria | 6358399 |
| 235 | 2841736928 | 2841734538 | Bacteria | 6784580 |
| 236 | 2842523870 | 2842521101 | Bacteria | 6569494 |
| 237 | 2842875950 | 2842871566 | Bacteria | 4827117 |
| 238 | 2844011334 | 2844009547 | Bacteria | 6728125 |
| 239 | 2850084097 | 2850079185 | Bacteria | 6848280 |
| 240 | 2855828822 | 2855825444 | Bacteria | 6785811 |
| 241 | 2855843946 | 2855839649 | Bacteria | 7135830 |
| 242 | 2856327365 | 2856320880 | Bacteria | 7263508 |
| 243 | 2856328347 | 2856328259 | Bacteria | 6528202 |
| 244 | 2856337769 | 2856334872 | Bacteria | 7037011 |
| 245 | 2856345278 | 2856342000 | Bacteria | 7176905 |
| 246 | 2857375215 | 2857367948 | Bacteria | 6965560 |
| 247 | 2858806811 | 2858800743 | Bacteria | 6603254 |
| 248 | 2869165949 | 2869162929 | Bacteria | 6399702 |
| 249 | 2869175540 | 2869169390 | Bacteria | 6659796 |
| 250 | 2869237929 | 2869234852 | Bacteria | 6654993 |
| 251 | 2869247060 | 2869242130 | Bacteria | 6609239 |
| 252 | 2869249970 | 2869249662 | Bacteria | 6868783 |
| 253 | 2869257240 | 2869256925 | Bacteria | 6981691 |
| 254 | 2869266350 | 2869264136 | Bacteria | 6880765 |
| 255 | 2869273802 | 2869271264 | Bacteria | 6908218 |
| 256 | 2869280596 | 2869278585 | Bacteria | 7077053 |
| 257 | 2871438108 | 2871435913 | Bacteria | 6880295 |
| 258 | 2871459374 | 2871451962 | Bacteria | 7336357 |
| 259 | 2871461935 | 2871459585 | Bacteria | 6866887 |
| 260 | 2871481144 | 2871474448 | Bacteria | 6806570 |
| 261 | 2871482191 | 2871481445 | Bacteria | 6700002 |
| 262 | 2871500349 | 2871495908 | Bacteria | 6935695 |
| 263 | 2874130250 | 2874123672 | Bacteria | 7238285 |
| 264 | 2874132836 | 2874131515 | Bacteria | 6820270 |
| 265 | 2874140035 | 2874139085 | Bacteria | 7021506 |
| 266 | 2874165419 | 2874162495 | Bacteria | 6174670 |
| 267 | 2874176655 | 2874168670 | Bacteria | 8062617 |
| 268 | 2876376109 | 2876369609 | Bacteria | 6807521 |
| 269 | 2876390114 | 2876386047 | Bacteria | 6698674 |
| 270 | 2876393119 | 2876392853 | Bacteria | 6660880 |
| 271 | 2876405390 | 2876399893 | Bacteria | 6927900 |
| 272 | 2876409033 | 2876406927 | Bacteria | 6191900 |
| 273 | 2876423977 | 2876420981 | Bacteria | 6687741 |
| 274 | 2878734380 | 2878730984 | Bacteria | 6380721 |
| 275 | 2878741936 | 2878738818 | Bacteria | 7136951 |
| 276 | 2878764438 | 2878760144 | Bacteria | 6823465 |
| 277 | 2878771539 | 2878767105 | Bacteria | 6898628 |
| 278 | 2878779387 | 2878774303 | Bacteria | 6108671 |
| 279 | 2878782545 | 2878781027 | Bacteria | 6834456 |
| 280 | 2881148707 | 2881147464 | Bacteria | 7779814 |
| 281 | 2881165487 | 2881161766 | Bacteria | 7127907 |
| 282 | 2885307343 | 2885305155 | Bacteria | 7348390 |
| 283 | 2885313610 | 2885312484 | Bacteria | 6415165 |
| 284 | 2885327293 | 2885326080 | Bacteria | 7134805 |
| 285 | 2888344894 | 2888343758 | Bacteria | 6611049 |
| 286 | 2894819274 | 2894817345 | Bacteria | 4892941 |
| 287 | 2896389319 | 2896384573 | Bacteria | 7700774 |
| 288 | 2903518031 | 2903513507 | Bacteria | 6344008 |
| 289 | 2903545162 | 2903540706 | Bacteria | 7062119 |
| 290 | 2904662435 | 2904659560 | Bacteria | 6685615 |
| 291 | 2906366174 | 2906363423 | Bacteria | 6856682 |
| 292 | 2906377719 | 2906370794 | Bacteria | 6881062 |
| 293 | 2906388697 | 2906386501 | Bacteria | 5977019 |
| 294 | 2906394313 | 2906393657 | Bacteria | 6790866 |
| 295 | 2906404751 | 2906401398 | Bacteria | 6693206 |
| 296 | 2906410083 | 2906408224 | Bacteria | 6162342 |
| 297 | 2906431035 | 2906427513 | Bacteria | 6375796 |
| 298 | 2915981931 | 2915980308 | Bacteria | 6624279 |
| 299 | 2915993461 | 2915986958 | Bacteria | 6739310 |
| 300 | 2915994601 | 2915993759 | Bacteria | 7016183 |
| 301 | 2916006332 | 2916000859 | Bacteria | 6865702 |
| 302 | 2916010236 | 2916007675 | Bacteria | 6898660 |
| 303 | 2916020683 | 2916014648 | Bacteria | 6946486 |
| 304 | 2916027089 | 2916021584 | Bacteria | 6854472 |
| 305 | 2916031612 | 2916028427 | Bacteria | 6748433 |
| 306 | 2916036178 | 2916035215 | Bacteria | 6755766 |
| 307 | 2916044219 | 2916041962 | Bacteria | 6820487 |
| 308 | 2916050864 | 2916048683 | Bacteria | 6543552 |
| 309 | 2916061318 | 2916055098 | Bacteria | 6758838 |
| 310 | 2916064418 | 2916061851 | Bacteria | 6737736 |
| 311 | 2916069220 | 2916068649 | Bacteria | 6943657 |
| 312 | 2916078166 | 2916076590 | Bacteria | 6596108 |
| 313 | 2917702466 | 2917699015 | Bacteria | 7043791 |
| 314 | 2920764910 | 2920760137 | Bacteria | 7427611 |
| 315 | 2920827526 | 2920822456 | Bacteria | 6897201 |
| 316 | 2921203420 | 2921201388 | Bacteria | 6926299 |
| 317 | 2921210551 | 2921208531 | Bacteria | 6745326 |
| 318 | 2921238671 | 2921237296 | Bacteria | 6876710 |
| 319 | 2921245514 | 2921244191 | Bacteria | 6568419 |
| 320 | 2921251932 | 2921250672 | Bacteria | 6677771 |
| 321 | 2921262323 | 2921257292 | Bacteria | 6808382 |
| 322 | 2921265599 | 2921263974 | Bacteria | 6864552 |
| 323 | 2921282514 | 2921282425 | Bacteria | 6826397 |
| 324 | 2921289379 | 2921289301 | Bacteria | 7316391 |
| 325 | 2922154074 | 2922151315 | Bacteria | 6902399 |
| 326 | 2922173504 | 2922172374 | Bacteria | 6167644 |
| 327 | 2922178872 | 2922178524 | Bacteria | 6025201 |
| 328 | 2923560960 | 2923556063 | Bacteria | 6793593 |
| 329 | 2924145841 | 2924144063 | Bacteria | 6883928 |
| 330 | 2924152629 | 2924150972 | Bacteria | 7169444 |
| 331 | 2924159582 | 2924158325 | Bacteria | 7188855 |
| 332 | 2924170119 | 2924165586 | Bacteria | 7260590 |
| 333 | 2924178067 | 2924172951 | Bacteria | 6749356 |
| 334 | 2924182107 | 2924179722 | Bacteria | 6843264 |
| 335 | 2924190653 | 2924186466 | Bacteria | 6876637 |
| 336 | 2924199461 | 2924193448 | Bacteria | 6955718 |
| 337 | 2924205176 | 2924200457 | Bacteria | 6757188 |
| 338 | 2924208326 | 2924207177 | Bacteria | 6917007 |
| 339 | 2924215282 | 2924214083 | Bacteria | 7080103 |
| 340 | 2924225348 | 2924221636 | Bacteria | 7113495 |
| 341 | 2924229217 | 2924228884 | Bacteria | 6633132 |
| 342 | 2924719342 | 2924718760 | Bacteria | 6331356 |
| 343 | 2924734469 | 2924733363 | Bacteria | 7574837 |
| 344 | 2924745911 | 2924741084 | Bacteria | 6661321 |
| 345 | 2924753509 | 2924748358 | Bacteria | 6154725 |
| 346 | 2924759359 | 2924754689 | Bacteria | 6774424 |
| 347 | 2924765464 | 2924762789 | Bacteria | 6561353 |
| 348 | 2924779620 | 2924776078 | Bacteria | 7492003 |
| 349 | 2937001942 | 2936996657 | Bacteria | 6298727 |
| 350 | 2937008575 | 2937002841 | Bacteria | 6934057 |
| 351 | 2937015887 | 2937009748 | Bacteria | 6746052 |
| 352 | 2937022690 | 2937016420 | Bacteria | 6782579 |
| 353 | 2937024164 | 2937023124 | Bacteria | 6815156 |
| 354 | 2937034187 | 2937029754 | Bacteria | 6424026 |
| 355 | 2937037388 | 2937036028 | Bacteria | 6846469 |
| 356 | 2937044496 | 2937042894 | Bacteria | 6741576 |
| 357 | 2937054428 | 2937049772 | Bacteria | 6757901 |
| 358 | 2937061198 | 2937056579 | Bacteria | 7107896 |
| 359 | 2937066639 | 2937063883 | Bacteria | 7199456 |
| 360 | 2937072090 | 2937071275 | Bacteria | 6984483 |
| 361 | 2937083575 | 2937078374 | Bacteria | 6610289 |
| 362 | 2937085695 | 2937084907 | Bacteria | 6618516 |
| 363 | 2937098652 | 2937091812 | Bacteria | 6979387 |
| 364 | 2937105333 | 2937098957 | Bacteria | 7249374 |
| 365 | 2937107888 | 2937106411 | Bacteria | 6947143 |
| 366 | 2937114358 | 2937113482 | Bacteria | 6505872 |
| 367 | 2937122744 | 2937119839 | Bacteria | 6597547 |
| 368 | 2937128496 | 2937126314 | Bacteria | 6771275 |
| 369 | 2937825380 | 2937822353 | Bacteria | 7290551 |
| 370 | 2937841220 | 2937836603 | Bacteria | 6811263 |
| 371 | 2937843679 | 2937843397 | Bacteria | 5256375 |
| 372 | 2937852758 | 2937848649 | Bacteria | 6983481 |
| 373 | 2937864399 | 2937861824 | Bacteria | 6660327 |
| 374 | 2937876891 | 2937868953 | Bacteria | 6639878 |
| 375 | 2937878112 | 2937877337 | Bacteria | 7246526 |
| 376 | 2937972980 | 2937972304 | Bacteria | 7532020 |
| 377 | 2937984006 | 2937980651 | Bacteria | 6517427 |
| 378 | 2937999009 | 2937994558 | Bacteria | 7036190 |
| 379 | 2957379310 | 2957375807 | Bacteria | 6425588 |
| 380 | 2957384222 | 2957382221 | Bacteria | 6737050 |
| 381 | 2957390389 | 2957388812 | Bacteria | 6778072 |
| 382 | 2957401139 | 2957395598 | Bacteria | 6822399 |
| 383 | 2957407997 | 2957402308 | Bacteria | 6741770 |
| 384 | 2957409733 | 2957408893 | Bacteria | 6558585 |
| 385 | 2957420602 | 2957415311 | Bacteria | 6991633 |
| 386 | 2957425770 | 2957422303 | Bacteria | 7172205 |
| 387 | 2957436005 | 2957430029 | Bacteria | 7022557 |
| 388 | 2957438464 | 2957437181 | Bacteria | 6568994 |
| 389 | 2957448842 | 2957443900 | Bacteria | 6869977 |
| 390 | 2957452010 | 2957450854 | Bacteria | 6765715 |
| 391 | 2957462945 | 2957457609 | Bacteria | 6967680 |
| 392 | 2957467399 | 2957464669 | Bacteria | 6568877 |
| 393 | 2957477734 | 2957471148 | Bacteria | 6797643 |
| 394 | 2957484541 | 2957478035 | Bacteria | 6756658 |
| 395 | 2957488095 | 2957484790 | Bacteria | 6703082 |
| 396 | 2957497527 | 2957491536 | Bacteria | 6695180 |
| 397 | 2957501523 | 2957498199 | Bacteria | 7126688 |
| 398 | 2957509732 | 2957505466 | Bacteria | 7253085 |
| 399 | 2958036468 | 2958034702 | Bacteria | 6989922 |
| 400 | 2958046123 | 2958041894 | Bacteria | 13082850 |
| 401 | 2958068488 | 2958064165 | Bacteria | 7158582 |
| 402 | 2958073204 | 2958071322 | Bacteria | 6815895 |
| 403 | 2958085226 | 2958084443 | Bacteria | 7312792 |
| 404 | 2958098248 | 2958092219 | Bacteria | 6861151 |
| 405 | 2958110005 | 2958108152 | Bacteria | 6681128 |
| 406 | 2958129326 | 2958122699 | Bacteria | 7280457 |
| 407 | 2958140571 | 2958137437 | Bacteria | 6050276 |
| 408 | 2958145957 | 2958144490 | Bacteria | 6677056 |
| 409 | 2958162889 | 2958158011 | Bacteria | 6058449 |
| 410 | 2958169483 | 2958165035 | Bacteria | 6906348 |
| 411 | 2960589960 | 2960584000 | Bacteria | 6864594 |
| 412 | 2960594518 | 2960591022 | Bacteria | 6622873 |
| 413 | 2960598625 | 2960597568 | Bacteria | 6550735 |
| 414 | 2960608663 | 2960603979 | Bacteria | 6898737 |
| 415 | 2960615480 | 2960610863 | Bacteria | 6691244 |
| 416 | 2960622960 | 2960617483 | Bacteria | 6727748 |
| 417 | 2960630411 | 2960624210 | Bacteria | 6875384 |
| 418 | 2960632376 | 2960631154 | Bacteria | 6732508 |
| 419 | 2960641934 | 2960637947 | Bacteria | 7296468 |
| 420 | 2960649615 | 2960645483 | Bacteria | 7211087 |
| 421 | 2960657943 | 2960652885 | Bacteria | 7083688 |
| 422 | 2960664620 | 2960660292 | Bacteria | 7041660 |
| 423 | 2960667784 | 2960667422 | Bacteria | 6763020 |
| 424 | 2960678226 | 2960674078 | Bacteria | 6609048 |
| 425 | 2960681996 | 2960680706 | Bacteria | 6624464 |
| 426 | 2960693625 | 2960687367 | Bacteria | 6535474 |
| 427 | 2960700448 | 2960693952 | Bacteria | 6749742 |
| 428 | 2961116203 | 2961114664 | Bacteria | 6680456 |
| 429 | 2961144723 | 2961136820 | Bacteria | 6775228 |
| 430 | 2961167943 | 2961163497 | Bacteria | 6901077 |
| 431 | 2961189814 | 2961183825 | Bacteria | 6688536 |
| 432 | 2964613312 | 2964607997 | Bacteria | 7101408 |
| 433 | 2964615914 | 2964615318 | Bacteria | 6809089 |
| 434 | 2964627514 | 2964621998 | Bacteria | 6834995 |
| 435 | 2964632403 | 2964628898 | Bacteria | 7083044 |
| 436 | 2964636739 | 2964636051 | Bacteria | 7091832 |
| 437 | 2964648464 | 2964643177 | Bacteria | 6820887 |
| 438 | 2964656034 | 2964649959 | Bacteria | 6675118 |
| 439 | 2964657293 | 2964656573 | Bacteria | 7100150 |
| 440 | 2964670653 | 2964663802 | Bacteria | 7019362 |
| 441 | 2964676231 | 2964670856 | Bacteria | 6851364 |
| 442 | 2964682564 | 2964678106 | Bacteria | 6792020 |
| 443 | 2964688422 | 2964685014 | Bacteria | 6839111 |
| 444 | 2964697979 | 2964691889 | Bacteria | 6802758 |
| 445 | 2964703973 | 2964698721 | Bacteria | 6765331 |
| 446 | 2964709468 | 2964705432 | Bacteria | 7114648 |
| 447 | 2964714263 | 2964712639 | Bacteria | 6695970 |
| 448 | 2964724530 | 2964719344 | Bacteria | 7286602 |
| 449 | 2965022762 | 2965018300 | Bacteria | 6883036 |
| 450 | 2965030881 | 2965025482 | Bacteria | 6532201 |
| 451 | 2965036858 | 2965032056 | Bacteria | 6887443 |
| 452 | 2965043541 | 2965040258 | Bacteria | 6855979 |
| 453 | 2965049362 | 2965047637 | Bacteria | 6623551 |
| 454 | 2965090131 | 2965089291 | Bacteria | 6866420 |
| 455 | 2965103781 | 2965102966 | Bacteria | 6800987 |
| 456 | 2967666884 | 2967664464 | Bacteria | 6948836 |
| 457 | 2967674085 | 2967671571 | Bacteria | 7021409 |
| 458 | 2967684307 | 2967678726 | Bacteria | 7264382 |
| 459 | 2967692716 | 2967686174 | Bacteria | 6678622 |
| 460 | 2967693720 | 2967693043 | Bacteria | 6804451 |
| 461 | 2967704695 | 2967699805 | Bacteria | 6854538 |
| 462 | 2967710957 | 2967706974 | Bacteria | 7186053 |
| 463 | 2967715543 | 2967714385 | Bacteria | 7000047 |
| 464 | 2967725121 | 2967721400 | Bacteria | 7073753 |
| 465 | 2967732267 | 2967728569 | Bacteria | 6641507 |
| 466 | 2967736065 | 2967735183 | Bacteria | 6827012 |
| 467 | 2967751146 | 2967748971 | Bacteria | 6733771 |
| 468 | 2967762101 | 2967755722 | Bacteria | 6814706 |
| 469 | 2967768258 | 2967762386 | Bacteria | 6923502 |
| 470 | 2967775444 | 2967769361 | Bacteria | 6587838 |
| 471 | 2967779672 | 2967775926 | Bacteria | 6738189 |
| 472 | 2968023405 | 2968016561 | Bacteria | 7022047 |
| 473 | 2968113500 | 2968110612 | Bacteria | 6814636 |
| 474 | 2968145867 | 2968138860 | Bacteria | 6605449 |
| 475 | 2968176343 | 2968171901 | Bacteria | 6894245 |
| 476 | 2970022931 | 2970019648 | Bacteria | 7072033 |
| 477 | 2970031284 | 2970026789 | Bacteria | 6785236 |
| 478 | 2970037918 | 2970033650 | Bacteria | 7118744 |
| 479 | 2970042039 | 2970040964 | Bacteria | 6731123 |
| 480 | 2970053204 | 2970047711 | Bacteria | 7088379 |
| 481 | 2970055470 | 2970054988 | Bacteria | 6611507 |
| 482 | 2970065079 | 2970061556 | Bacteria | 7099761 |
| 483 | 2970071672 | 2970068827 | Bacteria | 7123112 |
| 484 | 2970080668 | 2970076120 | Bacteria | 6697332 |
| 485 | 2970088684 | 2970082768 | Bacteria | 6183754 |
| 486 | 2970092281 | 2970088815 | Bacteria | 6933825 |
| 487 | 2970100502 | 2970095765 | Bacteria | 6936963 |
| 488 | 2970103558 | 2970102677 | Bacteria | 6812532 |
| 489 | 2970114696 | 2970109326 | Bacteria | 6863976 |
| 490 | 2970116554 | 2970116247 | Bacteria | 6501857 |
| 491 | 2970127119 | 2970122695 | Bacteria | 6625855 |
| 492 | 2970130519 | 2970129317 | Bacteria | 6806560 |
| 493 | 2970138527 | 2970136068 | Bacteria | 7207982 |
| 494 | 2970147481 | 2970143518 | Bacteria | 6446480 |
| 495 | 2970155154 | 2970149975 | Bacteria | 6779706 |
| 496 | 2970157367 | 2970156795 | Bacteria | 7168044 |
| 497 | 2970165764 | 2970164137 | Bacteria | 6861252 |
| 498 | 2970177603 | 2970170962 | Bacteria | 6876229 |
| 499 | 2970180381 | 2970177841 | Bacteria | 6768001 |
| 500 | 2970186023 | 2970184632 | Bacteria | 7054431 |
| 501 | 2970192151 | 2970191845 | Bacteria | 7032787 |
| 502 | 2970475987 | 2970469710 | Bacteria | 6969209 |
| 503 | 2970493643 | 2970489779 | Bacteria | 6517260 |
| 504 | 2970512182 | 2970510686 | Bacteria | 7006402 |
| 505 | 2970526622 | 2970524798 | Bacteria | 6840927 |
| 506 | 2970540992 | 2970540015 | Bacteria | 6977556 |
| 507 | 2970550259 | 2970547951 | Bacteria | 6931819 |
| 508 | 2970559282 | 2970554993 | Bacteria | 6814252 |
| 509 | 2970595250 | 2970593180 | Bacteria | 7073582 |
| 510 | 2970619760 | 2970619444 | Bacteria | 6986144 |
| 511 | 2970630986 | 2970627176 | Bacteria | 6680862 |
| 512 | 2977518132 | 2977516862 | Bacteria | 6940108 |
| 513 | 2977528285 | 2977523885 | Bacteria | 6960446 |
| 514 | 2977535476 | 2977530762 | Bacteria | 6951399 |
| 515 | 2977538939 | 2977537788 | Bacteria | 6929320 |
| 516 | 2977551585 | 2977544691 | Bacteria | 6875412 |
| 517 | 2977552517 | 2977551784 | Bacteria | 7125765 |
| 518 | 2977561950 | 2977558990 | Bacteria | 6863948 |
| 519 | 2977570746 | 2977565890 | Bacteria | 6901543 |
| 520 | 2977579330 | 2977572785 | Bacteria | 6763888 |
| 521 | 2977580872 | 2977579622 | Bacteria | 6772100 |
| 522 | 2977852223 | 2977851361 | Bacteria | 6694324 |
| 523 | 2977871432 | 2977864932 | Bacteria | 7534097 |
| 524 | 2977873902 | 2977872689 | Bacteria | 7270173 |
| 525 | 2977900710 | 2977898635 | Bacteria | 6675551 |
| 526 | 2977913080 | 2977907340 | Bacteria | 6577984 |
| 527 | 2977921782 | 2977915119 | Bacteria | 6829656 |
| 528 | 2977926379 | 2977922695 | Bacteria | 6956781 |
| 529 | 2977941732 | 2977935797 | Bacteria | 6252826 |
| 530 | 2977957346 | 2977950692 | Bacteria | 6893264 |
| 531 | 2977964015 | 2977957713 | Bacteria | 6877875 |
| 532 | 2979766030 | 2979764755 | Bacteria | 6610066 |
| 533 | 2979773383 | 2979772303 | Bacteria | 6618277 |
| 534 | 2979799693 | 2979793036 | Bacteria | 6808957 |
| 535 | 2987645519 | 2987645492 | Bacteria | 6117018 |
| 536 | 2987663957 | 2987659509 | Bacteria | 6966464 |
| 537 | 2987669808 | 2987666974 | Bacteria | 6509233 |
| 538 | 2987675579 | 2987673487 | Bacteria | 6884027 |
| 539 | 2996339568 | 2996336353 | Bacteria | 5511628 |
| 540 | 2996354570 | 2996348954 | Bacteria | 7239054 |
| 541 | 2996387714 | 2996386984 | Bacteria | 6978667 |
| 542 | 2996887848 | 2996887358 | Bacteria | 5795980 |
| 543 | 3004193012 | 3004188549 | Bacteria | 6952365 |
| 544 | 3004218188 | 3004211236 | Bacteria | 7417683 |
| 545 | 3004222860 | 3004218560 | Bacteria | 7421728 |
| 546 | 3004234940 | 3004232784 | Bacteria | 6662140 |
| 547 | 3004242085 | 3004239961 | Bacteria | 6892290 |
| 548 | 3004250345 | 3004248173 | Bacteria | 6563236 |
| 549 | 3004269034 | 3004268573 | Bacteria | 7043476 |
| 550 | 3004281218 | 3004275668 | Bacteria | 7114440 |
| 551 | 3004290926 | 3004289098 | Bacteria | 6135450 |
| 552 | 648737556 | 648276728 | Bacteria | 6968865 |
| 553 | 649871057 | 649633066 | Bacteria | 6690028 |
| 554 | 8003996518 | 8003992118 | Bacteria | 7266902 |
| 555 | 8004004280 | 8003999396 | Bacteria | 7063185 |
| 556 | 8004305167 | 8004300914 | Bacteria | 6132239 |
| 557 | 8004314661 | 8004312739 | Bacteria | 7444653 |
| 558 | 8004362531 | 8004361976 | Bacteria | 6858373 |
| 559 | 8004395405 | 8004395343 | Bacteria | 6620908 |
| 560 | 8004634012 | 8004633249 | Bacteria | 6723080 |
| 561 | 8004697383 | 8004695233 | Bacteria | 6731676 |
| 562 | 8004734235 | 8004727605 | Bacteria | 6643904 |
| 563 | 8005259213 | 8005258706 | Bacteria | 6184835 |
| 564 | 8005322375 | 8005321885 | Bacteria | 5795980 |
| 565 | 8005548193 | 8005542996 | Bacteria | 7077758 |
| 566 | 8054464647 | 8054460903 | Bacteria | 4872905 |
| 567 | 8055618448 | 8055617313 | Bacteria | 7548464 |
| 568 | 8056876385 | 8056875544 | Bacteria | 4355797 |
| 569 | JGI25157J39369_1003336 | |||
| 570 | JGI25152J39213_1005341 | |||
| 571 | JGI25406J46586_10013564 | |||
| 572 | rootH2_10005148 | |||
| 573 | Ga0055526_1000049 | |||
| 574 | Ga0055526_1008287 | |||
| 575 | Ga0055526_1017562 | |||
| 576 | Ga0055524_1004345 | |||
| 577 | Ga0055524_1014834 | |||
| 578 | Ga0055528_1025676 | |||
| 579 | Ga0055540_1002996 | |||
| 580 | Ga0055531_10028500 | |||
| 581 | Ga0070682_100025925 | |||
| 582 | Ga0070672_100001180 | |||
| 583 | Ga0068856_100040848 | |||
| 584 | Ga0081539_10008993 | |||
| 585 | Ga0075365_10089230 | |||
| 586 | Ga0075368_10118050 | |||
| 587 | Ga0075364_10012341 | |||
| 588 | Ga0075364_10024204 | |||
| 589 | Ga0075362_10021063 | |||
| 590 | Ga0075367_10002312 | |||
| 591 | Ga0075366_10035368 | |||
| 592 | Ga0105251_10051426 | |||
| 593 | Ga0105249_10091909 | |||
| 594 | Ga0123342_1024199 | |||
| 595 | Ga0171463_1002 | |||
| 596 | Ga0163163_10130050 | |||
| 597 | Ga0183363_1046 | |||
| 598 | Ga0214543_1000018 | |||
| 599 | Ga0228711_1028457 | |||
| 600 | Ga0228711_1028458 | |||
| 601 | Ga0228710_1008201 | |||
| 602 | Ga0209026_1000032 | |||
| 603 | Ga0209759_1000500 | |||
| 604 | Ga0209129_1000690 | |||
| 605 | Ga0209673_1008881 | |||
| 606 | Ga0209673_1016543 | |||
| 607 | Ga0209675_1001412 | |||
| 608 | Ga0209675_1004432 | |||
| 609 | Ga0209025_1000016 | |||
| 610 | Ga0209025_1000187 | |||
| 611 | Ga0209025_1005866 | |||
| 612 | Ga0209025_1027939 | |||
| 613 | Ga0209564_1000015 | |||
| 614 | Ga0209564_1000035 | |||
| 615 | Ga0209564_1000052 | |||
| 616 | Ga0209564_1001102 | |||
| 617 | Ga0209758_1058673 | |||
| 618 | Ga0209256_1000025 | |||
| 619 | Ga0209256_1000099 | |||
| 620 | Ga0209256_1000240 | |||
| 621 | Ga0209256_1000260 | |||
| 622 | Ga0209256_1007658 | |||
| 623 | Ga0209256_1024693 | |||
| 624 | Ga0209256_1034990 | |||
| 625 | Ga0209051_1001177 | |||
| 626 | Ga0209257_1004297 | |||
| 627 | Ga0207695_10033428 | |||
| 628 | Ga0207691_10003007 | |||
| 629 | Ga0207668_10086436 | |||
| 630 | Ga0207674_10056000 | |||
| 631 | Ga0209281_1000087 | |||
| 632 | Ga0209281_1000188 | |||
| 633 | Ga0209281_1001780 | |||
| 634 | Ga0209282_1000008 | |||
| 635 | Ga0268266_10123917 | |||
| 636 | Ga0268265_10088971 | |||
| 637 | Ga0307517_10234158 | |||
| 638 | Ga0307410_10144361 | |||
| 639 | Ga0307406_10008302 | |||
| 640 | Ga0315914_1000011 | |||
| 641 | Ga0307416_100296756 | |||
| 642 | Ga0307416_100817271 | |||
| 643 | Ga0307414_10117631 | |||
| 644 | Ga0315913_1000008 | |||
| 645 | Ga0315915_1000009 | |||
| 646 | Ga0400484_09109 | |||
| 647 | Ga0400490_25049 | |||
| 648 | Ga0400483_099725 | |||
| 649 | Ga0439436_0012751 | |||
| 650 | Ga0439465_0114268 | |||
| 651 | Ga0451795_1228475 | |||
| 652 | Ga0451807_2668761 | |||
| 653 | Ga0451853_0966572 | |||
| 654 | Ga0439445_0022790 | |||
| 655 | Ga0439449_0061999 | |||
| 656 | Ga0450918_010596 | |||
| 657 | Ga0495638_0013394 | |||
| 658 | Ga0495687_063284 | |||
| 659 | Ga0496102_0212052 | |||
| 660 | Ga0496104_0044391 | |||
| 661 | Ga0496105_0001811 | |||
| 662 | Ga0496108_0261487 | |||
| 663 | Ga0496109_0274790 | |||
| 664 | Ga0496111_0123075 | |||
| 665 | Ga0496113_0124718 | |||
| 666 | Ga0496114_0010906 | |||
| 667 | Ga0496117_0103533 | |||
| 668 | Ga0496117_0153043 | |||
| 669 | Ga0496119_0001603 | |||
| 670 | Ga0496119_0049344 | |||
| 671 | Ga0496120_0065603 | |||
| 672 | Ga0496121_0000710 | |||
| 673 | Ga0496121_0035067 | |||
| 674 | Ga0496121_0283281 | |||
| 675 | Ga0496122_0065842 | |||
| 676 | Ga0496122_0099732 | |||
| 677 | Ga0496123_0009553 | |||
| 678 | Ga0496123_0059400 | |||
| 679 | Ga0496124_0000929 | |||
| 680 | Ga0496124_0228362 | |||
| 681 | Ga0501031_0000064 | |||
| 682 | Ga0501031_0045601 | |||
| 683 | Ga0501032_0002801 | |||
| 684 | Ga0501032_0328443 | |||
| 685 | Ga0501033_0000053 | |||
| 686 | Ga0501033_0035020 | |||
| 687 | Ga0501033_0042295 | |||
| 688 | Ga0501034_0000030 | |||
| 689 | Ga0501036_0002921 | |||
| 690 | Ga0501036_0106781 | |||
| 691 | Ga0501036_0116982 | |||
| 692 | Ga0501037_0002386 | |||
| 693 | Ga0501037_0018615 | |||
| 694 | Ga0501037_0293090 | |||
| 695 | Ga0501038_0004075 | |||
| 696 | Ga0501038_0382560 | |||
| 697 | Ga0501039_0000008 | |||
| 698 | Ga0501040_0046065 | |||
| 699 | Ga0501040_0051941 | |||
| 700 | Ga0501042_0038606 | |||
| 701 | Ga0501043_0003198 | |||
| 702 | Ga0501046_0154085 | |||
| 703 | Ga0501047_0003942 | |||
| 704 | Ga0501047_0135346 | |||
| 705 | Ga0501048_0026586 | |||
| 706 | Ga0501068_0004893 | |||
| 707 | Ga0501070_0072570 | |||
| 708 | Ga0501073_0111707 | |||
| 709 | Ga0501074_0103694 | |||
| 710 | Ga0501282_009526 | |||
| 711 | Ga0501035_0000031 | |||
| 712 | Ga0501044_0000008 | |||
| 713 | Ga0501044_0055728 | |||
| 714 | Ga0501044_0164078 | |||
| 715 | Ga0501045_0077958 | |||
| 716 | nmdc:mga03683_67621_c1 | |||
| 717 | nmdc:mga00v17_1012_c1 | |||
| 718 | nmdc:mga00v17_169786_c1 | |||
| 719 | nmdc:mga00v17_17227_c1 | |||
| 720 | nmdc:mga00v17_376150_c1 | |||
| 721 | nmdc:mga0yw44_216871_c1 | |||
| 722 | nmdc:mga0k408_45228_c1 | |||
| 723 | nmdc:mga06z11_91874_c1 | |||
| 724 | nmdc:mga0sz30_21463_c2 | |||
| 725 | Ga0500643_018082 | |||
| 726 | Ga0500572_001986 | |||
| 727 | Ga0500568_0000357 | |||
| 728 | Ga0500620_000440 | |||
| 729 | Ga0500636_0000656 | |||
| 730 | Ga0501082_0287237 | |||
| 731 | 3004196672 | |||
| 732 | 2503199225 | |||
| 733 | 2509117216 | |||
| 734 | 2509144236 | |||
| 735 | 2509371726 | |||
| 736 | 2509378472 | |||
| 737 | 2509394162 | |||
| 738 | 2510303873 | |||
| 739 | 2510318145 | |||
| 740 | 2510840777 | |||
| 741 | 2511184932 | |||
| 742 | 2511390418 | |||
| 743 | 2511498003 | |||
| 744 | 2512529161 | |||
| 745 | 2513583767 | |||
| 746 | 2513595901 | |||
| 747 | 2513604878 | |||
| 748 | 2513610460 | |||
| 749 | 2513617290 | |||
| 750 | 2513882473 | |||
| 751 | 2513904092 | |||
| 752 | 2513983728 | |||
| 753 | 2514002168 | |||
| 754 | 2514006589 | |||
| 755 | 2514588511 | |||
| 756 | 2515612558 | |||
| 757 | 2516896352 | |||
| 758 | 2517565796 | |||
| 759 | 2524449783 | |||
| 760 | 2535520441 | |||
| 761 | 2551676169 | |||
| 762 | 2551685636 | |||
| 763 | 2551695207 | |||
| 764 | 2551700582 | |||
| 765 | 2551709980 | |||
| 766 | 2551723380 | |||
| 767 | 2551726651 | |||
| 768 | 2551732412 | |||
| 769 | 2551741870 | |||
| 770 | 2558861862 | |||
| 771 | 2558865482 | |||
| 772 | 2585167306 | |||
| 773 | 2585402919 | |||
| 774 | 2585820105 | |||
| 775 | 2597811724 | |||
| 776 | 2599937140 | |||
| 777 | 2643809544 | |||
| 778 | 2643988327 | |||
| 779 | 2644154756 | |||
| 780 | 2644375885 | |||
| 781 | 2644738062 | |||
| 782 | 2688596506 | |||
| 783 | 2694631674 | |||
| 784 | 2694638083 | |||
| 785 | 2739306938 | |||
| 786 | 2765464146 | |||
| 787 | 2770196446 | |||
| 788 | 2776272737 | |||
| 789 | 2776284680 | |||
| 790 | 2791923099 | |||
| 791 | 2792619725 | |||
| 792 | 2792627500 | |||
| 793 | 2792747764 | |||
| 794 | 2802721411 | |||
| 795 | 2802726681 | |||
| 796 | 2802732575 | |||
| 797 | 2802739696 | |||
| 798 | 2802747117 | |||
| 799 | 2802748827 | |||
| 800 | 2819721515 | |||
| 801 | 2838077648 | |||
| 802 | 2840768405 | |||
| 803 | 2841736928 | |||
| 804 | 2842523870 | |||
| 805 | 2842875950 | |||
| 806 | 2844011334 | |||
| 807 | 2850084097 | |||
| 808 | 2855828822 | |||
| 809 | 2855843946 | |||
| 810 | 2856327365 | |||
| 811 | 2856328347 | |||
| 812 | 2856337769 | |||
| 813 | 2856345278 | |||
| 814 | 2857375215 | |||
| 815 | 2858806811 | |||
| 816 | 2869165949 | |||
| 817 | 2869175540 | |||
| 818 | 2869237929 | |||
| 819 | 2869247060 | |||
| 820 | 2869249970 | |||
| 821 | 2869257240 | |||
| 822 | 2869266350 | |||
| 823 | 2869273802 | |||
| 824 | 2869280596 | |||
| 825 | 2871438108 | |||
| 826 | 2871459374 | |||
| 827 | 2871461935 | |||
| 828 | 2871481144 | |||
| 829 | 2871482191 | |||
| 830 | 2871500349 | |||
| 831 | 2874130250 | |||
| 832 | 2874132836 | |||
| 833 | 2874140035 | |||
| 834 | 2874165419 | |||
| 835 | 2874176655 | |||
| 836 | 2876376109 | |||
| 837 | 2876390114 | |||
| 838 | 2876393119 | |||
| 839 | 2876405390 | |||
| 840 | 2876409033 | |||
| 841 | 2876423977 | |||
| 842 | 2878734380 | |||
| 843 | 2878741936 | |||
| 844 | 2878764438 | |||
| 845 | 2878771539 | |||
| 846 | 2878779387 | |||
| 847 | 2878782545 | |||
| 848 | 2881148707 | |||
| 849 | 2881165487 | |||
| 850 | 2885307343 | |||
| 851 | 2885313610 | |||
| 852 | 2885327293 | |||
| 853 | 2888344894 | |||
| 854 | 2894819274 | |||
| 855 | 2896389319 | |||
| 856 | 2903518031 | |||
| 857 | 2903545162 | |||
| 858 | 2904662435 | |||
| 859 | 2906366174 | |||
| 860 | 2906377719 | |||
| 861 | 2906388697 | |||
| 862 | 2906394313 | |||
| 863 | 2906404751 | |||
| 864 | 2906410083 | |||
| 865 | 2906431035 | |||
| 866 | 2915981931 | |||
| 867 | 2915993461 | |||
| 868 | 2915994601 | |||
| 869 | 2916006332 | |||
| 870 | 2916010236 | |||
| 871 | 2916020683 | |||
| 872 | 2916027089 | |||
| 873 | 2916031612 | |||
| 874 | 2916036178 | |||
| 875 | 2916044219 | |||
| 876 | 2916050864 | |||
| 877 | 2916061318 | |||
| 878 | 2916064418 | |||
| 879 | 2916069220 | |||
| 880 | 2916078166 | |||
| 881 | 2917702466 | |||
| 882 | 2920764910 | |||
| 883 | 2920827526 | |||
| 884 | 2921203420 | |||
| 885 | 2921210551 | |||
| 886 | 2921238671 | |||
| 887 | 2921245514 | |||
| 888 | 2921251932 | |||
| 889 | 2921262323 | |||
| 890 | 2921265599 | |||
| 891 | 2921282514 | |||
| 892 | 2921289379 | |||
| 893 | 2922154074 | |||
| 894 | 2922173504 | |||
| 895 | 2922178872 | |||
| 896 | 2923560960 | |||
| 897 | 2924145841 | |||
| 898 | 2924152629 | |||
| 899 | 2924159582 | |||
| 900 | 2924170119 | |||
| 901 | 2924178067 | |||
| 902 | 2924182107 | |||
| 903 | 2924190653 | |||
| 904 | 2924199461 | |||
| 905 | 2924205176 | |||
| 906 | 2924208326 | |||
| 907 | 2924215282 | |||
| 908 | 2924225348 | |||
| 909 | 2924229217 | |||
| 910 | 2924719342 | |||
| 911 | 2924734469 | |||
| 912 | 2924745911 | |||
| 913 | 2924753509 | |||
| 914 | 2924759359 | |||
| 915 | 2924765464 | |||
| 916 | 2924779620 | |||
| 917 | 2937001942 | |||
| 918 | 2937008575 | |||
| 919 | 2937015887 | |||
| 920 | 2937022690 | |||
| 921 | 2937024164 | |||
| 922 | 2937034187 | |||
| 923 | 2937037388 | |||
| 924 | 2937044496 | |||
| 925 | 2937054428 | |||
| 926 | 2937061198 | |||
| 927 | 2937066639 | |||
| 928 | 2937072090 | |||
| 929 | 2937083575 | |||
| 930 | 2937085695 | |||
| 931 | 2937098652 | |||
| 932 | 2937105333 | |||
| 933 | 2937107888 | |||
| 934 | 2937114358 | |||
| 935 | 2937122744 | |||
| 936 | 2937128496 | |||
| 937 | 2937825380 | |||
| 938 | 2937841220 | |||
| 939 | 2937843679 | |||
| 940 | 2937852758 | |||
| 941 | 2937864399 | |||
| 942 | 2937876891 | |||
| 943 | 2937878112 | |||
| 944 | 2937972980 | |||
| 945 | 2937984006 | |||
| 946 | 2937999009 | |||
| 947 | 2957379310 | |||
| 948 | 2957384222 | |||
| 949 | 2957390389 | |||
| 950 | 2957401139 | |||
| 951 | 2957407997 | |||
| 952 | 2957409733 | |||
| 953 | 2957420602 | |||
| 954 | 2957425770 | |||
| 955 | 2957436005 | |||
| 956 | 2957438464 | |||
| 957 | 2957448842 | |||
| 958 | 2957452010 | |||
| 959 | 2957462945 | |||
| 960 | 2957467399 | |||
| 961 | 2957477734 | |||
| 962 | 2957484541 | |||
| 963 | 2957488095 | |||
| 964 | 2957497527 | |||
| 965 | 2957501523 | |||
| 966 | 2957509732 | |||
| 967 | 2958036468 | |||
| 968 | 2958046123 | |||
| 969 | 2958068488 | |||
| 970 | 2958073204 | |||
| 971 | 2958085226 | |||
| 972 | 2958098248 | |||
| 973 | 2958110005 | |||
| 974 | 2958129326 | |||
| 975 | 2958140571 | |||
| 976 | 2958145957 | |||
| 977 | 2958162889 | |||
| 978 | 2958169483 | |||
| 979 | 2960589960 | |||
| 980 | 2960594518 | |||
| 981 | 2960598625 | |||
| 982 | 2960608663 | |||
| 983 | 2960615480 | |||
| 984 | 2960622960 | |||
| 985 | 2960630411 | |||
| 986 | 2960632376 | |||
| 987 | 2960641934 | |||
| 988 | 2960649615 | |||
| 989 | 2960657943 | |||
| 990 | 2960664620 | |||
| 991 | 2960667784 | |||
| 992 | 2960678226 | |||
| 993 | 2960681996 | |||
| 994 | 2960693625 | |||
| 995 | 2960700448 | |||
| 996 | 2961116203 | |||
| 997 | 2961144723 | |||
| 998 | 2961167943 | |||
| 999 | 2961189814 | |||
| 1000 | 2964613312 | |||
| 1001 | 2964615914 | |||
| 1002 | 2964627514 | |||
| 1003 | 2964632403 | |||
| 1004 | 2964636739 | |||
| 1005 | 2964648464 | |||
| 1006 | 2964656034 | |||
| 1007 | 2964657293 | |||
| 1008 | 2964670653 | |||
| 1009 | 2964676231 | |||
| 1010 | 2964682564 | |||
| 1011 | 2964688422 | |||
| 1012 | 2964697979 | |||
| 1013 | 2964703973 | |||
| 1014 | 2964709468 | |||
| 1015 | 2964714263 | |||
| 1016 | 2964724530 | |||
| 1017 | 2965022762 | |||
| 1018 | 2965030881 | |||
| 1019 | 2965036858 | |||
| 1020 | 2965043541 | |||
| 1021 | 2965049362 | |||
| 1022 | 2965090131 | |||
| 1023 | 2965103781 | |||
| 1024 | 2967666884 | |||
| 1025 | 2967674085 | |||
| 1026 | 2967684307 | |||
| 1027 | 2967692716 | |||
| 1028 | 2967693720 | |||
| 1029 | 2967704695 | |||
| 1030 | 2967710957 | |||
| 1031 | 2967715543 | |||
| 1032 | 2967725121 | |||
| 1033 | 2967732267 | |||
| 1034 | 2967736065 | |||
| 1035 | 2967751146 | |||
| 1036 | 2967762101 | |||
| 1037 | 2967768258 | |||
| 1038 | 2967775444 | |||
| 1039 | 2967779672 | |||
| 1040 | 2968023405 | |||
| 1041 | 2968113500 | |||
| 1042 | 2968145867 | |||
| 1043 | 2968176343 | |||
| 1044 | 2970022931 | |||
| 1045 | 2970031284 | |||
| 1046 | 2970037918 | |||
| 1047 | 2970042039 | |||
| 1048 | 2970053204 | |||
| 1049 | 2970055470 | |||
| 1050 | 2970065079 | |||
| 1051 | 2970071672 | |||
| 1052 | 2970080668 | |||
| 1053 | 2970088684 | |||
| 1054 | 2970092281 | |||
| 1055 | 2970100502 | |||
| 1056 | 2970103558 | |||
| 1057 | 2970114696 | |||
| 1058 | 2970116554 | |||
| 1059 | 2970127119 | |||
| 1060 | 2970130519 | |||
| 1061 | 2970138527 | |||
| 1062 | 2970147481 | |||
| 1063 | 2970155154 | |||
| 1064 | 2970157367 | |||
| 1065 | 2970165764 | |||
| 1066 | 2970177603 | |||
| 1067 | 2970180381 | |||
| 1068 | 2970186023 | |||
| 1069 | 2970192151 | |||
| 1070 | 2970475987 | |||
| 1071 | 2970493643 | |||
| 1072 | 2970512182 | |||
| 1073 | 2970526622 | |||
| 1074 | 2970540992 | |||
| 1075 | 2970550259 | |||
| 1076 | 2970559282 | |||
| 1077 | 2970595250 | |||
| 1078 | 2970619760 | |||
| 1079 | 2970630986 | |||
| 1080 | 2977518132 | |||
| 1081 | 2977528285 | |||
| 1082 | 2977535476 | |||
| 1083 | 2977538939 | |||
| 1084 | 2977551585 | |||
| 1085 | 2977552517 | |||
| 1086 | 2977561950 | |||
| 1087 | 2977570746 | |||
| 1088 | 2977579330 | |||
| 1089 | 2977580872 | |||
| 1090 | 2977852223 | |||
| 1091 | 2977871432 | |||
| 1092 | 2977873902 | |||
| 1093 | 2977900710 | |||
| 1094 | 2977913080 | |||
| 1095 | 2977921782 | |||
| 1096 | 2977926379 | |||
| 1097 | 2977941732 | |||
| 1098 | 2977957346 | |||
| 1099 | 2977964015 | |||
| 1100 | 2979766030 | |||
| 1101 | 2979773383 | |||
| 1102 | 2979799693 | |||
| 1103 | 2987645519 | |||
| 1104 | 2987663957 | |||
| 1105 | 2987669808 | |||
| 1106 | 2987675579 | |||
| 1107 | 2996339568 | |||
| 1108 | 2996354570 | |||
| 1109 | 2996387714 | |||
| 1110 | 2996887848 | |||
| 1111 | 3004193012 | |||
| 1112 | 3004218188 | |||
| 1113 | 3004222860 | |||
| 1114 | 3004234940 | |||
| 1115 | 3004242085 | |||
| 1116 | 3004250345 | |||
| 1117 | 3004269034 | |||
| 1118 | 3004281218 | |||
| 1119 | 3004290926 | |||
| 1120 | 648737556 | |||
| 1121 | 649871057 | |||
| 1122 | 8003996518 | |||
| 1123 | 8004004280 | |||
| 1124 | 8004305167 | |||
| 1125 | 8004314661 | |||
| 1126 | 8004362531 | |||
| 1127 | 8004395405 | |||
| 1128 | 8004634012 | |||
| 1129 | 8004697383 | |||
| 1130 | 8004734235 | |||
| 1131 | 8005259213 | |||
| 1132 | 8005322375 | |||
| 1133 | 8005548193 | |||
| 1134 | 8054464647 | |||
| 1135 | 8055618448 | |||
| 1136 | 8056876385 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xru-assembly1.cif.gz_A | crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli | 0.9694 | 7 | 283 |
| 7yrs-assembly4.cif.gz_D | crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops | 0.9688 | 6 | 268 |
| 1ywk-assembly3.cif.gz_C | crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis | 0.9681 | 7 | 266 |
| 7ye3-assembly1.cif.gz_C | crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mes | 0.968 | 6 | 279 |
| 1ywk-assembly6.cif.gz_F | crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis | 0.9679 | 7 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9716 | 33 | 268 | 2.60.120.10 |
| 1ywkB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.968 | 6 | 266 | 2.60.120.10 |
| 1ywkB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9568 | 6 | 266 | 2.60.120.10 |
| 1x8mA02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.949 | 152 | 268 | 2.60.120.10 |
| af_Q46938_25_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9479 | 33 | 268 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526VBP8-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.9931 | 1 | 150 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A5J4SUE0-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.9918 | 6 | 121 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A484YH81-F1-model_v4 | 5-keto-4-deoxyuronate isomerase (EC 5.3.1.17) | 0.9913 | 74 | 147 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |
| AF-A0A351RGT4-F1-model_v4 | deleted | 0.9878 | 9 | 143 |
|
| AF-A0A526VBP8-F1-model_v4 | 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) | 0.9865 | 1 | 150 |
GO:0008697
GO:0019698 GO:0042840 GO:0045490 GO:0046872 |