F464792

General Info

Members Datasets Scaffolds Average Seq Length
570 247 1112 631

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100013904|Ga0068869_1000139042
Length 700
Sequence LTIIIKISTQGNAFLRNLKAVQVNNPCQSEGYLFEIKFCIYLCPHIPTESNLYQEPNISRVKIPTNRVTAAGLIIALGIIYGDIGTSPLYVMNEITTGKLINEELILGSLSCIIWTLTLQTTVKYVILTLRADNRGEGGIFSLYALVRRQKRWLVIPAMIGGASLIADGMITPPISVTSAVEGLRQIPIFHDITTWEIVYIVIGIITILFFLQQFGTASIGKLFGPIMTLWFLMLAILGTSHIFDDLEIFKAFSPHYAINLLTRYPNGFWLLGAVFLCTTGAEALYSDLGHCGKGNIRMSWIFVKTCLILCYLGQGAWLLHNYTGQTITPDMLSSGFHAFYGIMPDWFKIFGIVIATTAAEAMRLNLWPKLKISYPTEERGQLYVPGINFLLFFGCIGIVLYFRESSKMGAAYGLAITLCMIATSILFANFLISKRTKSSWIYLYLAVYFSIXXXFLFANLDKFKHGGYVTLIVGGALFGIMYVWYRSRKIKNRYVEFVRLEHYIPKIQELSADRGVAKYATHLVYLTSANNPKEIEHKIIYSILNKKPKRADIYWFVHVDTMDDPYTCEYKVDHIIPNDIIRVEFRLGFRTEPRINLMFRKVVEDLVQNMEVNITSRYESLASNNTVGDFQFMVMEKYLSQDNELPFFERVIMKLYFWIKEISLSEERGFGLDAANVTVEKFPLIVTPVTNLKLRRIED

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
160 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
202 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
205 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
213 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
214 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
215 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
216 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
219 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
220 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
233 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
234 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 2738541278 Niastella sp. CF465 Isolate Unclassified
245 2818991444 Filimonas endophytica 3197 Isolate Unclassified
246 2914759650 Rhizosphaericola mali Isolate Rhizosphere
247 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 0
Rhizoplane 0.18
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100013904 3300005334 Bacteria 5367
2 JGI24751J29686_10000380 3300002459 Bacteria 14955
3 JGI25406J46586_10003615 3300003203 Bacteria 7253
4 rootH2_10068132 3300003320 Bacteria 6364
5 rootL2_10127765 3300003322 Bacteria 6430
6 rootH1_10032979 3300003323 Bacteria 3795
7 rootH1_10170967 3300003323 Bacteria 3950
8 Ga0055535_1004479 3300003761 Bacteria 3379
9 Ga0055531_10000132 3300003794 Bacteria 85251
10 Ga0065714_10072281 3300005288 Bacteria 3396
11 Ga0065704_10089060 3300005289 Bacteria 2855
12 Ga0065712_10000839 3300005290 Bacteria 11700
13 Ga0065712_10082928 3300005290 Bacteria 2874
14 Ga0065715_10011933 3300005293 Unclassified 3288
15 Ga0065715_10090713 3300005293 Bacteria 6585
16 Ga0070658_10008028 3300005327 Bacteria 8489
17 Ga0070676_10000500 3300005328 Bacteria 18705
18 Ga0070683_100002310 3300005329 Bacteria 15119
19 Ga0070683_100024400 3300005329 Bacteria 5416
20 Ga0070683_100025557 3300005329 Bacteria 5305
21 Ga0070690_100023637 3300005330 Unclassified 3771
22 Ga0070690_100027776 3300005330 Bacteria 3500
23 Ga0070670_100019590 3300005331 Bacteria 5807
24 Ga0070670_100025266 3300005331 Bacteria 5111
25 Ga0070670_100031200 3300005331 Bacteria 4589
26 Ga0068869_100002414 3300005334 Bacteria 11262
27 Ga0068869_100006882 3300005334 Bacteria 7233
28 Ga0068869_100011660 3300005334 Bacteria 5774
29 Ga0070666_10000143 3300005335 Bacteria 48999
30 Ga0070666_10002377 3300005335 Bacteria 11374
31 Ga0070666_10003925 3300005335 Bacteria 9031
32 Ga0070682_100000005 3300005337 Bacteria 386439
33 Ga0070682_100000746 3300005337 Bacteria 19419
34 Ga0068868_100001434 3300005338 Bacteria 16445
35 Ga0068868_100002313 3300005338 Bacteria 13182
36 Ga0068868_100004031 3300005338 Bacteria 10239
37 Ga0070660_100000248 3300005339 Bacteria 35592
38 Ga0070660_100025601 3300005339 Bacteria 4386
39 Ga0070689_100110328 3300005340 Bacteria 2187
40 Ga0070691_10017645 3300005341 Bacteria 3284
41 Ga0070661_100003849 3300005344 Bacteria 10331
42 Ga0070661_100031001 3300005344 Unclassified 3865
43 Ga0070661_100076112 3300005344 Unclassified 2473
44 Ga0070668_100000150 3300005347 Bacteria 44112
45 Ga0070668_100013039 3300005347 Bacteria 6191
46 Ga0070669_100007578 3300005353 Bacteria 7768
47 Ga0070669_100091576 3300005353 Bacteria 2280
48 Ga0070669_100099282 3300005353 Bacteria 2194
49 Ga0070675_100011348 3300005354 Bacteria 6973
50 Ga0070675_100016725 3300005354 Bacteria 5823
51 Ga0070675_100024112 3300005354 Bacteria 4871
52 Ga0070675_100110537 3300005354 Bacteria 2324
53 Ga0070671_100037499 3300005355 Unclassified 4020
54 Ga0070671_100063553 3300005355 Bacteria 3074
55 Ga0070673_100006390 3300005364 Bacteria 7659
56 Ga0070673_100007234 3300005364 Bacteria 7303
57 Ga0070673_100010881 3300005364 Bacteria 6183
58 Ga0070673_100012133 3300005364 Bacteria 5906
59 Ga0070673_100017860 3300005364 Bacteria 5055
60 Ga0070673_100052424 3300005364 Bacteria 3201
61 Ga0070673_100093243 3300005364 Unclassified 2465
62 Ga0070688_100004101 3300005365 Bacteria 7559
63 Ga0070688_100011177 3300005365 Bacteria 4985
64 Ga0070688_100029537 3300005365 Unclassified 3283
65 Ga0070688_100053663 3300005365 Bacteria 2522
66 Ga0070659_100001755 3300005366 Bacteria 15575
67 Ga0070659_100006658 3300005366 Bacteria 8351
68 Ga0070667_100001725 3300005367 Bacteria 19543
69 Ga0070667_100025478 3300005367 Bacteria 4917
70 Ga0070667_100028636 3300005367 Bacteria 4638
71 Ga0070667_100092842 3300005367 Bacteria 2598
72 Ga0070700_100045667 3300005441 Unclassified 2703
73 Ga0070662_100001987 3300005457 Bacteria 12544
74 Ga0070662_100004186 3300005457 Bacteria 9092
75 Ga0070662_100006258 3300005457 Bacteria 7668
76 Ga0070662_100033701 3300005457 Bacteria 3608
77 Ga0070681_10014686 3300005458 Bacteria 7789
78 Ga0068867_100000958 3300005459 Bacteria 19652
79 Ga0070685_10026167 3300005466 Bacteria 3214
80 Ga0070698_100001014 3300005471 Bacteria 30868
81 Ga0070698_100001279 3300005471 Bacteria 28081
82 Ga0070698_100013621 3300005471 Bacteria 8610
83 Ga0070698_100021469 3300005471 Bacteria 6763
84 Ga0070698_100024918 3300005471 Bacteria 6236
85 Ga0070699_100032217 3300005518 Bacteria 4526
86 Ga0070679_100059242 3300005530 Bacteria 3817
87 Ga0070679_100081443 3300005530 Bacteria 3226
88 Ga0070684_100016932 3300005535 Bacteria 5971
89 Ga0070684_100021169 3300005535 Bacteria 5405
90 Ga0070684_100030161 3300005535 Bacteria 4605
91 Ga0070684_100097338 3300005535 Bacteria 2624
92 Ga0068853_100004666 3300005539 Bacteria 10625
93 Ga0068853_100010004 3300005539 Bacteria 7658
94 Ga0070672_100003106 3300005543 Bacteria 10718
95 Ga0070672_100029529 3300005543 Unclassified 4113
96 Ga0070672_100073226 3300005543 Bacteria 2730
97 Ga0070672_100074780 3300005543 Unclassified 2703
98 Ga0070665_100003408 3300005548 Bacteria 16991
99 Ga0070665_100074427 3300005548 Bacteria 3402
100 Ga0070665_100134363 3300005548 Bacteria 2475
101 Ga0068855_100028933 3300005563 Bacteria 6629
102 Ga0070664_100009170 3300005564 Bacteria 8033
103 Ga0070664_100018657 3300005564 Bacteria 5704
104 Ga0070664_100097004 3300005564 Bacteria 2559
105 Ga0068857_100023390 3300005577 Bacteria 5440
106 Ga0068857_100024726 3300005577 Bacteria 5290
107 Ga0068857_100118515 3300005577 Bacteria 2382
108 Ga0068856_100007365 3300005614 Bacteria 10739
109 Ga0068852_100006437 3300005616 Bacteria 8486
110 Ga0068852_100025417 3300005616 Bacteria 4799
111 Ga0068859_100000099 3300005617 Bacteria 80240
112 Ga0068859_100000990 3300005617 Bacteria 29074
113 Ga0068859_100009345 3300005617 Bacteria 9899
114 Ga0068859_100012427 3300005617 Bacteria 8568
115 Ga0068859_100038308 3300005617 Bacteria 4810
116 Ga0068859_100057430 3300005617 Bacteria 3920
117 Ga0068859_100089994 3300005617 Bacteria 3120
118 Ga0068859_100090109 3300005617 Unclassified 3117
119 Ga0068864_100000588 3300005618 Bacteria 30940
120 Ga0068864_100002481 3300005618 Bacteria 15238
121 Ga0068864_100008205 3300005618 Bacteria 8613
122 Ga0068864_100008709 3300005618 Bacteria 8369
123 Ga0068864_100028804 3300005618 Bacteria 4699
124 Ga0068861_100004816 3300005719 Bacteria 9073
125 Ga0068861_100039927 3300005719 Bacteria 3507
126 Ga0068851_10002549 3300005834 Bacteria 8017
127 Ga0068851_10037492 3300005834 Unclassified 2430
128 Ga0068863_100002137 3300005841 Bacteria 19611
129 Ga0068863_100018681 3300005841 Bacteria 6634
130 Ga0068863_100019797 3300005841 Bacteria 6436
131 Ga0068863_100026683 3300005841 Bacteria 5508
132 Ga0068863_100028608 3300005841 Bacteria 5321
133 Ga0068863_100031433 3300005841 Bacteria 5065
134 Ga0068863_100112290 3300005841 Bacteria 2595
135 Ga0068858_100003774 3300005842 Bacteria 14974
136 Ga0068858_100012065 3300005842 Bacteria 8142
137 Ga0068858_100023150 3300005842 Bacteria 5793
138 Ga0068860_100000252 3300005843 Bacteria 79891
139 Ga0068860_100006770 3300005843 Bacteria 11492
140 Ga0068860_100008273 3300005843 Bacteria 10354
141 Ga0068860_100009669 3300005843 Bacteria 9576
142 Ga0068860_100021509 3300005843 Bacteria 6246
143 Ga0068860_100052874 3300005843 Bacteria 3863
144 Ga0068860_100086154 3300005843 Bacteria 2989
145 Ga0068860_100107878 3300005843 Bacteria 2661
146 Ga0068862_100014657 3300005844 Bacteria 6511
147 Ga0081539_10001591 3300005985 Bacteria 37498
148 Ga0097621_100002450 3300006237 Bacteria 12708
149 Ga0097621_100005128 3300006237 Bacteria 9202
150 Ga0097621_100013501 3300006237 Bacteria 6090
151 Ga0068871_100001412 3300006358 Bacteria 16072
152 Ga0068871_100001627 3300006358 Bacteria 15132
153 Ga0068871_100004396 3300006358 Bacteria 9796
154 Ga0068871_100007569 3300006358 Bacteria 7770
155 Ga0068871_100010472 3300006358 Bacteria 6769
156 Ga0068871_100011586 3300006358 Bacteria 6471
157 Ga0068871_100027276 3300006358 Bacteria 4465
158 Ga0075428_100000685 3300006844 Bacteria 34851
159 Ga0075428_100000697 3300006844 Bacteria 34709
160 Ga0075428_100073265 3300006844 Bacteria 3740
161 Ga0075430_100017761 3300006846 Bacteria 6055
162 Ga0075430_100058703 3300006846 Bacteria 3235
163 Ga0075431_100007533 3300006847 Bacteria 10836
164 Ga0075431_100021809 3300006847 Bacteria 6548
165 Ga0075429_100004372 3300006880 Bacteria 12131
166 Ga0075429_100020789 3300006880 Bacteria 5698
167 Ga0075429_100023968 3300006880 Bacteria 5294
168 Ga0075429_100027364 3300006880 Bacteria 4949
169 Ga0075429_100033355 3300006880 Bacteria 4473
170 Ga0068865_100000270 3300006881 Bacteria 28438
171 Ga0068865_100072666 3300006881 Bacteria 2444
172 Ga0097620_100000099 3300006931 Bacteria 80240
173 Ga0097620_100000990 3300006931 Bacteria 29074
174 Ga0097620_100009345 3300006931 Bacteria 9899
175 Ga0097620_100012426 3300006931 Bacteria 8568
176 Ga0097620_100038308 3300006931 Bacteria 4810
177 Ga0097620_100057431 3300006931 Bacteria 3920
178 Ga0097620_100089991 3300006931 Bacteria 3120
179 Ga0097620_100090111 3300006931 Unclassified 3117
180 Ga0105240_10000431 3300009093 Bacteria 77497
181 Ga0105240_10009074 3300009093 Bacteria 14113
182 Ga0105240_10088621 3300009093 Bacteria 3786
183 Ga0111539_10002057 3300009094 Bacteria 26904
184 Ga0111539_10015066 3300009094 Bacteria 9636
185 Ga0111539_10195005 3300009094 Bacteria 2362
186 Ga0105247_10001414 3300009101 Bacteria 17416
187 Ga0105247_10051996 3300009101 Bacteria 2525
188 Ga0114129_10002037 3300009147 Bacteria 27713
189 Ga0114129_10015933 3300009147 Bacteria 10690
190 Ga0114129_10016983 3300009147 Bacteria 10361
191 Ga0114129_10089935 3300009147 Bacteria 4256
192 Ga0114129_10111327 3300009147 Bacteria 3778
193 Ga0105241_10001380 3300009174 Bacteria 18536
194 Ga0105241_10004335 3300009174 Bacteria 10497
195 Ga0105241_10063143 3300009174 Bacteria 2857
196 Ga0105242_10005557 3300009176 Bacteria 9728
197 Ga0105242_10015914 3300009176 Bacteria 5844
198 Ga0105242_10017146 3300009176 Bacteria 5639
199 Ga0105248_10098065 3300009177 Bacteria 3302
200 Ga0105237_10001023 3300009545 Bacteria 37620
201 Ga0105237_10001555 3300009545 Bacteria 29930
202 Ga0105249_10000298 3300009553 Bacteria 51006
203 Ga0105249_10001422 3300009553 Bacteria 20964
204 Ga0105249_10002214 3300009553 Bacteria 16849
205 Ga0105249_10004609 3300009553 Bacteria 11903
206 Ga0105249_10006091 3300009553 Bacteria 10457
207 Ga0105249_10007217 3300009553 Bacteria 9695
208 Ga0105249_10018379 3300009553 Bacteria 6217
209 Ga0105249_10024878 3300009553 Bacteria 5386
210 Ga0105249_10057375 3300009553 Bacteria 3567
211 Ga0105239_10005205 3300010375 Bacteria 15304
212 Ga0157373_10003080 3300013100 Bacteria 12592
213 Ga0157371_10002722 3300013102 Bacteria 16650
214 Ga0157371_10007055 3300013102 Bacteria 9142
215 Ga0157371_10012745 3300013102 Bacteria 6409
216 Ga0157371_10049774 3300013102 Bacteria 2976
217 Ga0157371_10051320 3300013102 Bacteria 2931
218 Ga0157371_10088132 3300013102 Bacteria 2197
219 Ga0157370_10000549 3300013104 Bacteria 46792
220 Ga0157370_10016694 3300013104 Bacteria 7430
221 Ga0157370_10121253 3300013104 Bacteria 2441
222 Ga0157369_10013269 3300013105 Bacteria 9323
223 Ga0157369_10121862 3300013105 Unclassified 2766
224 Ga0157374_10007085 3300013296 Bacteria 9546
225 Ga0157374_10027749 3300013296 Bacteria 5111
226 Ga0157378_10003064 3300013297 Bacteria 14860
227 Ga0157378_10004116 3300013297 Bacteria 12844
228 Ga0157378_10022851 3300013297 Bacteria 5504
229 Ga0157378_10031569 3300013297 Bacteria 4678
230 Ga0157378_10032846 3300013297 Bacteria 4587
231 Ga0157378_10038275 3300013297 Unclassified 4250
232 Ga0163162_10000994 3300013306 Bacteria 26396
233 Ga0163162_10001303 3300013306 Bacteria 23341
234 Ga0163162_10002632 3300013306 Bacteria 17022
235 Ga0163162_10007556 3300013306 Bacteria 10587
236 Ga0163162_10008560 3300013306 Bacteria 9974
237 Ga0163162_10031112 3300013306 Bacteria 5291
238 Ga0163162_10033805 3300013306 Bacteria 5083
239 Ga0163162_10042067 3300013306 Bacteria 4572
240 Ga0157372_10000651 3300013307 Bacteria 38151
241 Ga0157372_10025774 3300013307 Bacteria 6396
242 Ga0157372_10029917 3300013307 Bacteria 5951
243 Ga0157372_10050653 3300013307 Bacteria 4619
244 Ga0157372_10059031 3300013307 Bacteria 4290
245 Ga0157372_10070688 3300013307 Bacteria 3928
246 Ga0157372_10080000 3300013307 Bacteria 3697
247 Ga0157372_10109487 3300013307 Unclassified 3163
248 Ga0157372_10218973 3300013307 Bacteria 2207
249 Ga0157375_10011816 3300013308 Bacteria 7720
250 Ga0157375_10012214 3300013308 Bacteria 7614
251 Ga0157375_10020065 3300013308 Bacteria 6098
252 Ga0157375_10022313 3300013308 Bacteria 5825
253 Ga0157375_10022585 3300013308 Bacteria 5792
254 Ga0157375_10073272 3300013308 Bacteria 3443
255 Ga0157375_10095416 3300013308 Bacteria 3045
256 Ga0163163_10001079 3300014325 Bacteria 23132
257 Ga0163163_10001603 3300014325 Bacteria 19013
258 Ga0163163_10001726 3300014325 Bacteria 18422
259 Ga0163163_10005895 3300014325 Bacteria 10664
260 Ga0163163_10024424 3300014325 Bacteria 5753
261 Ga0163163_10105724 3300014325 Bacteria 2840
262 Ga0163163_10120343 3300014325 Unclassified 2659
263 Ga0157380_10003952 3300014326 Bacteria 10234
264 Ga0157380_10015999 3300014326 Bacteria 5523
265 Ga0157377_10000417 3300014745 Bacteria 18428
266 Ga0157377_10004298 3300014745 Bacteria 6535
267 Ga0157377_10020388 3300014745 Bacteria 3472
268 Ga0157379_10020384 3300014968 Bacteria 5861
269 Ga0157379_10025152 3300014968 Bacteria 5285
270 Ga0157376_10000249 3300014969 Bacteria 37241
271 Ga0157376_10000404 3300014969 Bacteria 28086
272 Ga0157376_10002842 3300014969 Bacteria 11849
273 Ga0182005_1000116 3300015265 Bacteria 57638
274 Ga0163161_10005954 3300017792 Bacteria 8455
275 Ga0163161_10042391 3300017792 Bacteria 3273
276 Ga0213876_10002938 3300021384 Bacteria 9872
277 Ga0209436_100740 3300025208 Bacteria 13623
278 Ga0209258_100075 3300025242 Bacteria 270751
279 Ga0209148_1000085 3300025254 Bacteria 265193
280 Ga0207426_1000009 3300025302 Bacteria 797229
281 Ga0207426_1003254 3300025302 Bacteria 9095
282 Ga0209257_1000004 3300025304 Bacteria 1678347
283 Ga0207710_10000837 3300025900 Bacteria 16584
284 Ga0207710_10033063 3300025900 Bacteria 2267
285 Ga0207688_10026198 3300025901 Unclassified 3204
286 Ga0207680_10001105 3300025903 Bacteria 12710
287 Ga0207680_10005751 3300025903 Bacteria 5945
288 Ga0207680_10024364 3300025903 Bacteria 3321
289 Ga0207647_10000017 3300025904 Bacteria 129999
290 Ga0207647_10035835 3300025904 Unclassified 3158
291 Ga0207645_10001542 3300025907 Bacteria 18824
292 Ga0207645_10008095 3300025907 Bacteria 7371
293 Ga0207645_10014232 3300025907 Bacteria 5329
294 Ga0207645_10028348 3300025907 Bacteria 3615
295 Ga0207643_10007753 3300025908 Bacteria 5767
296 Ga0207643_10009602 3300025908 Bacteria 5196
297 Ga0207643_10016869 3300025908 Bacteria 3984
298 Ga0207705_10002989 3300025909 Bacteria 12903
299 Ga0207654_10003449 3300025911 Bacteria 7996
300 Ga0207695_10001519 3300025913 Bacteria 38506
301 Ga0207695_10022792 3300025913 Bacteria 7094
302 Ga0207671_10003880 3300025914 Bacteria 14605
303 Ga0207657_10025426 3300025919 Bacteria 5462
304 Ga0207657_10061217 3300025919 Bacteria 3228
305 Ga0207657_10067268 3300025919 Bacteria 3047
306 Ga0207652_10110580 3300025921 Bacteria 2436
307 Ga0207681_10078669 3300025923 Bacteria 2321
308 Ga0207650_10005812 3300025925 Bacteria 8418
309 Ga0207659_10006887 3300025926 Bacteria 6989
310 Ga0207659_10024873 3300025926 Unclassified 4019
311 Ga0207659_10028801 3300025926 Bacteria 3777
312 Ga0207659_10036527 3300025926 Unclassified 3404
313 Ga0207659_10042161 3300025926 Bacteria 3198
314 Ga0207644_10078077 3300025931 Bacteria 2440
315 Ga0207690_10066683 3300025932 Bacteria 2466
316 Ga0207706_10001127 3300025933 Bacteria 27189
317 Ga0207706_10003824 3300025933 Bacteria 14344
318 Ga0207706_10005398 3300025933 Bacteria 11913
319 Ga0207706_10052237 3300025933 Bacteria 3608
320 Ga0207706_10153094 3300025933 Bacteria 2028
321 Ga0207686_10000379 3300025934 Bacteria 30995
322 Ga0207686_10000722 3300025934 Bacteria 20514
323 Ga0207686_10011222 3300025934 Bacteria 4900
324 Ga0207670_10060106 3300025936 Bacteria 2588
325 Ga0207704_10000721 3300025938 Bacteria 14511
326 Ga0207704_10070750 3300025938 Unclassified 2211
327 Ga0207691_10000012 3300025940 Bacteria 147942
328 Ga0207691_10023232 3300025940 Bacteria 5838
329 Ga0207691_10038930 3300025940 Bacteria 4400
330 Ga0207691_10039030 3300025940 Unclassified 4394
331 Ga0207691_10099412 3300025940 Bacteria 2598
332 Ga0207711_10080913 3300025941 Bacteria 2838
333 Ga0207689_10001163 3300025942 Bacteria 25336
334 Ga0207689_10004939 3300025942 Bacteria 12012
335 Ga0207689_10005694 3300025942 Bacteria 11078
336 Ga0207689_10011346 3300025942 Bacteria 7643
337 Ga0207661_10011493 3300025944 Bacteria 6418
338 Ga0207661_10044596 3300025944 Bacteria 3505
339 Ga0207679_10008446 3300025945 Bacteria 6558
340 Ga0207667_10010666 3300025949 Bacteria 10725
341 Ga0207667_10097036 3300025949 Bacteria 3042
342 Ga0207667_10167577 3300025949 Bacteria 2258
343 Ga0207651_10002226 3300025960 Bacteria 9186
344 Ga0207651_10003485 3300025960 Bacteria 7731
345 Ga0207651_10060358 3300025960 Bacteria 2632
346 Ga0207712_10000844 3300025961 Bacteria 22396
347 Ga0207712_10006411 3300025961 Bacteria 7424
348 Ga0207712_10007258 3300025961 Bacteria 6986
349 Ga0207712_10009186 3300025961 Bacteria 6260
350 Ga0207712_10012396 3300025961 Bacteria 5446
351 Ga0207712_10025087 3300025961 Bacteria 3957
352 Ga0207712_10060342 3300025961 Bacteria 2688
353 Ga0207668_10063616 3300025972 Bacteria 2603
354 Ga0207658_10001321 3300025986 Bacteria 19445
355 Ga0207658_10034357 3300025986 Bacteria 3624
356 Ga0207658_10038478 3300025986 Bacteria 3446
357 Ga0207658_10047478 3300025986 Bacteria 3143
358 Ga0207677_10004086 3300026023 Bacteria 7803
359 Ga0207677_10069610 3300026023 Bacteria 2475
360 Ga0207703_10006747 3300026035 Bacteria 9153
361 Ga0207639_10002744 3300026041 Bacteria 11815
362 Ga0207639_10010138 3300026041 Bacteria 6518
363 Ga0207639_10065269 3300026041 Bacteria 2825
364 Ga0207639_10089070 3300026041 Bacteria 2465
365 Ga0207678_10015818 3300026067 Bacteria 6632
366 Ga0207641_10000133 3300026088 Bacteria 109199
367 Ga0207641_10000783 3300026088 Bacteria 33947
368 Ga0207641_10006390 3300026088 Bacteria 9936
369 Ga0207641_10008257 3300026088 Bacteria 8605
370 Ga0207641_10038424 3300026088 Bacteria 4001
371 Ga0207648_10000394 3300026089 Bacteria 48433
372 Ga0207648_10001120 3300026089 Bacteria 30104
373 Ga0207648_10007711 3300026089 Bacteria 10527
374 Ga0207648_10053118 3300026089 Bacteria 3542
375 Ga0207648_10072256 3300026089 Bacteria 3007
376 Ga0207676_10007555 3300026095 Bacteria 7712
377 Ga0207676_10007733 3300026095 Bacteria 7644
378 Ga0207676_10013807 3300026095 Bacteria 5799
379 Ga0207674_10005366 3300026116 Bacteria 15246
380 Ga0207674_10008871 3300026116 Bacteria 11566
381 Ga0207674_10097286 3300026116 Bacteria 2927
382 Ga0207675_100010149 3300026118 Bacteria 8827
383 Ga0207675_100022290 3300026118 Bacteria 5897
384 Ga0207683_10018567 3300026121 Bacteria 5935
385 Ga0207683_10024076 3300026121 Bacteria 5240
386 Ga0207683_10038940 3300026121 Bacteria 4146
387 Ga0207683_10090641 3300026121 Bacteria 2723
388 Ga0207683_10148375 3300026121 Unclassified 2116
389 Ga0207698_10030148 3300026142 Bacteria 3896
390 Ga0207698_10038579 3300026142 Bacteria 3531
391 Ga0209974_10016047 3300027876 Unclassified 2486
392 Ga0207428_10054240 3300027907 Unclassified 3193
393 Ga0268266_10121324 3300028379 Bacteria 2326
394 Ga0268264_10000015 3300028381 Bacteria 508501
395 Ga0268264_10000019 3300028381 Bacteria 488112
396 Ga0268264_10000054 3300028381 Bacteria 317048
397 Ga0268264_10008928 3300028381 Bacteria 8317
398 Ga0268264_10010334 3300028381 Bacteria 7721
399 Ga0307515_10000001 3300028794 Bacteria 4259510
400 Ga0307515_10000024 3300028794 Bacteria 393119
401 Ga0265327_10000051 3300031251 Bacteria 257963
402 Ga0265327_10000059 3300031251 Bacteria 236935
403 Ga0307513_10067737 3300031456 Bacteria 3743
404 Ga0307509_10056327 3300031507 Bacteria 4173
405 Ga0307509_10097386 3300031507 Bacteria 2990
406 Ga0307508_10000162 3300031616 Bacteria 80675
407 Ga0307405_10052828 3300031731 Bacteria 2529
408 Ga0307414_10001588 3300032004 Bacteria 11789
409 Ga0307510_10003234 3300033180 Bacteria 18935
410 Ga0395899_0000021 3300037312 Bacteria 391702
411 Ga0395899_0000528 3300037312 Bacteria 41982
412 Ga0395900_0003233 3300037418 Bacteria 17638
413 Ga0395900_0025640 3300037418 Bacteria 6035
414 Ga0395900_0148932 3300037418 Bacteria 2392
415 Ga0395898_0000595 3300037466 Bacteria 67162
416 Ga0395905_0000001 3300037471 Bacteria 2037079
417 Ga0395905_0001924 3300037471 Bacteria 23839
418 Ga0395905_0013062 3300037471 Bacteria 7976
419 Ga0395905_0031821 3300037471 Bacteria 4964
420 Ga0395901_0001672 3300038443 Bacteria 22890
421 Ga0436365_0427875 3300039437 Bacteria 8704
422 Ga0436365_1245659 3300039437 Bacteria 14982
423 Ga0439436_0001090 3300041404 Bacteria 7651
424 Ga0439443_003513 3300042003 Unclassified 1981
425 Ga0439445_0009570 3300042004 Bacteria 2286
426 Ga0439457_000054 3300042014 Bacteria 23780
427 Ga0439462_0002538 3300042015 Bacteria 4256
428 Ga0439434_0003457 3300042435 Bacteria 4615
429 Ga0451577_0010855 3300042876 Bacteria 8655
430 Ga0466969_0003430 3300044656 Bacteria 8431
431 Ga0466972_0000032 3300044658 Bacteria 159445
432 Ga0466972_0000205 3300044658 Bacteria 43008
433 Ga0466972_0002109 3300044658 Bacteria 9755
434 Ga0466966_0000054 3300044684 Bacteria 82352
435 Ga0453684_0000311 3300044712 Bacteria 206847
436 Ga0453684_0018451 3300044712 Bacteria 10708
437 Ga0453684_0046530 3300044712 Bacteria 5769
438 Ga0466968_0020441 3300044735 Bacteria 2673
439 Ga0466970_0000844 3300044765 Bacteria 14756
440 Ga0466957_0000656 3300044842 Bacteria 17549
441 Ga0466957_0004005 3300044842 Bacteria 8147
442 Ga0466959_0000012 3300045049 Bacteria 168961
443 Ga0466959_0017923 3300045049 Bacteria 5195
444 Ga0495606_0021636 3300046507 Bacteria 4705
445 Ga0495648_0000493 3300046524 Bacteria 42504
446 Ga0495598_0004348 3300046537 Bacteria 3061
447 Ga0495621_0008439 3300046539 Bacteria 3090
448 Ga0495668_0000106 3300046616 Bacteria 133476
449 Ga0495649_0045691 3300046694 Bacteria 2387
450 Ga0495672_0010538 3300047320 Bacteria 6577
451 Ga0495672_0024588 3300047320 Bacteria 3876
452 Ga0495687_000031 3300047443 Bacteria 274659
453 Ga0495686_0015245 3300047472 Bacteria 5258
454 Ga0495686_0049291 3300047472 Bacteria 2650
455 Ga0495686_0075985 3300047472 Bacteria 2059
456 Ga0496114_0029105 3300048917 Unclassified 4537
457 Ga0496124_0062985 3300048927 Bacteria 3101
458 Ga0496126_0015990 3300048929 Bacteria 7525
459 Ga0501298_003474 3300049521 Bacteria 2440
460 Ga0501032_0005230 3300049569 Bacteria 9661
461 Ga0501032_0010226 3300049569 Bacteria 6771
462 Ga0501034_0004635 3300049571 Bacteria 15228
463 Ga0501034_0020155 3300049571 Bacteria 6807
464 Ga0501034_0044656 3300049571 Bacteria 4480
465 Ga0501034_0166936 3300049571 Bacteria 2169
466 Ga0501036_0011069 3300049572 Bacteria 7459
467 Ga0501036_0032480 3300049572 Unclassified 4410
468 Ga0501036_0108379 3300049572 Bacteria 2348
469 Ga0501037_0016109 3300049573 Bacteria 5502
470 Ga0501038_0015399 3300049574 Bacteria 6952
471 Ga0501038_0031789 3300049574 Bacteria 4662
472 Ga0501038_0034161 3300049574 Bacteria 4474
473 Ga0501038_0067729 3300049574 Unclassified 3036
474 Ga0501039_0001372 3300049575 Bacteria 17881
475 Ga0501040_0079084 3300049576 Bacteria 2276
476 Ga0501043_0010222 3300049579 Bacteria 7355
477 Ga0501043_0014209 3300049579 Bacteria 6230
478 Ga0501046_0023434 3300049580 Bacteria 5079
479 Ga0501046_0030095 3300049580 Unclassified 4409
480 Ga0501047_0003414 3300049581 Bacteria 15035
481 Ga0501047_0009295 3300049581 Bacteria 9283
482 Ga0501047_0121996 3300049581 Bacteria 2488
483 Ga0501048_0018263 3300049582 Bacteria 5159
484 Ga0501067_0037685 3300049583 Unclassified 2685
485 Ga0501068_0026397 3300049584 Unclassified 3422
486 Ga0501073_0006622 3300049589 Bacteria 8625
487 Ga0501198_000545 3300049649 Bacteria 4679
488 Ga0501201_000191 3300049651 Bacteria 5387
489 Ga0501202_000029 3300049652 Bacteria 14302
490 Ga0501202_000563 3300049652 Bacteria 5384
491 Ga0501206_001916 3300049653 Bacteria 2616
492 Ga0501207_002068 3300049654 Bacteria 2565
493 Ga0501217_000131 3300049661 Bacteria 10001
494 Ga0501217_000406 3300049661 Bacteria 6959
495 Ga0501222_001901 3300049662 Bacteria 2898
496 Ga0501222_003146 3300049662 Bacteria 2267
497 Ga0501223_007972 3300049663 Bacteria 2160
498 Ga0501224_000214 3300049664 Bacteria 6592
499 Ga0501224_003773 3300049664 Bacteria 2130
500 Ga0501233_001507 3300049668 Bacteria 3974
501 Ga0501233_008416 3300049668 Bacteria 1988
502 Ga0501235_005471 3300049669 Bacteria 2764
503 Ga0501257_005310 3300049686 Bacteria 2833
504 Ga0501259_000109 3300049688 Bacteria 11986
505 Ga0501261_000626 3300049690 Bacteria 4483
506 Ga0501219_000235 3300049703 Bacteria 10559
507 Ga0501221_000490 3300049704 Bacteria 6228
508 Ga0501225_0003122 3300049705 Bacteria 5063
509 Ga0501225_0003159 3300049705 Bacteria 5032
510 Ga0501225_0003261 3300049705 Bacteria 4952
511 Ga0501245_002150 3300049708 Bacteria 2621
512 Ga0501232_001310 3300049757 Unclassified 1951
513 Ga0501266_001381 3300049763 Bacteria 3098
514 Ga0501035_0009960 3300049822 Bacteria 8823
515 Ga0501035_0012125 3300049822 Bacteria 7970
516 Ga0501035_0077803 3300049822 Bacteria 2931
517 Ga0501044_0003510 3300049823 Bacteria 17649
518 Ga0501044_0013869 3300049823 Bacteria 8710
519 Ga0501044_0024700 3300049823 Bacteria 6375
520 Ga0501044_0098721 3300049823 Bacteria 2940
521 Ga0501045_0037644 3300049824 Unclassified 3517
522 Ga0501284_00015 3300050005 Bacteria 104438
523 nmdc:mga05p37_115681_c1 3300050507 Bacteria 3296
524 nmdc:mga05p37_116536_c1 3300050507 Bacteria 3283
525 nmdc:mga05p37_51420_c1 3300050507 Bacteria 5067
526 nmdc:mga09592_13413_c1 3300050508 Bacteria 6689
527 nmdc:mga09592_22135_c1 3300050508 Bacteria 5244
528 nmdc:mga09592_3966_c1 3300050508 Bacteria 11924
529 nmdc:mga06r32_120459_c1 3300050510 Unclassified 2588
530 nmdc:mga06r32_24351_c1 3300050510 Bacteria 5616
531 nmdc:mga06r32_79186_c1 3300050510 Bacteria 3196
532 nmdc:mga08y16_41950_c1 3300050511 Unclassified 4792
533 Ga0500578_0000001 3300053086 Bacteria 317120
534 Ga0500644_0000078 3300053088 Bacteria 59447
535 Ga0500644_0001876 3300053088 Bacteria 5416
536 Ga0500646_0000911 3300053090 Bacteria 8156
537 Ga0500583_0000048 3300053092 Bacteria 78503
538 Ga0500583_0001230 3300053092 Bacteria 7330
539 Ga0500583_0011913 3300053092 Bacteria 3298
540 Ga0500562_000080 3300053108 Bacteria 43341
541 Ga0500569_001259 3300053109 Bacteria 4727
542 Ga0500652_008523 3300053131 Bacteria 3421
543 Ga0500658_0001268 3300053134 Bacteria 10241
544 Ga0500568_0000325 3300053139 Bacteria 37538
545 Ga0500590_011223 3300053148 Bacteria 4536
546 Ga0500616_0003988 3300053153 Bacteria 10783
547 Ga0500622_0000176 3300053156 Bacteria 69125
548 Ga0500622_0000677 3300053156 Bacteria 30106
549 Ga0500636_0026221 3300053177 Bacteria 3445
550 Ga0500611_000029 3300053727 Bacteria 89288
551 Ga0500611_000094 3300053727 Bacteria 25623
552 Ga0501084_0161138 3300054114 Bacteria 1892
553 2738728870 2738541278 Bacteria 9755573
554 2819587863 2818991444 Bacteria 6968812
555 2914759898 2914759650 Bacteria 4701441
556 2929158110 2929154850 Bacteria 6753285
557 Ga0068869_100013904
558 JGI24751J29686_10000380
559 JGI25406J46586_10003615
560 rootH2_10068132
561 rootL2_10127765
562 rootH1_10032979
563 rootH1_10170967
564 Ga0055535_1004479
565 Ga0055531_10000132
566 Ga0065714_10072281
567 Ga0065704_10089060
568 Ga0065712_10000839
569 Ga0065712_10082928
570 Ga0065715_10011933
571 Ga0065715_10090713
572 Ga0070658_10008028
573 Ga0070676_10000500
574 Ga0070683_100002310
575 Ga0070683_100024400
576 Ga0070683_100025557
577 Ga0070690_100023637
578 Ga0070690_100027776
579 Ga0070670_100019590
580 Ga0070670_100025266
581 Ga0070670_100031200
582 Ga0068869_100002414
583 Ga0068869_100006882
584 Ga0068869_100011660
585 Ga0070666_10000143
586 Ga0070666_10002377
587 Ga0070666_10003925
588 Ga0070682_100000005
589 Ga0070682_100000746
590 Ga0068868_100001434
591 Ga0068868_100002313
592 Ga0068868_100004031
593 Ga0070660_100000248
594 Ga0070660_100025601
595 Ga0070689_100110328
596 Ga0070691_10017645
597 Ga0070661_100003849
598 Ga0070661_100031001
599 Ga0070661_100076112
600 Ga0070668_100000150
601 Ga0070668_100013039
602 Ga0070669_100007578
603 Ga0070669_100091576
604 Ga0070669_100099282
605 Ga0070675_100011348
606 Ga0070675_100016725
607 Ga0070675_100024112
608 Ga0070675_100110537
609 Ga0070671_100037499
610 Ga0070671_100063553
611 Ga0070673_100006390
612 Ga0070673_100007234
613 Ga0070673_100010881
614 Ga0070673_100012133
615 Ga0070673_100017860
616 Ga0070673_100052424
617 Ga0070673_100093243
618 Ga0070688_100004101
619 Ga0070688_100011177
620 Ga0070688_100029537
621 Ga0070688_100053663
622 Ga0070659_100001755
623 Ga0070659_100006658
624 Ga0070667_100001725
625 Ga0070667_100025478
626 Ga0070667_100028636
627 Ga0070667_100092842
628 Ga0070700_100045667
629 Ga0070662_100001987
630 Ga0070662_100004186
631 Ga0070662_100006258
632 Ga0070662_100033701
633 Ga0070681_10014686
634 Ga0068867_100000958
635 Ga0070685_10026167
636 Ga0070698_100001014
637 Ga0070698_100001279
638 Ga0070698_100013621
639 Ga0070698_100021469
640 Ga0070698_100024918
641 Ga0070699_100032217
642 Ga0070679_100059242
643 Ga0070679_100081443
644 Ga0070684_100016932
645 Ga0070684_100021169
646 Ga0070684_100030161
647 Ga0070684_100097338
648 Ga0068853_100004666
649 Ga0068853_100010004
650 Ga0070672_100003106
651 Ga0070672_100029529
652 Ga0070672_100073226
653 Ga0070672_100074780
654 Ga0070665_100003408
655 Ga0070665_100074427
656 Ga0070665_100134363
657 Ga0068855_100028933
658 Ga0070664_100009170
659 Ga0070664_100018657
660 Ga0070664_100097004
661 Ga0068857_100023390
662 Ga0068857_100024726
663 Ga0068857_100118515
664 Ga0068856_100007365
665 Ga0068852_100006437
666 Ga0068852_100025417
667 Ga0068859_100000099
668 Ga0068859_100000990
669 Ga0068859_100009345
670 Ga0068859_100012427
671 Ga0068859_100038308
672 Ga0068859_100057430
673 Ga0068859_100089994
674 Ga0068859_100090109
675 Ga0068864_100000588
676 Ga0068864_100002481
677 Ga0068864_100008205
678 Ga0068864_100008709
679 Ga0068864_100028804
680 Ga0068861_100004816
681 Ga0068861_100039927
682 Ga0068851_10002549
683 Ga0068851_10037492
684 Ga0068863_100002137
685 Ga0068863_100018681
686 Ga0068863_100019797
687 Ga0068863_100026683
688 Ga0068863_100028608
689 Ga0068863_100031433
690 Ga0068863_100112290
691 Ga0068858_100003774
692 Ga0068858_100012065
693 Ga0068858_100023150
694 Ga0068860_100000252
695 Ga0068860_100006770
696 Ga0068860_100008273
697 Ga0068860_100009669
698 Ga0068860_100021509
699 Ga0068860_100052874
700 Ga0068860_100086154
701 Ga0068860_100107878
702 Ga0068862_100014657
703 Ga0081539_10001591
704 Ga0097621_100002450
705 Ga0097621_100005128
706 Ga0097621_100013501
707 Ga0068871_100001412
708 Ga0068871_100001627
709 Ga0068871_100004396
710 Ga0068871_100007569
711 Ga0068871_100010472
712 Ga0068871_100011586
713 Ga0068871_100027276
714 Ga0075428_100000685
715 Ga0075428_100000697
716 Ga0075428_100073265
717 Ga0075430_100017761
718 Ga0075430_100058703
719 Ga0075431_100007533
720 Ga0075431_100021809
721 Ga0075429_100004372
722 Ga0075429_100020789
723 Ga0075429_100023968
724 Ga0075429_100027364
725 Ga0075429_100033355
726 Ga0068865_100000270
727 Ga0068865_100072666
728 Ga0097620_100000099
729 Ga0097620_100000990
730 Ga0097620_100009345
731 Ga0097620_100012426
732 Ga0097620_100038308
733 Ga0097620_100057431
734 Ga0097620_100089991
735 Ga0097620_100090111
736 Ga0105240_10000431
737 Ga0105240_10009074
738 Ga0105240_10088621
739 Ga0111539_10002057
740 Ga0111539_10015066
741 Ga0111539_10195005
742 Ga0105247_10001414
743 Ga0105247_10051996
744 Ga0114129_10002037
745 Ga0114129_10015933
746 Ga0114129_10016983
747 Ga0114129_10089935
748 Ga0114129_10111327
749 Ga0105241_10001380
750 Ga0105241_10004335
751 Ga0105241_10063143
752 Ga0105242_10005557
753 Ga0105242_10015914
754 Ga0105242_10017146
755 Ga0105248_10098065
756 Ga0105237_10001023
757 Ga0105237_10001555
758 Ga0105249_10000298
759 Ga0105249_10001422
760 Ga0105249_10002214
761 Ga0105249_10004609
762 Ga0105249_10006091
763 Ga0105249_10007217
764 Ga0105249_10018379
765 Ga0105249_10024878
766 Ga0105249_10057375
767 Ga0105239_10005205
768 Ga0157373_10003080
769 Ga0157371_10002722
770 Ga0157371_10007055
771 Ga0157371_10012745
772 Ga0157371_10049774
773 Ga0157371_10051320
774 Ga0157371_10088132
775 Ga0157370_10000549
776 Ga0157370_10016694
777 Ga0157370_10121253
778 Ga0157369_10013269
779 Ga0157369_10121862
780 Ga0157374_10007085
781 Ga0157374_10027749
782 Ga0157378_10003064
783 Ga0157378_10004116
784 Ga0157378_10022851
785 Ga0157378_10031569
786 Ga0157378_10032846
787 Ga0157378_10038275
788 Ga0163162_10000994
789 Ga0163162_10001303
790 Ga0163162_10002632
791 Ga0163162_10007556
792 Ga0163162_10008560
793 Ga0163162_10031112
794 Ga0163162_10033805
795 Ga0163162_10042067
796 Ga0157372_10000651
797 Ga0157372_10025774
798 Ga0157372_10029917
799 Ga0157372_10050653
800 Ga0157372_10059031
801 Ga0157372_10070688
802 Ga0157372_10080000
803 Ga0157372_10109487
804 Ga0157372_10218973
805 Ga0157375_10011816
806 Ga0157375_10012214
807 Ga0157375_10020065
808 Ga0157375_10022313
809 Ga0157375_10022585
810 Ga0157375_10073272
811 Ga0157375_10095416
812 Ga0163163_10001079
813 Ga0163163_10001603
814 Ga0163163_10001726
815 Ga0163163_10005895
816 Ga0163163_10024424
817 Ga0163163_10105724
818 Ga0163163_10120343
819 Ga0157380_10003952
820 Ga0157380_10015999
821 Ga0157377_10000417
822 Ga0157377_10004298
823 Ga0157377_10020388
824 Ga0157379_10020384
825 Ga0157379_10025152
826 Ga0157376_10000249
827 Ga0157376_10000404
828 Ga0157376_10002842
829 Ga0182005_1000116
830 Ga0163161_10005954
831 Ga0163161_10042391
832 Ga0213876_10002938
833 Ga0209436_100740
834 Ga0209258_100075
835 Ga0209148_1000085
836 Ga0207426_1000009
837 Ga0207426_1003254
838 Ga0209257_1000004
839 Ga0207710_10000837
840 Ga0207710_10033063
841 Ga0207688_10026198
842 Ga0207680_10001105
843 Ga0207680_10005751
844 Ga0207680_10024364
845 Ga0207647_10000017
846 Ga0207647_10035835
847 Ga0207645_10001542
848 Ga0207645_10008095
849 Ga0207645_10014232
850 Ga0207645_10028348
851 Ga0207643_10007753
852 Ga0207643_10009602
853 Ga0207643_10016869
854 Ga0207705_10002989
855 Ga0207654_10003449
856 Ga0207695_10001519
857 Ga0207695_10022792
858 Ga0207671_10003880
859 Ga0207657_10025426
860 Ga0207657_10061217
861 Ga0207657_10067268
862 Ga0207652_10110580
863 Ga0207681_10078669
864 Ga0207650_10005812
865 Ga0207659_10006887
866 Ga0207659_10024873
867 Ga0207659_10028801
868 Ga0207659_10036527
869 Ga0207659_10042161
870 Ga0207644_10078077
871 Ga0207690_10066683
872 Ga0207706_10001127
873 Ga0207706_10003824
874 Ga0207706_10005398
875 Ga0207706_10052237
876 Ga0207706_10153094
877 Ga0207686_10000379
878 Ga0207686_10000722
879 Ga0207686_10011222
880 Ga0207670_10060106
881 Ga0207704_10000721
882 Ga0207704_10070750
883 Ga0207691_10000012
884 Ga0207691_10023232
885 Ga0207691_10038930
886 Ga0207691_10039030
887 Ga0207691_10099412
888 Ga0207711_10080913
889 Ga0207689_10001163
890 Ga0207689_10004939
891 Ga0207689_10005694
892 Ga0207689_10011346
893 Ga0207661_10011493
894 Ga0207661_10044596
895 Ga0207679_10008446
896 Ga0207667_10010666
897 Ga0207667_10097036
898 Ga0207667_10167577
899 Ga0207651_10002226
900 Ga0207651_10003485
901 Ga0207651_10060358
902 Ga0207712_10000844
903 Ga0207712_10006411
904 Ga0207712_10007258
905 Ga0207712_10009186
906 Ga0207712_10012396
907 Ga0207712_10025087
908 Ga0207712_10060342
909 Ga0207668_10063616
910 Ga0207658_10001321
911 Ga0207658_10034357
912 Ga0207658_10038478
913 Ga0207658_10047478
914 Ga0207677_10004086
915 Ga0207677_10069610
916 Ga0207703_10006747
917 Ga0207639_10002744
918 Ga0207639_10010138
919 Ga0207639_10065269
920 Ga0207639_10089070
921 Ga0207678_10015818
922 Ga0207641_10000133
923 Ga0207641_10000783
924 Ga0207641_10006390
925 Ga0207641_10008257
926 Ga0207641_10038424
927 Ga0207648_10000394
928 Ga0207648_10001120
929 Ga0207648_10007711
930 Ga0207648_10053118
931 Ga0207648_10072256
932 Ga0207676_10007555
933 Ga0207676_10007733
934 Ga0207676_10013807
935 Ga0207674_10005366
936 Ga0207674_10008871
937 Ga0207674_10097286
938 Ga0207675_100010149
939 Ga0207675_100022290
940 Ga0207683_10018567
941 Ga0207683_10024076
942 Ga0207683_10038940
943 Ga0207683_10090641
944 Ga0207683_10148375
945 Ga0207698_10030148
946 Ga0207698_10038579
947 Ga0209974_10016047
948 Ga0207428_10054240
949 Ga0268266_10121324
950 Ga0268264_10000015
951 Ga0268264_10000019
952 Ga0268264_10000054
953 Ga0268264_10008928
954 Ga0268264_10010334
955 Ga0307515_10000001
956 Ga0307515_10000024
957 Ga0265327_10000051
958 Ga0265327_10000059
959 Ga0307513_10067737
960 Ga0307509_10056327
961 Ga0307509_10097386
962 Ga0307508_10000162
963 Ga0307405_10052828
964 Ga0307414_10001588
965 Ga0307510_10003234
966 Ga0395899_0000021
967 Ga0395899_0000528
968 Ga0395900_0003233
969 Ga0395900_0025640
970 Ga0395900_0148932
971 Ga0395898_0000595
972 Ga0395905_0000001
973 Ga0395905_0001924
974 Ga0395905_0013062
975 Ga0395905_0031821
976 Ga0395901_0001672
977 Ga0436365_0427875
978 Ga0436365_1245659
979 Ga0439436_0001090
980 Ga0439443_003513
981 Ga0439445_0009570
982 Ga0439457_000054
983 Ga0439462_0002538
984 Ga0439434_0003457
985 Ga0451577_0010855
986 Ga0466969_0003430
987 Ga0466972_0000032
988 Ga0466972_0000205
989 Ga0466972_0002109
990 Ga0466966_0000054
991 Ga0453684_0000311
992 Ga0453684_0018451
993 Ga0453684_0046530
994 Ga0466968_0020441
995 Ga0466970_0000844
996 Ga0466957_0000656
997 Ga0466957_0004005
998 Ga0466959_0000012
999 Ga0466959_0017923
1000 Ga0495606_0021636
1001 Ga0495648_0000493
1002 Ga0495598_0004348
1003 Ga0495621_0008439
1004 Ga0495668_0000106
1005 Ga0495649_0045691
1006 Ga0495672_0010538
1007 Ga0495672_0024588
1008 Ga0495687_000031
1009 Ga0495686_0015245
1010 Ga0495686_0049291
1011 Ga0495686_0075985
1012 Ga0496114_0029105
1013 Ga0496124_0062985
1014 Ga0496126_0015990
1015 Ga0501298_003474
1016 Ga0501032_0005230
1017 Ga0501032_0010226
1018 Ga0501034_0004635
1019 Ga0501034_0020155
1020 Ga0501034_0044656
1021 Ga0501034_0166936
1022 Ga0501036_0011069
1023 Ga0501036_0032480
1024 Ga0501036_0108379
1025 Ga0501037_0016109
1026 Ga0501038_0015399
1027 Ga0501038_0031789
1028 Ga0501038_0034161
1029 Ga0501038_0067729
1030 Ga0501039_0001372
1031 Ga0501040_0079084
1032 Ga0501043_0010222
1033 Ga0501043_0014209
1034 Ga0501046_0023434
1035 Ga0501046_0030095
1036 Ga0501047_0003414
1037 Ga0501047_0009295
1038 Ga0501047_0121996
1039 Ga0501048_0018263
1040 Ga0501067_0037685
1041 Ga0501068_0026397
1042 Ga0501073_0006622
1043 Ga0501198_000545
1044 Ga0501201_000191
1045 Ga0501202_000029
1046 Ga0501202_000563
1047 Ga0501206_001916
1048 Ga0501207_002068
1049 Ga0501217_000131
1050 Ga0501217_000406
1051 Ga0501222_001901
1052 Ga0501222_003146
1053 Ga0501223_007972
1054 Ga0501224_000214
1055 Ga0501224_003773
1056 Ga0501233_001507
1057 Ga0501233_008416
1058 Ga0501235_005471
1059 Ga0501257_005310
1060 Ga0501259_000109
1061 Ga0501261_000626
1062 Ga0501219_000235
1063 Ga0501221_000490
1064 Ga0501225_0003122
1065 Ga0501225_0003159
1066 Ga0501225_0003261
1067 Ga0501245_002150
1068 Ga0501232_001310
1069 Ga0501266_001381
1070 Ga0501035_0009960
1071 Ga0501035_0012125
1072 Ga0501035_0077803
1073 Ga0501044_0003510
1074 Ga0501044_0013869
1075 Ga0501044_0024700
1076 Ga0501044_0098721
1077 Ga0501045_0037644
1078 Ga0501284_00015
1079 nmdc:mga05p37_115681_c1
1080 nmdc:mga05p37_116536_c1
1081 nmdc:mga05p37_51420_c1
1082 nmdc:mga09592_13413_c1
1083 nmdc:mga09592_22135_c1
1084 nmdc:mga09592_3966_c1
1085 nmdc:mga06r32_120459_c1
1086 nmdc:mga06r32_24351_c1
1087 nmdc:mga06r32_79186_c1
1088 nmdc:mga08y16_41950_c1
1089 Ga0500578_0000001
1090 Ga0500644_0000078
1091 Ga0500644_0001876
1092 Ga0500646_0000911
1093 Ga0500583_0000048
1094 Ga0500583_0001230
1095 Ga0500583_0011913
1096 Ga0500562_000080
1097 Ga0500569_001259
1098 Ga0500652_008523
1099 Ga0500658_0001268
1100 Ga0500568_0000325
1101 Ga0500590_011223
1102 Ga0500616_0003988
1103 Ga0500622_0000176
1104 Ga0500622_0000677
1105 Ga0500636_0026221
1106 Ga0500611_000029
1107 Ga0500611_000094
1108 Ga0501084_0161138
1109 2738728870
1110 2819587863
1111 2914759898
1112 2929158110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02705

K_trans

K+ potassium transporter integral membrane domain

72

507

0.92

PF22776

K_trans_C

K+ potassium transporter C-terminal domain

521

695

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gi9-assembly1.cif.gz_C crystal structure of apct transporter bound to 7f11 monoclonal fab fragment 0.7 1 445
3gi8-assembly1.cif.gz_C crystal structure of apct k158a transporter bound to 7f11 monoclonal fab fragment 0.6973 1 445
7dsk-assembly1.cif.gz_B overall structure of the lat1-4f2hc bound with jx-075 0.6843 5 438
3gi8-assembly1.cif.gz_C crystal structure of apct k158a transporter bound to 7f11 monoclonal fab fragment 0.681 1 445
3gi9-assembly1.cif.gz_C crystal structure of apct transporter bound to 7f11 monoclonal fab fragment 0.6772 1 445
ID Description Score Start End Superfamily
af_Q84YJ9_78_550_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9351 13 448 1.20.1740.10
af_Q84MS4_133_530_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9328 87 437 1.20.1740.10
af_Q69RI8_116_588_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9327 13 445 1.20.1740.10
af_Q942X8_26_493_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.93 13 438 1.20.1740.10
af_Q652J4_30_507_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9277 12 447 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A3D3PBK7-F1-model_v4 Potassium transporter Kup 0.9864 3 442 GO:0015079
GO:0016020
AF-A0A7J5WP67-F1-model_v4 KUP system potassium uptake 0.983 1 296 GO:0015079
GO:0016020
AF-A0A4Q3RDR5-F1-model_v4 Potassium transporter Kup 0.9766 3 264 GO:0015079
GO:0016020
AF-A0A3D3PBK7-F1-model_v4 Potassium transporter Kup 0.9707 3 442 GO:0015079
GO:0016020
AF-A0A7J5WP67-F1-model_v4 KUP system potassium uptake 0.97 1 296 GO:0015079
GO:0016020

Map