F464796

General Info

Members Datasets Scaffolds Average Seq Length
570 315 569 154

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10103937|Ga0070691_101039372
Length 188
Sequence MSIVGPRVKSAPAETGAIATVYDAGRVRRPRTEFLMHAFARAVAILALVAGFGVAVEAAAIAPAAAQTAGKKIMTTASGLKYTDETVGTGPSPKPGQTAVVHYTGWLYVNGVKGAKFDSSVDRNEPFSFPVGKGRVIKGWDEGVATMKVGGKRTLIIPPALGYGASGAGGVIPPNATLMFDVELLAVK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
63 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
64 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
92 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
93 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
151 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
193 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
194 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
195 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
307 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.63
Nodule 2.81
Rhizoplane 10.7
Rhizosphere 70.88
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10104580 3300002459 Bacteria 592
2 JGI25153J46596_10000560 3300003215 Bacteria 23047
3 JGI25160J50197_1003827 3300003354 Bacteria 6610
4 Ga0055531_10003731 3300003794 Bacteria 9573
5 Ga0065165_1004598 3300005262 Bacteria 8400
6 Ga0065165_1060899 3300005262 Bacteria 1035
7 Ga0070658_10196990 3300005327 Bacteria 1699
8 Ga0070670_100202787 3300005331 Bacteria 1724
9 Ga0070670_100337358 3300005331 Bacteria 1323
10 Ga0070680_100024919 3300005336 Bacteria 4782
11 Ga0070680_100214640 3300005336 Bacteria 1624
12 Ga0070680_100412164 3300005336 Bacteria 1152
13 Ga0070682_100678550 3300005337 Bacteria 824
14 Ga0070660_100228074 3300005339 Bacteria 1515
15 Ga0070660_100421867 3300005339 Bacteria 1105
16 Ga0070689_100311399 3300005340 Bacteria 1313
17 Ga0070691_10103937 3300005341 Bacteria 1414
18 Ga0070668_100047473 3300005347 Bacteria 3301
19 Ga0070668_101536339 3300005347 Bacteria 609
20 Ga0070669_101145280 3300005353 Bacteria 671
21 Ga0070675_100172821 3300005354 Bacteria 1864
22 Ga0070675_101424738 3300005354 Bacteria 639
23 Ga0070671_101593269 3300005355 Bacteria 579
24 Ga0070674_100074026 3300005356 Bacteria 2416
25 Ga0070673_100100290 3300005364 Bacteria 2383
26 Ga0070673_101049537 3300005364 Bacteria 760
27 Ga0070688_100041703 3300005365 Bacteria 2819
28 Ga0070659_100213216 3300005366 Bacteria 1592
29 Ga0070667_100279544 3300005367 Bacteria 1499
30 Ga0070709_10000261 3300005434 Bacteria 33691
31 Ga0070709_10347673 3300005434 Bacteria 1095
32 Ga0070714_100037946 3300005435 Bacteria 4051
33 Ga0070714_100153262 3300005435 Bacteria 2078
34 Ga0070714_100325728 3300005435 Bacteria 1438
35 Ga0070713_100040271 3300005436 Bacteria 3798
36 Ga0070710_10000210 3300005437 Bacteria 27444
37 Ga0070710_10046737 3300005437 Bacteria 2412
38 Ga0070711_100025996 3300005439 Bacteria 3833
39 Ga0070711_100216032 3300005439 Bacteria 1488
40 Ga0070663_100013561 3300005455 Bacteria 5202
41 Ga0070663_100109563 3300005455 Bacteria 2073
42 Ga0070663_100273483 3300005455 Bacteria 1344
43 Ga0070678_100076771 3300005456 Bacteria 2518
44 Ga0070678_100227867 3300005456 Bacteria 1552
45 Ga0070662_100268101 3300005457 Bacteria 1378
46 Ga0070662_100368843 3300005457 Bacteria 1179
47 Ga0070681_10048935 3300005458 Bacteria 4223
48 Ga0070681_10071418 3300005458 Bacteria 3436
49 Ga0070681_10115574 3300005458 Bacteria 2621
50 Ga0070681_10134729 3300005458 Bacteria 2401
51 Ga0070681_10368028 3300005458 Bacteria 1348
52 Ga0070679_100165885 3300005530 Bacteria 2182
53 Ga0070679_100387164 3300005530 Bacteria 1345
54 Ga0070679_100794068 3300005530 Bacteria 890
55 Ga0070679_101485394 3300005530 Bacteria 624
56 Ga0070697_101715629 3300005536 Bacteria 562
57 Ga0068853_100526611 3300005539 Bacteria 1118
58 Ga0068853_101500504 3300005539 Bacteria 653
59 Ga0070672_100054030 3300005543 Bacteria 3143
60 Ga0070686_100753878 3300005544 Bacteria 781
61 Ga0070665_100053032 3300005548 Bacteria 4067
62 Ga0070665_100224569 3300005548 Bacteria 1878
63 Ga0070665_100244008 3300005548 Bacteria 1797
64 Ga0068855_100108082 3300005563 Bacteria 3195
65 Ga0068855_100734852 3300005563 Bacteria 1054
66 Ga0070664_101282821 3300005564 Bacteria 692
67 Ga0068857_100088811 3300005577 Bacteria 2765
68 Ga0068857_101082360 3300005577 Bacteria 774
69 Ga0068857_101556984 3300005577 Bacteria 645
70 Ga0068854_100152560 3300005578 Bacteria 1783
71 Ga0068854_100270209 3300005578 Bacteria 1365
72 Ga0068852_100215450 3300005616 Bacteria 1824
73 Ga0068859_100100443 3300005617 Bacteria 2949
74 Ga0068859_100588792 3300005617 Bacteria 1206
75 Ga0068861_100652511 3300005719 Bacteria 972
76 Ga0068863_100085365 3300005841 Bacteria 2991
77 Ga0068858_100843865 3300005842 Bacteria 895
78 Ga0068860_101322273 3300005843 Bacteria 742
79 Ga0070717_10087927 3300006028 Bacteria 2618
80 Ga0070717_10947980 3300006028 Bacteria 784
81 Ga0070717_11318472 3300006028 Bacteria 656
82 Ga0075365_10034633 3300006038 Bacteria 3262
83 Ga0075365_10047090 3300006038 Bacteria 2833
84 Ga0075365_10051895 3300006038 Bacteria 2710
85 Ga0075365_10142828 3300006038 Bacteria 1662
86 Ga0075368_10017272 3300006042 Bacteria 2699
87 Ga0075368_10035322 3300006042 Bacteria 1950
88 Ga0075368_10074422 3300006042 Bacteria 1376
89 Ga0075363_100017468 3300006048 Bacteria 3558
90 Ga0075363_100287963 3300006048 Bacteria 951
91 Ga0075364_10148960 3300006051 Bacteria 1576
92 Ga0075364_10461733 3300006051 Bacteria 868
93 Ga0070715_10419022 3300006163 Bacteria 749
94 Ga0070715_10489777 3300006163 Bacteria 702
95 Ga0070716_100030058 3300006173 Bacteria 2943
96 Ga0070712_100024163 3300006175 Bacteria 4023
97 Ga0070712_100096022 3300006175 Bacteria 2182
98 Ga0070712_100277452 3300006175 Bacteria 1349
99 Ga0070712_100403527 3300006175 Bacteria 1129
100 Ga0075362_10058713 3300006177 Bacteria 1736
101 Ga0075362_10529034 3300006177 Bacteria 605
102 Ga0075367_10089319 3300006178 Bacteria 1873
103 Ga0075367_10116979 3300006178 Bacteria 1640
104 Ga0075367_10298117 3300006178 Bacteria 1015
105 Ga0075367_10447294 3300006178 Bacteria 819
106 Ga0075366_10104244 3300006195 Bacteria 1704
107 Ga0075366_10137737 3300006195 Bacteria 1475
108 Ga0075366_10475472 3300006195 Bacteria 772
109 Ga0097621_100728402 3300006237 Bacteria 915
110 Ga0075370_10054875 3300006353 Bacteria 2263
111 Ga0068871_101026812 3300006358 Bacteria 769
112 Ga0097620_100100448 3300006931 Bacteria 2949
113 Ga0097620_100588787 3300006931 Bacteria 1206
114 Ga0099825_1037919 3300006941 Bacteria 1565
115 Ga0099824_1036906 3300006942 Bacteria 1389
116 Ga0099823_1015403 3300006944 Bacteria 7581
117 Ga0075435_101297309 3300007076 Bacteria 638
118 Ga0099795_10168293 3300007788 Bacteria 909
119 Ga0105240_10023872 3300009093 Bacteria 8077
120 Ga0105240_10111074 3300009093 Bacteria 3317
121 Ga0105245_10282164 3300009098 Bacteria 1624
122 Ga0105247_10075595 3300009101 Bacteria 2114
123 Ga0105243_10020564 3300009148 Bacteria 5004
124 Ga0105243_10740964 3300009148 Bacteria 962
125 Ga0105241_10059790 3300009174 Bacteria 2931
126 Ga0105241_11513428 3300009174 Bacteria 646
127 Ga0105242_10063591 3300009176 Bacteria 3039
128 Ga0105248_10038686 3300009177 Bacteria 5339
129 Ga0105237_10381640 3300009545 Bacteria 1414
130 Ga0105237_10867833 3300009545 Bacteria 909
131 Ga0105238_10000577 3300009551 Bacteria 38524
132 Ga0105238_10033988 3300009551 Bacteria 5188
133 Ga0105238_11772453 3300009551 Bacteria 649
134 Ga0105249_12170438 3300009553 Bacteria 628
135 Ga0105249_12456027 3300009553 Bacteria 594
136 Ga0105239_10002730 3300010375 Bacteria 22163
137 Ga0105239_10006321 3300010375 Bacteria 13782
138 Ga0105239_10052776 3300010375 Bacteria 4459
139 Ga0105239_10430323 3300010375 Bacteria 1496
140 Ga0105246_10044664 3300011119 Bacteria 3012
141 Ga0157371_10064895 3300013102 Bacteria 2586
142 Ga0157370_10131437 3300013104 Bacteria 2335
143 Ga0157370_10373388 3300013104 Bacteria 1314
144 Ga0157370_10468207 3300013104 Bacteria 1158
145 Ga0157369_10008567 3300013105 Bacteria 11731
146 Ga0157369_10596161 3300013105 Bacteria 1141
147 Ga0157374_10095353 3300013296 Bacteria 2845
148 Ga0157374_10513393 3300013296 Bacteria 1204
149 Ga0157374_10751862 3300013296 Bacteria 989
150 Ga0163162_10155605 3300013306 Bacteria 2406
151 Ga0163163_10313012 3300014325 Bacteria 1623
152 Ga0163163_10650854 3300014325 Bacteria 1117
153 Ga0163163_10803370 3300014325 Bacteria 1004
154 Ga0157380_10046758 3300014326 Bacteria 3401
155 Ga0157380_10564542 3300014326 Bacteria 1119
156 Ga0157377_10404261 3300014745 Bacteria 931
157 Ga0157377_10914538 3300014745 Bacteria 657
158 Ga0157379_10606306 3300014968 Bacteria 1022
159 Ga0157379_10759465 3300014968 Bacteria 913
160 Ga0157376_10298847 3300014969 Bacteria 1523
161 Ga0182005_1212271 3300015265 Bacteria 586
162 Ga0206353_10149552 3300020082 Bacteria 1929
163 Ga0214542_1000058 3300021321 Bacteria 133923
164 Ga0214542_1025427 3300021321 Bacteria 3092
165 Ga0214545_1000026 3300021324 Bacteria 133811
166 Ga0214545_1016362 3300021324 Bacteria 7682
167 Ga0214543_1002325 3300021327 Bacteria 37311
168 Ga0214543_1031379 3300021327 Bacteria 2123
169 Ga0228598_1001342 3300024227 Bacteria 5411
170 Ga0207425_1042066 3300025245 Bacteria 866
171 Ga0209129_1051943 3300025258 Bacteria 624
172 Ga0209564_1004700 3300025295 Bacteria 8186
173 Ga0209564_1005701 3300025295 Bacteria 6979
174 Ga0209758_1000011 3300025297 Bacteria 1049685
175 Ga0209758_1000940 3300025297 Bacteria 39289
176 Ga0209758_1001336 3300025297 Bacteria 29877
177 Ga0209256_1025400 3300025299 Bacteria 1725
178 Ga0207426_1004163 3300025302 Bacteria 7231
179 Ga0209257_1000158 3300025304 Bacteria 180079
180 Ga0209257_1014253 3300025304 Bacteria 3432
181 Ga0209257_1025655 3300025304 Bacteria 2008
182 Ga0209257_1093316 3300025304 Bacteria 747
183 Ga0207710_10112344 3300025900 Bacteria 1294
184 Ga0207688_10108686 3300025901 Bacteria 1608
185 Ga0207680_10406771 3300025903 Bacteria 962
186 Ga0207680_10422890 3300025903 Bacteria 944
187 Ga0207647_10002857 3300025904 Bacteria 13013
188 Ga0207647_10325881 3300025904 Bacteria 872
189 Ga0207699_10001210 3300025906 Bacteria 12240
190 Ga0207705_10200663 3300025909 Bacteria 1511
191 Ga0207705_10788485 3300025909 Bacteria 738
192 Ga0207707_10034632 3300025912 Bacteria 4418
193 Ga0207707_10079987 3300025912 Bacteria 2854
194 Ga0207707_10119943 3300025912 Bacteria 2299
195 Ga0207707_10222453 3300025912 Bacteria 1643
196 Ga0207707_10573617 3300025912 Bacteria 957
197 Ga0207707_10726693 3300025912 Bacteria 832
198 Ga0207695_10022692 3300025913 Bacteria 7113
199 Ga0207695_10091336 3300025913 Bacteria 3059
200 Ga0207695_10323027 3300025913 Bacteria 1433
201 Ga0207671_10049790 3300025914 Bacteria 3102
202 Ga0207671_10941489 3300025914 Bacteria 682
203 Ga0207693_10069824 3300025915 Bacteria 2749
204 Ga0207693_10312774 3300025915 Bacteria 1230
205 Ga0207663_10257083 3300025916 Bacteria 1288
206 Ga0207660_10014919 3300025917 Bacteria 5122
207 Ga0207660_10054432 3300025917 Bacteria 2856
208 Ga0207660_10118064 3300025917 Bacteria 2006
209 Ga0207660_10293694 3300025917 Bacteria 1293
210 Ga0207662_10743115 3300025918 Bacteria 689
211 Ga0207657_10711598 3300025919 Bacteria 780
212 Ga0207657_10943293 3300025919 Bacteria 664
213 Ga0207649_10622862 3300025920 Bacteria 832
214 Ga0207652_10178507 3300025921 Bacteria 1907
215 Ga0207652_10587906 3300025921 Bacteria 999
216 Ga0207652_11356633 3300025921 Bacteria 614
217 Ga0207681_10564332 3300025923 Bacteria 938
218 Ga0207694_10000273 3300025924 Bacteria 49024
219 Ga0207694_10725040 3300025924 Bacteria 839
220 Ga0207650_10366702 3300025925 Bacteria 1187
221 Ga0207659_10324274 3300025926 Bacteria 1271
222 Ga0207687_10516293 3300025927 Bacteria 999
223 Ga0207700_10045098 3300025928 Bacteria 3251
224 Ga0207700_10074350 3300025928 Bacteria 2628
225 Ga0207664_10014428 3300025929 Bacteria 5705
226 Ga0207664_10031561 3300025929 Bacteria 4054
227 Ga0207664_10289400 3300025929 Bacteria 1439
228 Ga0207664_10324633 3300025929 Bacteria 1358
229 Ga0207644_10287027 3300025931 Bacteria 1322
230 Ga0207690_10415108 3300025932 Bacteria 1076
231 Ga0207690_10792413 3300025932 Bacteria 783
232 Ga0207706_10121113 3300025933 Bacteria 2301
233 Ga0207706_10504587 3300025933 Bacteria 1044
234 Ga0207709_10048060 3300025935 Bacteria 2598
235 Ga0207709_11206876 3300025935 Bacteria 623
236 Ga0207709_11409646 3300025935 Bacteria 577
237 Ga0207670_10355276 3300025936 Bacteria 1161
238 Ga0207669_10195511 3300025937 Bacteria 1463
239 Ga0207665_10041535 3300025939 Bacteria 3072
240 Ga0207691_10080020 3300025940 Bacteria 2940
241 Ga0207691_10573623 3300025940 Bacteria 956
242 Ga0207691_10780630 3300025940 Bacteria 803
243 Ga0207711_10136789 3300025941 Bacteria 2201
244 Ga0207711_10289924 3300025941 Bacteria 1508
245 Ga0207661_10659873 3300025944 Bacteria 961
246 Ga0207679_10764354 3300025945 Bacteria 879
247 Ga0207667_10120365 3300025949 Bacteria 2705
248 Ga0207712_10804055 3300025961 Bacteria 827
249 Ga0207668_10129544 3300025972 Bacteria 1924
250 Ga0207668_10253038 3300025972 Bacteria 1432
251 Ga0207668_10330719 3300025972 Bacteria 1268
252 Ga0207668_11626059 3300025972 Bacteria 583
253 Ga0207640_10024770 3300025981 Bacteria 3625
254 Ga0207640_10265321 3300025981 Bacteria 1340
255 Ga0207640_10294831 3300025981 Bacteria 1280
256 Ga0207703_10151346 3300026035 Bacteria 2024
257 Ga0207639_10293963 3300026041 Bacteria 1433
258 Ga0207639_11366888 3300026041 Bacteria 665
259 Ga0207678_10066235 3300026067 Bacteria 3102
260 Ga0207678_10092129 3300026067 Bacteria 2590
261 Ga0207678_10147831 3300026067 Bacteria 2006
262 Ga0207678_10766338 3300026067 Bacteria 851
263 Ga0207641_11286072 3300026088 Bacteria 732
264 Ga0207648_11016817 3300026089 Bacteria 776
265 Ga0207676_10391316 3300026095 Bacteria 1297
266 Ga0207674_10075312 3300026116 Bacteria 3385
267 Ga0207674_10155357 3300026116 Bacteria 2243
268 Ga0207675_100555059 3300026118 Bacteria 1148
269 Ga0207675_100989443 3300026118 Bacteria 859
270 Ga0207683_10307996 3300026121 Bacteria 1449
271 Ga0207683_10786849 3300026121 Bacteria 883
272 Ga0207683_10802805 3300026121 Bacteria 873
273 Ga0207698_10226336 3300026142 Bacteria 1694
274 Ga0207698_10541709 3300026142 Bacteria 1139
275 Ga0207698_11186375 3300026142 Bacteria 777
276 Ga0209389_1000073 3300027296 Bacteria 94298
277 Ga0209389_1000160 3300027296 Bacteria 56126
278 Ga0209589_1000484 3300027357 Bacteria 56126
279 Ga0209489_100917 3300027361 Bacteria 58978
280 Ga0209489_100982 3300027361 Bacteria 57399
281 Ga0209700_100067 3300027363 Bacteria 144074
282 Ga0209179_1025995 3300027512 Bacteria 1172
283 Ga0209813_10161992 3300027866 Bacteria 808
284 Ga0209813_10225101 3300027866 Bacteria 704
285 Ga0268266_10021997 3300028379 Bacteria 5435
286 Ga0268266_10082247 3300028379 Bacteria 2809
287 Ga0268266_10114683 3300028379 Bacteria 2391
288 Ga0268264_12637567 3300028381 Bacteria 507
289 Ga0265338_10024838 3300028800 Bacteria 6106
290 Ga0265330_10009652 3300031235 Bacteria 4576
291 Ga0265325_10010920 3300031241 Bacteria 5232
292 Ga0265340_10018433 3300031247 Bacteria 3600
293 Ga0265331_10081675 3300031250 Bacteria 1500
294 Ga0265327_10135276 3300031251 Bacteria 1156
295 Ga0265316_10151065 3300031344 Bacteria 1740
296 Ga0307408_100599776 3300031548 Bacteria 978
297 Ga0265313_10018461 3300031595 Bacteria 3913
298 Ga0307508_10000008 3300031616 Bacteria 265023
299 Ga0265314_10020265 3300031711 Bacteria 5135
300 Ga0265342_10011898 3300031712 Bacteria 5920
301 Ga0265342_10049095 3300031712 Bacteria 2527
302 Ga0307409_101579308 3300031995 Bacteria 684
303 Ga0307416_100520317 3300032002 Bacteria 1258
304 Ga0307411_10903524 3300032005 Bacteria 785
305 Ga0373934_0332307 3300035086 Bacteria 632
306 Ga0373923_0011100 3300035111 Bacteria 3296
307 Ga0373939_0168874 3300035114 Bacteria 808
308 Ga0373953_0021843 3300035117 Bacteria 2406
309 Ga0373954_0005019 3300035118 Bacteria 5712
310 Ga0373954_0064007 3300035118 Bacteria 1738
311 Ga0373954_0318239 3300035118 Bacteria 768
312 Ga0373956_0019909 3300035119 Bacteria 2850
313 Ga0373956_0095221 3300035119 Bacteria 1377
314 Ga0373956_0186124 3300035119 Bacteria 982
315 Ga0373957_0095771 3300035120 Bacteria 1184
316 Ga0373955_0051660 3300035172 Bacteria 2239
317 Ga0373955_0190686 3300035172 Bacteria 1218
318 Ga0373961_0059894 3300035241 Bacteria 1152
319 Ga0373962_0026296 3300035242 Bacteria 1568
320 Ga0373924_0103180 3300035410 Bacteria 1228
321 Ga0373931_0004059 3300035691 Bacteria 6635
322 Ga0373935_0160484 3300035692 Bacteria 1532
323 Ga0373935_0238931 3300035692 Bacteria 1268
324 Ga0373933_0014929 3300035724 Bacteria 4325
325 Ga0373933_0060893 3300035724 Bacteria 2276
326 Ga0373933_0071348 3300035724 Bacteria 2114
327 Ga0373937_0014381 3300036401 Bacteria 6987
328 Ga0373937_0016707 3300036401 Bacteria 6521
329 Ga0373937_0102273 3300036401 Bacteria 2660
330 Ga0373937_1084377 3300036401 Bacteria 749
331 Ga0373937_1979711 3300036401 Bacteria 529
332 Ga0395900_0317933 3300037418 Bacteria 1538
333 Ga0395898_1295562 3300037466 Bacteria 658
334 Ga0395901_0267384 3300038443 Bacteria 1779
335 Ga0436362_0505536 3300039453 Bacteria 1004
336 Ga0439453_0055680 3300041408 Bacteria 808
337 Ga0451843_0662871 3300041509 Bacteria 1808
338 Ga0439455_0082568 3300042012 Bacteria 875
339 Ga0439456_005631 3300042013 Bacteria 2545
340 Ga0466972_0143869 3300044658 Bacteria 1122
341 Ga0466972_0239876 3300044658 Bacteria 848
342 Ga0453683_0121072 3300044673 Bacteria 1647
343 Ga0466965_0029688 3300044683 Bacteria 2661
344 Ga0466965_0278880 3300044683 Bacteria 902
345 Ga0466963_0024458 3300044694 Bacteria 3846
346 Ga0466963_0187759 3300044694 Bacteria 1444
347 Ga0466963_0213303 3300044694 Bacteria 1351
348 Ga0466960_0788855 3300044901 Bacteria 574
349 Ga0451576_0010701 3300045051 Bacteria 10504
350 Ga0466967_0430878 3300045976 Bacteria 1286
351 Ga0495592_0039033 3300046454 Bacteria 3569
352 Ga0495592_0191798 3300046454 Bacteria 1384
353 Ga0495590_0109117 3300046457 Bacteria 987
354 Ga0495629_0042353 3300046459 Bacteria 3200
355 Ga0495629_0424726 3300046459 Bacteria 902
356 Ga0495651_0024676 3300046462 Bacteria 4677
357 Ga0495651_0120000 3300046462 Bacteria 1933
358 Ga0495651_0376206 3300046462 Bacteria 932
359 Ga0495653_0088251 3300046463 Bacteria 2275
360 Ga0495653_0107431 3300046463 Bacteria 2011
361 Ga0495662_0226533 3300046476 Bacteria 922
362 Ga0495664_0042411 3300046477 Bacteria 2695
363 Ga0495585_0156756 3300046492 Bacteria 1184
364 Ga0495594_0123990 3300046499 Bacteria 1461
365 Ga0495607_0238425 3300046501 Bacteria 881
366 Ga0495583_0099738 3300046506 Bacteria 1241
367 Ga0495610_0183335 3300046512 Bacteria 869
368 Ga0495616_0015442 3300046513 Bacteria 4248
369 Ga0495618_0118927 3300046514 Bacteria 1692
370 Ga0495618_0685713 3300046514 Bacteria 603
371 Ga0495628_0069415 3300046516 Bacteria 2748
372 Ga0495628_0108289 3300046516 Bacteria 2139
373 Ga0495630_0515959 3300046517 Bacteria 916
374 Ga0495644_0197177 3300046523 Bacteria 776
375 Ga0495652_0022074 3300046529 Bacteria 5652
376 Ga0495652_0673223 3300046529 Bacteria 699
377 Ga0495652_0786196 3300046529 Bacteria 634
378 Ga0495640_0042612 3300046533 Bacteria 3165
379 Ga0495640_0105062 3300046533 Bacteria 1850
380 Ga0495640_0170787 3300046533 Bacteria 1389
381 Ga0495587_0010933 3300046536 Bacteria 5758
382 Ga0495587_0165902 3300046536 Bacteria 1255
383 Ga0495597_0023924 3300046542 Bacteria 2823
384 Ga0495645_0106584 3300046543 Bacteria 1987
385 Ga0495667_0045953 3300046559 Bacteria 2888
386 Ga0495667_0116418 3300046559 Bacteria 1726
387 Ga0495667_0178462 3300046559 Bacteria 1364
388 Ga0495656_0707089 3300046615 Bacteria 542
389 Ga0495668_0028092 3300046616 Bacteria 3183
390 Ga0495634_0048984 3300046642 Bacteria 2842
391 Ga0495634_0187689 3300046642 Bacteria 1291
392 Ga0495625_0457460 3300046660 Bacteria 787
393 Ga0495635_0045516 3300046663 Bacteria 3028
394 Ga0495635_0631943 3300046663 Bacteria 697
395 Ga0495657_0372748 3300046675 Bacteria 842
396 Ga0495599_0026974 3300046678 Bacteria 3599
397 Ga0495623_0000341 3300046679 Bacteria 30684
398 Ga0495646_0285246 3300046680 Bacteria 876
399 Ga0495658_0068452 3300046683 Bacteria 2056
400 Ga0495669_0349370 3300046684 Bacteria 715
401 Ga0495613_0324368 3300046689 Bacteria 1062
402 Ga0495624_0434352 3300046690 Bacteria 787
403 Ga0495600_0004899 3300046809 Bacteria 8041
404 Ga0495600_0089630 3300046809 Bacteria 2006
405 Ga0495600_0178910 3300046809 Bacteria 1367
406 Ga0495581_0064444 3300047315 Bacteria 2117
407 Ga0495604_0107051 3300047317 Bacteria 2044
408 Ga0495604_0195533 3300047317 Bacteria 1406
409 Ga0495674_0194142 3300047319 Bacteria 1686
410 Ga0495680_0070998 3300047322 Bacteria 2652
411 Ga0495680_0234886 3300047322 Bacteria 1304
412 Ga0495680_0397848 3300047322 Bacteria 951
413 Ga0495680_0414872 3300047322 Bacteria 927
414 Ga0495683_0061528 3300047323 Bacteria 1859
415 Ga0495687_012034 3300047443 Bacteria 4602
416 Ga0495675_0165001 3300047444 Bacteria 1362
417 Ga0495677_0204527 3300047445 Bacteria 768
418 Ga0495684_0006898 3300047471 Bacteria 8816
419 Ga0495684_0198669 3300047471 Bacteria 1479
420 Ga0495593_0055198 3300047673 Bacteria 2091
421 Ga0495593_0236323 3300047673 Bacteria 916
422 Ga0495602_0050066 3300048088 Bacteria 3736
423 Ga0495602_0093108 3300048088 Bacteria 2494
424 Ga0495602_0685029 3300048088 Bacteria 697
425 Ga0496100_0073278 3300048903 Bacteria 2291
426 Ga0496100_0141071 3300048903 Bacteria 1708
427 Ga0496100_0170164 3300048903 Bacteria 1568
428 Ga0496100_0440341 3300048903 Bacteria 998
429 Ga0496100_0444289 3300048903 Bacteria 993
430 Ga0496100_0452993 3300048903 Bacteria 984
431 Ga0496101_0111646 3300048904 Bacteria 2058
432 Ga0496101_1148515 3300048904 Bacteria 609
433 Ga0496101_1301156 3300048904 Bacteria 568
434 Ga0496102_0052448 3300048905 Bacteria 3716
435 Ga0496102_0053235 3300048905 Bacteria 3689
436 Ga0496102_0188945 3300048905 Bacteria 1941
437 Ga0496102_0461272 3300048905 Bacteria 1191
438 Ga0496103_0010003 3300048906 Bacteria 5610
439 Ga0496103_0020039 3300048906 Bacteria 4016
440 Ga0496103_0414236 3300048906 Bacteria 865
441 Ga0496104_0006100 3300048907 Bacteria 10578
442 Ga0496104_0149697 3300048907 Bacteria 2241
443 Ga0496104_0250767 3300048907 Bacteria 1683
444 Ga0496104_0252097 3300048907 Bacteria 1678
445 Ga0496104_0990835 3300048907 Bacteria 744
446 Ga0496105_0018424 3300048908 Bacteria 5611
447 Ga0496105_0084393 3300048908 Bacteria 2624
448 Ga0496105_0291140 3300048908 Bacteria 1314
449 Ga0496106_0008322 3300048909 Bacteria 7676
450 Ga0496106_0078331 3300048909 Bacteria 2536
451 Ga0496106_0080504 3300048909 Bacteria 2501
452 Ga0496106_0736498 3300048909 Bacteria 784
453 Ga0496107_0011233 3300048910 Bacteria 6232
454 Ga0496107_0014344 3300048910 Bacteria 5548
455 Ga0496107_0699170 3300048910 Bacteria 746
456 Ga0496108_0000884 3300048911 Bacteria 23347
457 Ga0496108_0178539 3300048911 Bacteria 1838
458 Ga0496108_0589067 3300048911 Bacteria 969
459 Ga0496109_0000680 3300048912 Bacteria 28264
460 Ga0496109_0024895 3300048912 Bacteria 5328
461 Ga0496109_0086022 3300048912 Bacteria 2903
462 Ga0496109_0251551 3300048912 Bacteria 1664
463 Ga0496110_0011875 3300048913 Bacteria 7153
464 Ga0496110_0025539 3300048913 Bacteria 5049
465 Ga0496110_0802640 3300048913 Bacteria 845
466 Ga0496111_0015146 3300048914 Bacteria 5285
467 Ga0496111_0120136 3300048914 Bacteria 1941
468 Ga0496111_0136596 3300048914 Bacteria 1816
469 Ga0496112_0012627 3300048915 Bacteria 7765
470 Ga0496112_0169525 3300048915 Bacteria 2148
471 Ga0496112_0727352 3300048915 Bacteria 919
472 Ga0496112_0935360 3300048915 Bacteria 788
473 Ga0496112_1290578 3300048915 Bacteria 646
474 Ga0496113_0004759 3300048916 Bacteria 8382
475 Ga0496113_0010432 3300048916 Bacteria 6144
476 Ga0496113_0047490 3300048916 Bacteria 3190
477 Ga0496113_0635305 3300048916 Bacteria 854
478 Ga0496114_0031891 3300048917 Bacteria 4334
479 Ga0496114_0096668 3300048917 Bacteria 2515
480 Ga0496115_0022612 3300048918 Bacteria 4874
481 Ga0496115_0097185 3300048918 Bacteria 2412
482 Ga0496115_0152657 3300048918 Bacteria 1907
483 Ga0496115_0176283 3300048918 Bacteria 1768
484 Ga0496115_0248151 3300048918 Bacteria 1466
485 Ga0496115_0855456 3300048918 Bacteria 704
486 Ga0496116_0288610 3300048919 Bacteria 789
487 Ga0496118_0087768 3300048921 Bacteria 2155
488 Ga0496119_0085667 3300048922 Bacteria 1803
489 Ga0496119_0264831 3300048922 Bacteria 861
490 Ga0496120_0236471 3300048923 Bacteria 865
491 Ga0496121_0089542 3300048924 Bacteria 2409
492 Ga0496122_0030192 3300048925 Bacteria 4551
493 Ga0496123_0030511 3300048926 Bacteria 3945
494 Ga0496124_0054449 3300048927 Bacteria 3386
495 Ga0496124_0248331 3300048927 Bacteria 1318
496 Ga0496124_0311801 3300048927 Bacteria 1131
497 Ga0496125_0581198 3300048928 Bacteria 615
498 Ga0496126_0047239 3300048929 Bacteria 3942
499 Ga0496126_0323982 3300048929 Bacteria 1266
500 Ga0496126_1140048 3300048929 Bacteria 577
501 Ga0501034_0023099 3300049571 Bacteria 6337
502 Ga0501036_0039523 3300049572 Bacteria 3992
503 Ga0501036_0316531 3300049572 Bacteria 1304
504 Ga0501036_0463401 3300049572 Bacteria 1055
505 Ga0501036_0606801 3300049572 Bacteria 907
506 Ga0501038_0008832 3300049574 Bacteria 9243
507 Ga0501038_0036774 3300049574 Bacteria 4296
508 Ga0501038_0104900 3300049574 Bacteria 2348
509 Ga0501039_0954829 3300049575 Bacteria 667
510 Ga0501043_0045910 3300049579 Bacteria 3434
511 Ga0501046_0144378 3300049580 Bacteria 1798
512 Ga0501047_0054296 3300049581 Bacteria 3875
513 Ga0501047_0062754 3300049581 Bacteria 3584
514 Ga0501047_0333100 3300049581 Bacteria 1356
515 Ga0501048_0568307 3300049582 Bacteria 814
516 Ga0501048_1062450 3300049582 Bacteria 582
517 Ga0501069_0056137 3300049585 Bacteria 2193
518 Ga0501070_0024235 3300049586 Bacteria 5088
519 Ga0501070_0204870 3300049586 Bacteria 1620
520 Ga0501071_0024104 3300049587 Bacteria 4253
521 Ga0501072_0934317 3300049588 Bacteria 677
522 Ga0501074_0068432 3300049590 Bacteria 2552
523 Ga0501080_0103000 3300049742 Bacteria 2647
524 Ga0501080_0378141 3300049742 Bacteria 1276
525 Ga0501035_0010160 3300049822 Bacteria 8736
526 Ga0501035_0178906 3300049822 Bacteria 1828
527 Ga0501035_0243547 3300049822 Bacteria 1529
528 Ga0501044_0116009 3300049823 Bacteria 2683
529 Ga0501044_0116324 3300049823 Bacteria 2679
530 nmdc:mga03683_94282_c1 3300050489 Bacteria 1308
531 nmdc:mga03n38_124071_c1 3300050490 Bacteria 1273
532 nmdc:mga03n38_195692_c1 3300050490 Bacteria 1044
533 nmdc:mga0yw44_174299_c1 3300050492 Bacteria 1413
534 nmdc:mga0yw44_367669_c1 3300050492 Bacteria 970
535 nmdc:mga0yw44_62046_c1 3300050492 Bacteria 2295
536 nmdc:mga0yw44_7789_c1 3300050492 Bacteria 5296
537 nmdc:mga0yw44_984002_c1 3300050492 Bacteria 571
538 nmdc:mga0k408_107167_c1 3300050493 Bacteria 1651
539 nmdc:mga0k408_138269_c1 3300050493 Bacteria 1448
540 nmdc:mga0k408_212620_c1 3300050493 Bacteria 1155
541 nmdc:mga06z11_26111_c1 3300050494 Bacteria 2776
542 nmdc:mga06z11_30363_c1 3300050494 Bacteria 1563
543 nmdc:mga06z11_955657_c1 3300050494 Bacteria 522
544 nmdc:mga04h51_157738_c1 3300050495 Bacteria 871
545 nmdc:mga04h51_362125_c1 3300050495 Bacteria 601
546 nmdc:mga04h51_42895_c1 3300050495 Bacteria 1486
547 nmdc:mga07m45_32276_c1 3300050496 Bacteria 2904
548 nmdc:mga0n895_778385_c1 3300050512 Bacteria 948
549 nmdc:mga08x19_167424_c1 3300050514 Bacteria 1495
550 nmdc:mga0sz30_122956_c1 3300050516 Bacteria 1141
551 nmdc:mga0sz30_78966_c1 3300050516 Bacteria 1423
552 Ga0495601_0170045 3300053077 Bacteria 1425
553 Ga0495595_0008422 3300053084 Bacteria 4231
554 Ga0495595_0012617 3300053084 Bacteria 3555
555 Ga0495619_0009683 3300053085 Bacteria 6075
556 Ga0495619_0089093 3300053085 Bacteria 2087
557 Ga0495619_0135907 3300053085 Bacteria 1691
558 Ga0495619_0393371 3300053085 Bacteria 957
559 Ga0500578_0064541 3300053086 Bacteria 2335
560 Ga0500644_0000753 3300053088 Bacteria 11169
561 Ga0500646_0084450 3300053090 Bacteria 974
562 Ga0500651_0011520 3300053093 Bacteria 5336
563 Ga0500652_001919 3300053131 Bacteria 6255
564 Ga0500658_0011848 3300053134 Bacteria 3215
565 Ga0500577_0248427 3300053142 Bacteria 773
566 Ga0500616_0000002 3300053153 Bacteria 1611257
567 Ga0500616_0005915 3300053153 Bacteria 8176
568 Ga0500645_000252 3300053730 Bacteria 39375
569 Ga0500645_040976 3300053730 Bacteria 1368

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0121072 Ga0453683_0121072_60_596 135
2 3300045051 Ga0451576_0010701 Ga0451576_0010701_9172_9681 135
3 3300007788 Ga0099795_10168293 Ga0099795_101682932 136
4 3300025912 Ga0207707_10726693 Ga0207707_107266931 136
5 3300005354 Ga0070675_100172821 Ga0070675_1001728213 137
6 3300005530 Ga0070679_100794068 Ga0070679_1007940682 143
7 3300025912 Ga0207707_10079987 Ga0207707_100799873 143
8 3300025913 Ga0207695_10323027 Ga0207695_103230272 143
9 3300025917 Ga0207660_10293694 Ga0207660_102936942 143
10 3300006163 Ga0070715_10419022 Ga0070715_104190222 144
11 3300049575 Ga0501039_0954829 Ga0501039_0954829_159_620 144
12 3300006051 Ga0075364_10461733 Ga0075364_104617332 145
13 3300044694 Ga0466963_0024458 Ga0466963_0024458_416_967 145
14 3300049588 Ga0501072_0934317 Ga0501072_0934317_64_528 145
15 3300050514 nmdc:mga08x19_167424_c1 nmdc:mga08x19_167424_c1_662_1132 145
16 3300015265 Ga0182005_1212271 Ga0182005_12122711 146
17 3300025921 Ga0207652_11356633 Ga0207652_113566331 146
18 3300006038 Ga0075365_10047090 Ga0075365_100470904 147
19 3300006177 Ga0075362_10058713 Ga0075362_100587132 147
20 3300006178 Ga0075367_10298117 Ga0075367_102981171 147
21 3300035118 Ga0373954_0005019 Ga0373954_0005019_5215_5685 147
22 3300035119 Ga0373956_0186124 Ga0373956_0186124_229_699 147
23 3300035172 Ga0373955_0190686 Ga0373955_0190686_572_1042 147
24 3300035724 Ga0373933_0014929 Ga0373933_0014929_2705_3175 147
25 3300036401 Ga0373937_0016707 Ga0373937_0016707_1619_2089 147
26 3300036401 Ga0373937_0102273 Ga0373937_0102273_291_761 147
27 3300036401 Ga0373937_1979711 Ga0373937_1979711_38_496 147
28 3300046533 Ga0495640_0042612 Ga0495640_0042612_2589_3059 147
29 3300046559 Ga0495667_0178462 Ga0495667_0178462_21_491 147
30 3300047322 Ga0495680_0414872 Ga0495680_0414872_145_615 147
31 3300048088 Ga0495602_0685029 Ga0495602_0685029_197_667 147
32 3300048903 Ga0496100_0073278 Ga0496100_0073278_726_1184 147
33 3300048903 Ga0496100_0452993 Ga0496100_0452993_419_913 147
34 3300048907 Ga0496104_0250767 Ga0496104_0250767_336_794 147
35 3300048909 Ga0496106_0080504 Ga0496106_0080504_1560_2018 147
36 3300048910 Ga0496107_0011233 Ga0496107_0011233_2649_3107 147
37 3300048911 Ga0496108_0000884 Ga0496108_0000884_12240_12698 147
38 3300048912 Ga0496109_0000680 Ga0496109_0000680_24516_24974 147
39 3300048913 Ga0496110_0025539 Ga0496110_0025539_29_487 147
40 3300048914 Ga0496111_0120136 Ga0496111_0120136_116_574 147
41 3300048915 Ga0496112_0012627 Ga0496112_0012627_1767_2225 147
42 3300048916 Ga0496113_0010432 Ga0496113_0010432_2303_2761 147
43 3300048918 Ga0496115_0097185 Ga0496115_0097185_127_585 147
44 3300050492 nmdc:mga0yw44_7789_c1 nmdc:mga0yw44_7789_c1_535_993 147
45 3300050494 nmdc:mga06z11_26111_c1 nmdc:mga06z11_26111_c1_1424_1882 147
46 3300050495 nmdc:mga04h51_362125_c1 nmdc:mga04h51_362125_c1_52_510 147
47 3300053077 Ga0495601_0170045 Ga0495601_0170045_275_733 147
48 3300053084 Ga0495595_0008422 Ga0495595_0008422_1694_2164 147
49 3300053085 Ga0495619_0089093 Ga0495619_0089093_1528_1998 147
50 3300053085 Ga0495619_0135907 Ga0495619_0135907_1037_1507 147
51 3300005435 Ga0070714_100325728 Ga0070714_1003257282 148
52 3300025929 Ga0207664_10324633 Ga0207664_103246331 148
53 3300005336 Ga0070680_100214640 Ga0070680_1002146402 150
54 3300005530 Ga0070679_101485394 Ga0070679_1014853941 150
55 3300005539 Ga0068853_100526611 Ga0068853_1005266113 150
56 3300006175 Ga0070712_100096022 Ga0070712_1000960222 150
57 3300009551 Ga0105238_11772453 Ga0105238_117724531 150
58 3300027512 Ga0209179_1025995 Ga0209179_10259952 150
59 3300031616 Ga0307508_10000008 Ga0307508_1000000822 150
60 3300044694 Ga0466963_0213303 Ga0466963_0213303_588_1082 150
61 iso_pu_bacteria 8019659431 8019660584 150
62 3300005356 Ga0070674_100074026 Ga0070674_1000740264 151
63 3300005364 Ga0070673_101049537 Ga0070673_1010495371 151
64 3300005437 Ga0070710_10046737 Ga0070710_100467372 151
65 3300005439 Ga0070711_100025996 Ga0070711_1000259966 151
66 3300005456 Ga0070678_100076771 Ga0070678_1000767712 151
67 3300005458 Ga0070681_10134729 Ga0070681_101347293 151
68 3300006038 Ga0075365_10034633 Ga0075365_100346335 151
69 3300009098 Ga0105245_10282164 Ga0105245_102821642 151
70 3300009101 Ga0105247_10075595 Ga0105247_100755953 151
71 3300009553 Ga0105249_12170438 Ga0105249_121704382 151
72 3300009553 Ga0105249_12456027 Ga0105249_124560271 151
73 3300013105 Ga0157369_10008567 Ga0157369_1000856714 151
74 3300013296 Ga0157374_10095353 Ga0157374_100953532 151
75 3300014326 Ga0157380_10046758 Ga0157380_100467585 151
76 3300014326 Ga0157380_10564542 Ga0157380_105645422 151
77 3300014745 Ga0157377_10404261 Ga0157377_104042612 151
78 3300014745 Ga0157377_10914538 Ga0157377_109145381 151
79 3300025912 Ga0207707_10222453 Ga0207707_102224532 151
80 3300025935 Ga0207709_11409646 Ga0207709_114096461 151
81 3300025972 Ga0207668_10253038 Ga0207668_102530383 151
82 3300031250 Ga0265331_10081675 Ga0265331_100816752 151
83 3300044694 Ga0466963_0187759 Ga0466963_0187759_622_1083 151
84 3300045976 Ga0466967_0430878 Ga0466967_0430878_27_506 151
85 3300046615 Ga0495656_0707089 Ga0495656_0707089_70_528 151
86 3300048910 Ga0496107_0699170 Ga0496107_0699170_214_672 151
87 3300049571 Ga0501034_0023099 Ga0501034_0023099_3521_3991 151
88 3300049572 Ga0501036_0039523 Ga0501036_0039523_1456_1926 151
89 3300049572 Ga0501036_0316531 Ga0501036_0316531_672_1169 151
90 3300049572 Ga0501036_0463401 Ga0501036_0463401_550_1029 151
91 3300049572 Ga0501036_0606801 Ga0501036_0606801_166_630 151
92 3300049574 Ga0501038_0008832 Ga0501038_0008832_4362_4826 151
93 3300049574 Ga0501038_0036774 Ga0501038_0036774_335_805 151
94 3300049574 Ga0501038_0104900 Ga0501038_0104900_553_1032 151
95 3300049579 Ga0501043_0045910 Ga0501043_0045910_430_909 151
96 3300049580 Ga0501046_0144378 Ga0501046_0144378_312_782 151
97 3300049581 Ga0501047_0054296 Ga0501047_0054296_2259_2723 151
98 3300049581 Ga0501047_0062754 Ga0501047_0062754_1681_2151 151
99 3300049581 Ga0501047_0333100 Ga0501047_0333100_127_606 151
100 3300049582 Ga0501048_0568307 Ga0501048_0568307_151_615 151
101 3300049582 Ga0501048_1062450 Ga0501048_1062450_28_498 151
102 3300049585 Ga0501069_0056137 Ga0501069_0056137_263_733 151
103 3300049586 Ga0501070_0024235 Ga0501070_0024235_345_815 151
104 3300049586 Ga0501070_0204870 Ga0501070_0204870_121_585 151
105 3300049587 Ga0501071_0024104 Ga0501071_0024104_3467_3937 151
106 3300049590 Ga0501074_0068432 Ga0501074_0068432_1999_2469 151
107 3300049742 Ga0501080_0103000 Ga0501080_0103000_2067_2537 151
108 3300049742 Ga0501080_0378141 Ga0501080_0378141_544_1008 151
109 3300049822 Ga0501035_0010160 Ga0501035_0010160_3379_3849 151
110 3300049822 Ga0501035_0178906 Ga0501035_0178906_862_1326 151
111 3300049823 Ga0501044_0116009 Ga0501044_0116009_1719_2189 151
112 3300049823 Ga0501044_0116324 Ga0501044_0116324_1207_1671 151
113 3300050492 nmdc:mga0yw44_174299_c1 nmdc:mga0yw44_174299_c1_83_541 151
114 3300053090 Ga0500646_0084450 Ga0500646_0084450_102_584 151
115 3300005327 Ga0070658_10196990 Ga0070658_101969902 152
116 3300005336 Ga0070680_100024919 Ga0070680_1000249195 152
117 3300005336 Ga0070680_100412164 Ga0070680_1004121642 152
118 3300005337 Ga0070682_100678550 Ga0070682_1006785501 152
119 3300005341 Ga0070691_10103937 Ga0070691_101039372 152
120 3300005434 Ga0070709_10000261 Ga0070709_1000026120 152
121 3300005435 Ga0070714_100037946 Ga0070714_1000379465 152
122 3300005436 Ga0070713_100040271 Ga0070713_1000402712 152
123 3300005437 Ga0070710_10000210 Ga0070710_100002109 152
124 3300005455 Ga0070663_100273483 Ga0070663_1002734832 152
125 3300005456 Ga0070678_100227867 Ga0070678_1002278672 152
126 3300005458 Ga0070681_10048935 Ga0070681_100489354 152
127 3300005458 Ga0070681_10071418 Ga0070681_100714183 152
128 3300005458 Ga0070681_10368028 Ga0070681_103680282 152
129 3300005530 Ga0070679_100165885 Ga0070679_1001658852 152
130 3300005530 Ga0070679_100387164 Ga0070679_1003871642 152
131 3300005548 Ga0070665_100053032 Ga0070665_1000530323 152
132 3300005563 Ga0068855_100108082 Ga0068855_1001080822 152
133 3300005577 Ga0068857_101082360 Ga0068857_1010823602 152
134 3300005578 Ga0068854_100152560 Ga0068854_1001525602 152
135 3300005578 Ga0068854_100270209 Ga0068854_1002702092 152
136 3300006028 Ga0070717_10947980 Ga0070717_109479802 152
137 3300006028 Ga0070717_11318472 Ga0070717_113184722 152
138 3300006038 Ga0075365_10051895 Ga0075365_100518952 152
139 3300006042 Ga0075368_10035322 Ga0075368_100353222 152
140 3300006042 Ga0075368_10074422 Ga0075368_100744222 152
141 3300006048 Ga0075363_100287963 Ga0075363_1002879632 152
142 3300006173 Ga0070716_100030058 Ga0070716_1000300582 152
143 3300006175 Ga0070712_100024163 Ga0070712_1000241633 152
144 3300006178 Ga0075367_10089319 Ga0075367_100893193 152
145 3300006178 Ga0075367_10447294 Ga0075367_104472942 152
146 3300006195 Ga0075366_10475472 Ga0075366_104754722 152
147 3300006237 Ga0097621_100728402 Ga0097621_1007284022 152
148 3300006353 Ga0075370_10054875 Ga0075370_100548752 152
149 3300009093 Ga0105240_10023872 Ga0105240_100238726 152
150 3300009174 Ga0105241_10059790 Ga0105241_100597904 152
151 3300009176 Ga0105242_10063591 Ga0105242_100635913 152
152 3300009551 Ga0105238_10000577 Ga0105238_1000057721 152
153 3300009551 Ga0105238_10033988 Ga0105238_100339886 152
154 3300010375 Ga0105239_10002730 Ga0105239_100027307 152
155 3300010375 Ga0105239_10006321 Ga0105239_1000632120 152
156 3300013102 Ga0157371_10064895 Ga0157371_100648952 152
157 3300013104 Ga0157370_10131437 Ga0157370_101314373 152
158 3300013104 Ga0157370_10468207 Ga0157370_104682072 152
159 3300013105 Ga0157369_10596161 Ga0157369_105961611 152
160 3300013306 Ga0163162_10155605 Ga0163162_101556052 152
161 3300014325 Ga0163163_10803370 Ga0163163_108033702 152
162 3300014968 Ga0157379_10759465 Ga0157379_107594652 152
163 3300014969 Ga0157376_10298847 Ga0157376_102988472 152
164 3300020082 Ga0206353_10149552 Ga0206353_101495521 152
165 3300025900 Ga0207710_10112344 Ga0207710_101123442 152
166 3300025906 Ga0207699_10001210 Ga0207699_100012105 152
167 3300025909 Ga0207705_10200663 Ga0207705_102006632 152
168 3300025912 Ga0207707_10034632 Ga0207707_100346322 152
169 3300025912 Ga0207707_10119943 Ga0207707_101199432 152
170 3300025912 Ga0207707_10573617 Ga0207707_105736172 152
171 3300025913 Ga0207695_10022692 Ga0207695_1002269210 152
172 3300025913 Ga0207695_10091336 Ga0207695_100913362 152
173 3300025915 Ga0207693_10069824 Ga0207693_100698242 152
174 3300025917 Ga0207660_10014919 Ga0207660_100149192 152
175 3300025917 Ga0207660_10054432 Ga0207660_100544322 152
176 3300025920 Ga0207649_10622862 Ga0207649_106228621 152
177 3300025921 Ga0207652_10178507 Ga0207652_101785071 152
178 3300025921 Ga0207652_10587906 Ga0207652_105879062 152
179 3300025924 Ga0207694_10000273 Ga0207694_1000027356 152
180 3300025928 Ga0207700_10045098 Ga0207700_100450983 152
181 3300025929 Ga0207664_10014428 Ga0207664_100144283 152
182 3300025929 Ga0207664_10031561 Ga0207664_100315612 152
183 3300025939 Ga0207665_10041535 Ga0207665_100415354 152
184 3300025940 Ga0207691_10780630 Ga0207691_107806301 152
185 3300025944 Ga0207661_10659873 Ga0207661_106598732 152
186 3300025949 Ga0207667_10120365 Ga0207667_101203652 152
187 3300025981 Ga0207640_10024770 Ga0207640_100247703 152
188 3300025981 Ga0207640_10265321 Ga0207640_102653212 152
189 3300025981 Ga0207640_10294831 Ga0207640_102948312 152
190 3300026041 Ga0207639_10293963 Ga0207639_102939631 152
191 3300026067 Ga0207678_10066235 Ga0207678_100662353 152
192 3300026089 Ga0207648_11016817 Ga0207648_110168171 152
193 3300026116 Ga0207674_10075312 Ga0207674_100753122 152
194 3300026121 Ga0207683_10307996 Ga0207683_103079962 152
195 3300026142 Ga0207698_10226336 Ga0207698_102263362 152
196 3300026142 Ga0207698_10541709 Ga0207698_105417092 152
197 3300027866 Ga0209813_10161992 Ga0209813_101619922 152
198 3300028379 Ga0268266_10021997 Ga0268266_100219973 152
199 3300028800 Ga0265338_10024838 Ga0265338_100248383 152
200 3300031235 Ga0265330_10009652 Ga0265330_100096523 152
201 3300031241 Ga0265325_10010920 Ga0265325_100109204 152
202 3300031247 Ga0265340_10018433 Ga0265340_100184333 152
203 3300031344 Ga0265316_10151065 Ga0265316_101510652 152
204 3300031548 Ga0307408_100599776 Ga0307408_1005997762 152
205 3300031711 Ga0265314_10020265 Ga0265314_100202651 152
206 3300031712 Ga0265342_10011898 Ga0265342_100118984 152
207 3300031712 Ga0265342_10049095 Ga0265342_100490952 152
208 3300031995 Ga0307409_101579308 Ga0307409_1015793082 152
209 3300032002 Ga0307416_100520317 Ga0307416_1005203171 152
210 3300032005 Ga0307411_10903524 Ga0307411_109035242 152
211 3300035114 Ga0373939_0168874 Ga0373939_0168874_288_749 152
212 3300035242 Ga0373962_0026296 Ga0373962_0026296_610_1071 152
213 3300035691 Ga0373931_0004059 Ga0373931_0004059_4773_5234 152
214 3300035692 Ga0373935_0160484 Ga0373935_0160484_286_747 152
215 3300039453 Ga0436362_0505536 Ga0436362_0505536_150_614 152
216 3300041408 Ga0439453_0055680 Ga0439453_0055680_43_504 152
217 3300042013 Ga0439456_005631 Ga0439456_005631_120_581 152
218 3300046459 Ga0495629_0424726 Ga0495629_0424726_393_851 152
219 3300046462 Ga0495651_0120000 Ga0495651_0120000_1399_1860 152
220 3300046462 Ga0495651_0376206 Ga0495651_0376206_204_662 152
221 3300046523 Ga0495644_0197177 Ga0495644_0197177_189_647 152
222 3300046529 Ga0495652_0673223 Ga0495652_0673223_178_639 152
223 3300046660 Ga0495625_0457460 Ga0495625_0457460_29_547 152
224 3300046683 Ga0495658_0068452 Ga0495658_0068452_75_533 152
225 3300046684 Ga0495669_0349370 Ga0495669_0349370_96_554 152
226 3300046809 Ga0495600_0178910 Ga0495600_0178910_80_538 152
227 3300047315 Ga0495581_0064444 Ga0495581_0064444_882_1340 152
228 3300047322 Ga0495680_0234886 Ga0495680_0234886_544_1002 152
229 3300048903 Ga0496100_0170164 Ga0496100_0170164_464_925 152
230 3300048903 Ga0496100_0440341 Ga0496100_0440341_294_752 152
231 3300048904 Ga0496101_0111646 Ga0496101_0111646_712_1173 152
232 3300048905 Ga0496102_0052448 Ga0496102_0052448_607_1068 152
233 3300048906 Ga0496103_0020039 Ga0496103_0020039_954_1415 152
234 3300048906 Ga0496103_0414236 Ga0496103_0414236_62_520 152
235 3300048907 Ga0496104_0252097 Ga0496104_0252097_1174_1632 152
236 3300048909 Ga0496106_0008322 Ga0496106_0008322_4153_4614 152
237 3300048909 Ga0496106_0078331 Ga0496106_0078331_1576_2034 152
238 3300048910 Ga0496107_0014344 Ga0496107_0014344_2220_2681 152
239 3300048913 Ga0496110_0011875 Ga0496110_0011875_6110_6571 152
240 3300048914 Ga0496111_0015146 Ga0496111_0015146_4019_4480 152
241 3300048915 Ga0496112_0727352 Ga0496112_0727352_37_498 152
242 3300048915 Ga0496112_1290578 Ga0496112_1290578_23_481 152
243 3300048916 Ga0496113_0004759 Ga0496113_0004759_2718_3179 152
244 3300048916 Ga0496113_0635305 Ga0496113_0635305_53_511 152
245 3300048917 Ga0496114_0031891 Ga0496114_0031891_3632_4093 152
246 3300048918 Ga0496115_0152657 Ga0496115_0152657_241_702 152
247 3300048918 Ga0496115_0176283 Ga0496115_0176283_425_883 152
248 3300048922 Ga0496119_0264831 Ga0496119_0264831_267_725 152
249 3300048924 Ga0496121_0089542 Ga0496121_0089542_555_1013 152
250 3300048929 Ga0496126_0323982 Ga0496126_0323982_514_978 152
251 3300050490 nmdc:mga03n38_124071_c1 nmdc:mga03n38_124071_c1_735_1193 152
252 3300050492 nmdc:mga0yw44_367669_c1 nmdc:mga0yw44_367669_c1_21_479 152
253 3300050493 nmdc:mga0k408_212620_c1 nmdc:mga0k408_212620_c1_49_507 152
254 3300050494 nmdc:mga06z11_955657_c1 nmdc:mga06z11_955657_c1_39_506 152
255 3300050495 nmdc:mga04h51_157738_c1 nmdc:mga04h51_157738_c1_112_570 152
256 3300050512 nmdc:mga0n895_778385_c1 nmdc:mga0n895_778385_c1_346_804 152
257 3300053088 Ga0500644_0000753 Ga0500644_0000753_1512_1985 152
258 3300053093 Ga0500651_0011520 Ga0500651_0011520_2814_3275 152
259 3300053131 Ga0500652_001919 Ga0500652_001919_995_1456 152
260 3300053134 Ga0500658_0011848 Ga0500658_0011848_1130_1588 152
261 3300053142 Ga0500577_0248427 Ga0500577_0248427_108_569 152
262 3300053153 Ga0500616_0000002 Ga0500616_0000002_983451_983912 152
263 3300053730 Ga0500645_000252 Ga0500645_000252_26774_27235 152
264 3300053730 Ga0500645_040976 Ga0500645_040976_740_1198 152
265 3300005331 Ga0070670_100202787 Ga0070670_1002027873 153
266 3300005339 Ga0070660_100228074 Ga0070660_1002280742 153
267 3300005340 Ga0070689_100311399 Ga0070689_1003113992 153
268 3300005347 Ga0070668_101536339 Ga0070668_1015363391 153
269 3300005353 Ga0070669_101145280 Ga0070669_1011452801 153
270 3300005354 Ga0070675_101424738 Ga0070675_1014247381 153
271 3300005364 Ga0070673_100100290 Ga0070673_1001002906 153
272 3300005365 Ga0070688_100041703 Ga0070688_1000417031 153
273 3300005367 Ga0070667_100279544 Ga0070667_1002795442 153
274 3300005434 Ga0070709_10347673 Ga0070709_103476732 153
275 3300005435 Ga0070714_100153262 Ga0070714_1001532623 153
276 3300005439 Ga0070711_100216032 Ga0070711_1002160322 153
277 3300005458 Ga0070681_10115574 Ga0070681_101155743 153
278 3300005543 Ga0070672_100054030 Ga0070672_1000540303 153
279 3300005544 Ga0070686_100753878 Ga0070686_1007538782 153
280 3300005548 Ga0070665_100244008 Ga0070665_1002440082 153
281 3300005564 Ga0070664_101282821 Ga0070664_1012828211 153
282 3300005577 Ga0068857_101556984 Ga0068857_1015569841 153
283 3300005617 Ga0068859_100100443 Ga0068859_1001004434 153
284 3300005719 Ga0068861_100652511 Ga0068861_1006525112 153
285 3300006028 Ga0070717_10087927 Ga0070717_100879272 153
286 3300006163 Ga0070715_10489777 Ga0070715_104897771 153
287 3300006175 Ga0070712_100277452 Ga0070712_1002774521 153
288 3300006931 Ga0097620_100100448 Ga0097620_1001004484 153
289 3300007076 Ga0075435_101297309 Ga0075435_1012973091 153
290 3300009148 Ga0105243_10020564 Ga0105243_100205644 153
291 3300009174 Ga0105241_11513428 Ga0105241_115134281 153
292 3300013104 Ga0157370_10373388 Ga0157370_103733881 153
293 3300013296 Ga0157374_10513393 Ga0157374_105133932 153
294 3300014325 Ga0163163_10313012 Ga0163163_103130122 153
295 3300014968 Ga0157379_10606306 Ga0157379_106063061 153
296 3300024227 Ga0228598_1001342 Ga0228598_10013425 153
297 3300025903 Ga0207680_10422890 Ga0207680_104228902 153
298 3300025916 Ga0207663_10257083 Ga0207663_102570832 153
299 3300025917 Ga0207660_10118064 Ga0207660_101180643 153
300 3300025918 Ga0207662_10743115 Ga0207662_107431151 153
301 3300025919 Ga0207657_10711598 Ga0207657_107115981 153
302 3300025924 Ga0207694_10725040 Ga0207694_107250401 153
303 3300025926 Ga0207659_10324274 Ga0207659_103242741 153
304 3300025927 Ga0207687_10516293 Ga0207687_105162931 153
305 3300025928 Ga0207700_10074350 Ga0207700_100743504 153
306 3300025929 Ga0207664_10289400 Ga0207664_102894001 153
307 3300025935 Ga0207709_10048060 Ga0207709_100480602 153
308 3300025936 Ga0207670_10355276 Ga0207670_103552762 153
309 3300025937 Ga0207669_10195511 Ga0207669_101955112 153
310 3300025940 Ga0207691_10080020 Ga0207691_100800203 153
311 3300025941 Ga0207711_10136789 Ga0207711_101367893 153
312 3300025945 Ga0207679_10764354 Ga0207679_107643542 153
313 3300025972 Ga0207668_10330719 Ga0207668_103307191 153
314 3300025972 Ga0207668_11626059 Ga0207668_116260591 153
315 3300026067 Ga0207678_10147831 Ga0207678_101478313 153
316 3300026095 Ga0207676_10391316 Ga0207676_103913162 153
317 3300026118 Ga0207675_100555059 Ga0207675_1005550591 153
318 3300026121 Ga0207683_10786849 Ga0207683_107868492 153
319 3300026121 Ga0207683_10802805 Ga0207683_108028052 153
320 3300028379 Ga0268266_10082247 Ga0268266_100822473 153
321 3300028381 Ga0268264_12637567 Ga0268264_126375671 153
322 3300035086 Ga0373934_0332307 Ga0373934_0332307_106_570 153
323 3300035118 Ga0373954_0318239 Ga0373954_0318239_137_601 153
324 3300035119 Ga0373956_0095221 Ga0373956_0095221_115_579 153
325 3300035692 Ga0373935_0238931 Ga0373935_0238931_76_540 153
326 3300035724 Ga0373933_0071348 Ga0373933_0071348_1612_2076 153
327 3300036401 Ga0373937_1084377 Ga0373937_1084377_57_521 153
328 3300044901 Ga0466960_0788855 Ga0466960_0788855_28_489 153
329 3300046454 Ga0495592_0191798 Ga0495592_0191798_413_877 153
330 3300046462 Ga0495651_0024676 Ga0495651_0024676_4172_4636 153
331 3300046463 Ga0495653_0107431 Ga0495653_0107431_1228_1692 153
332 3300046476 Ga0495662_0226533 Ga0495662_0226533_378_842 153
333 3300046477 Ga0495664_0042411 Ga0495664_0042411_1273_1737 153
334 3300046499 Ga0495594_0123990 Ga0495594_0123990_40_504 153
335 3300046514 Ga0495618_0685713 Ga0495618_0685713_23_487 153
336 3300046516 Ga0495628_0069415 Ga0495628_0069415_2008_2472 153
337 3300046517 Ga0495630_0515959 Ga0495630_0515959_223_687 153
338 3300046529 Ga0495652_0786196 Ga0495652_0786196_41_505 153
339 3300046533 Ga0495640_0105062 Ga0495640_0105062_480_944 153
340 3300046536 Ga0495587_0010933 Ga0495587_0010933_4544_5008 153
341 3300046559 Ga0495667_0045953 Ga0495667_0045953_715_1179 153
342 3300046642 Ga0495634_0187689 Ga0495634_0187689_636_1100 153
343 3300046663 Ga0495635_0631943 Ga0495635_0631943_122_586 153
344 3300046690 Ga0495624_0434352 Ga0495624_0434352_204_668 153
345 3300046809 Ga0495600_0089630 Ga0495600_0089630_393_857 153
346 3300047317 Ga0495604_0107051 Ga0495604_0107051_995_1459 153
347 3300047322 Ga0495680_0397848 Ga0495680_0397848_147_611 153
348 3300047471 Ga0495684_0198669 Ga0495684_0198669_641_1105 153
349 3300047673 Ga0495593_0236323 Ga0495593_0236323_415_879 153
350 3300048088 Ga0495602_0050066 Ga0495602_0050066_1063_1527 153
351 3300048903 Ga0496100_0141071 Ga0496100_0141071_353_817 153
352 3300048904 Ga0496101_1148515 Ga0496101_1148515_131_595 153
353 3300048905 Ga0496102_0461272 Ga0496102_0461272_699_1163 153
354 3300048907 Ga0496104_0006100 Ga0496104_0006100_9989_10453 153
355 3300048907 Ga0496104_0149697 Ga0496104_0149697_563_1027 153
356 3300048908 Ga0496105_0018424 Ga0496105_0018424_1585_2049 153
357 3300048911 Ga0496108_0589067 Ga0496108_0589067_339_803 153
358 3300048912 Ga0496109_0024895 Ga0496109_0024895_1557_2021 153
359 3300048912 Ga0496109_0251551 Ga0496109_0251551_605_1069 153
360 3300048915 Ga0496112_0935360 Ga0496112_0935360_306_770 153
361 3300048917 Ga0496114_0096668 Ga0496114_0096668_1608_2072 153
362 3300048918 Ga0496115_0022612 Ga0496115_0022612_2489_2953 153
363 3300048918 Ga0496115_0248151 Ga0496115_0248151_754_1218 153
364 3300053084 Ga0495595_0012617 Ga0495595_0012617_1779_2243 153
365 3300053085 Ga0495619_0393371 Ga0495619_0393371_436_900 153
366 3300002459 JGI24751J29686_10104580 JGI24751J29686_101045801 154
367 3300003215 JGI25153J46596_10000560 JGI25153J46596_100005609 154
368 3300003354 JGI25160J50197_1003827 JGI25160J50197_10038275 154
369 3300003794 Ga0055531_10003731 Ga0055531_100037314 154
370 3300005262 Ga0065165_1004598 Ga0065165_10045985 154
371 3300005262 Ga0065165_1060899 Ga0065165_10608992 154
372 3300005331 Ga0070670_100337358 Ga0070670_1003373581 154
373 3300005339 Ga0070660_100421867 Ga0070660_1004218671 154
374 3300005347 Ga0070668_100047473 Ga0070668_1000474733 154
375 3300005355 Ga0070671_101593269 Ga0070671_1015932691 154
376 3300005366 Ga0070659_100213216 Ga0070659_1002132162 154
377 3300005455 Ga0070663_100013561 Ga0070663_1000135614 154
378 3300005455 Ga0070663_100109563 Ga0070663_1001095632 154
379 3300005457 Ga0070662_100268101 Ga0070662_1002681012 154
380 3300005457 Ga0070662_100368843 Ga0070662_1003688432 154
381 3300005536 Ga0070697_101715629 Ga0070697_1017156291 154
382 3300005539 Ga0068853_101500504 Ga0068853_1015005041 154
383 3300005548 Ga0070665_100224569 Ga0070665_1002245692 154
384 3300005563 Ga0068855_100734852 Ga0068855_1007348521 154
385 3300005577 Ga0068857_100088811 Ga0068857_1000888114 154
386 3300005616 Ga0068852_100215450 Ga0068852_1002154503 154
387 3300005617 Ga0068859_100588792 Ga0068859_1005887923 154
388 3300005841 Ga0068863_100085365 Ga0068863_1000853655 154
389 3300005842 Ga0068858_100843865 Ga0068858_1008438652 154
390 3300005843 Ga0068860_101322273 Ga0068860_1013222732 154
391 3300006038 Ga0075365_10142828 Ga0075365_101428283 154
392 3300006042 Ga0075368_10017272 Ga0075368_100172723 154
393 3300006048 Ga0075363_100017468 Ga0075363_1000174682 154
394 3300006051 Ga0075364_10148960 Ga0075364_101489602 154
395 3300006175 Ga0070712_100403527 Ga0070712_1004035272 154
396 3300006177 Ga0075362_10529034 Ga0075362_105290341 154
397 3300006178 Ga0075367_10116979 Ga0075367_101169792 154
398 3300006195 Ga0075366_10104244 Ga0075366_101042443 154
399 3300006195 Ga0075366_10137737 Ga0075366_101377372 154
400 3300006358 Ga0068871_101026812 Ga0068871_1010268121 154
401 3300006931 Ga0097620_100588787 Ga0097620_1005887873 154
402 3300006941 Ga0099825_1037919 Ga0099825_10379192 154
403 3300006942 Ga0099824_1036906 Ga0099824_10369061 154
404 3300006944 Ga0099823_1015403 Ga0099823_10154036 154
405 3300009093 Ga0105240_10111074 Ga0105240_101110745 154
406 3300009148 Ga0105243_10740964 Ga0105243_107409642 154
407 3300009177 Ga0105248_10038686 Ga0105248_100386862 154
408 3300009545 Ga0105237_10381640 Ga0105237_103816401 154
409 3300009545 Ga0105237_10867833 Ga0105237_108678332 154
410 3300010375 Ga0105239_10052776 Ga0105239_100527762 154
411 3300010375 Ga0105239_10430323 Ga0105239_104303232 154
412 3300011119 Ga0105246_10044664 Ga0105246_100446645 154
413 3300013296 Ga0157374_10751862 Ga0157374_107518621 154
414 3300014325 Ga0163163_10650854 Ga0163163_106508541 154
415 3300021321 Ga0214542_1000058 Ga0214542_100005817 154
416 3300021321 Ga0214542_1025427 Ga0214542_10254272 154
417 3300021324 Ga0214545_1000026 Ga0214545_1000026113 154
418 3300021324 Ga0214545_1016362 Ga0214545_10163625 154
419 3300021327 Ga0214543_1002325 Ga0214543_100232517 154
420 3300021327 Ga0214543_1031379 Ga0214543_10313792 154
421 3300025245 Ga0207425_1042066 Ga0207425_10420662 154
422 3300025258 Ga0209129_1051943 Ga0209129_10519431 154
423 3300025295 Ga0209564_1004700 Ga0209564_10047007 154
424 3300025295 Ga0209564_1005701 Ga0209564_10057013 154
425 3300025297 Ga0209758_1000011 Ga0209758_1000011916 154
426 3300025297 Ga0209758_1000940 Ga0209758_10009403 154
427 3300025297 Ga0209758_1001336 Ga0209758_100133617 154
428 3300025299 Ga0209256_1025400 Ga0209256_10254002 154
429 3300025302 Ga0207426_1004163 Ga0207426_10041638 154
430 3300025304 Ga0209257_1000158 Ga0209257_100015816 154
431 3300025304 Ga0209257_1014253 Ga0209257_10142536 154
432 3300025304 Ga0209257_1025655 Ga0209257_10256553 154
433 3300025304 Ga0209257_1093316 Ga0209257_10933162 154
434 3300025901 Ga0207688_10108686 Ga0207688_101086862 154
435 3300025903 Ga0207680_10406771 Ga0207680_104067712 154
436 3300025904 Ga0207647_10002857 Ga0207647_1000285716 154
437 3300025904 Ga0207647_10325881 Ga0207647_103258811 154
438 3300025909 Ga0207705_10788485 Ga0207705_107884852 154
439 3300025914 Ga0207671_10049790 Ga0207671_100497905 154
440 3300025914 Ga0207671_10941489 Ga0207671_109414892 154
441 3300025915 Ga0207693_10312774 Ga0207693_103127741 154
442 3300025919 Ga0207657_10943293 Ga0207657_109432931 154
443 3300025923 Ga0207681_10564332 Ga0207681_105643321 154
444 3300025925 Ga0207650_10366702 Ga0207650_103667022 154
445 3300025931 Ga0207644_10287027 Ga0207644_102870272 154
446 3300025932 Ga0207690_10415108 Ga0207690_104151082 154
447 3300025932 Ga0207690_10792413 Ga0207690_107924132 154
448 3300025933 Ga0207706_10121113 Ga0207706_101211132 154
449 3300025933 Ga0207706_10504587 Ga0207706_105045872 154
450 3300025935 Ga0207709_11206876 Ga0207709_112068761 154
451 3300025940 Ga0207691_10573623 Ga0207691_105736232 154
452 3300025941 Ga0207711_10289924 Ga0207711_102899242 154
453 3300025961 Ga0207712_10804055 Ga0207712_108040551 154
454 3300025972 Ga0207668_10129544 Ga0207668_101295443 154
455 3300026035 Ga0207703_10151346 Ga0207703_101513462 154
456 3300026041 Ga0207639_11366888 Ga0207639_113668881 154
457 3300026067 Ga0207678_10092129 Ga0207678_100921292 154
458 3300026067 Ga0207678_10766338 Ga0207678_107663382 154
459 3300026088 Ga0207641_11286072 Ga0207641_112860721 154
460 3300026116 Ga0207674_10155357 Ga0207674_101553572 154
461 3300026118 Ga0207675_100989443 Ga0207675_1009894431 154
462 3300026142 Ga0207698_11186375 Ga0207698_111863752 154
463 3300027296 Ga0209389_1000073 Ga0209389_100007314 154
464 3300027296 Ga0209389_1000160 Ga0209389_10001605 154
465 3300027357 Ga0209589_1000484 Ga0209589_10004845 154
466 3300027361 Ga0209489_100917 Ga0209489_1009177 154
467 3300027361 Ga0209489_100982 Ga0209489_10098239 154
468 3300027363 Ga0209700_100067 Ga0209700_10006714 154
469 3300027866 Ga0209813_10225101 Ga0209813_102251011 154
470 3300028379 Ga0268266_10114683 Ga0268266_101146832 154
471 3300031251 Ga0265327_10135276 Ga0265327_101352761 154
472 3300031595 Ga0265313_10018461 Ga0265313_100184614 154
473 3300035111 Ga0373923_0011100 Ga0373923_0011100_902_1366 154
474 3300035117 Ga0373953_0021843 Ga0373953_0021843_280_744 154
475 3300035118 Ga0373954_0064007 Ga0373954_0064007_1189_1653 154
476 3300035119 Ga0373956_0019909 Ga0373956_0019909_149_613 154
477 3300035120 Ga0373957_0095771 Ga0373957_0095771_388_852 154
478 3300035172 Ga0373955_0051660 Ga0373955_0051660_48_512 154
479 3300035241 Ga0373961_0059894 Ga0373961_0059894_197_739 154
480 3300035410 Ga0373924_0103180 Ga0373924_0103180_177_641 154
481 3300035724 Ga0373933_0060893 Ga0373933_0060893_1280_1744 154
482 3300036401 Ga0373937_0014381 Ga0373937_0014381_5587_6051 154
483 3300037418 Ga0395900_0317933 Ga0395900_0317933_938_1402 154
484 3300037466 Ga0395898_1295562 Ga0395898_1295562_137_601 154
485 3300038443 Ga0395901_0267384 Ga0395901_0267384_707_1171 154
486 3300041509 Ga0451843_0662871 Ga0451843_0662871_631_1095 154
487 3300042012 Ga0439455_0082568 Ga0439455_0082568_370_834 154
488 3300044658 Ga0466972_0143869 Ga0466972_0143869_379_843 154
489 3300044658 Ga0466972_0239876 Ga0466972_0239876_143_607 154
490 3300044683 Ga0466965_0029688 Ga0466965_0029688_1548_2012 154
491 3300044683 Ga0466965_0278880 Ga0466965_0278880_379_843 154
492 3300046454 Ga0495592_0039033 Ga0495592_0039033_1103_1567 154
493 3300046457 Ga0495590_0109117 Ga0495590_0109117_174_638 154
494 3300046459 Ga0495629_0042353 Ga0495629_0042353_1941_2405 154
495 3300046463 Ga0495653_0088251 Ga0495653_0088251_1016_1480 154
496 3300046492 Ga0495585_0156756 Ga0495585_0156756_280_744 154
497 3300046501 Ga0495607_0238425 Ga0495607_0238425_154_618 154
498 3300046506 Ga0495583_0099738 Ga0495583_0099738_663_1127 154
499 3300046512 Ga0495610_0183335 Ga0495610_0183335_151_615 154
500 3300046513 Ga0495616_0015442 Ga0495616_0015442_123_587 154
501 3300046514 Ga0495618_0118927 Ga0495618_0118927_751_1215 154
502 3300046516 Ga0495628_0108289 Ga0495628_0108289_1252_1716 154
503 3300046529 Ga0495652_0022074 Ga0495652_0022074_4380_4844 154
504 3300046533 Ga0495640_0170787 Ga0495640_0170787_113_577 154
505 3300046536 Ga0495587_0165902 Ga0495587_0165902_533_997 154
506 3300046542 Ga0495597_0023924 Ga0495597_0023924_1268_1732 154
507 3300046543 Ga0495645_0106584 Ga0495645_0106584_1070_1534 154
508 3300046559 Ga0495667_0116418 Ga0495667_0116418_248_712 154
509 3300046616 Ga0495668_0028092 Ga0495668_0028092_1575_2039 154
510 3300046642 Ga0495634_0048984 Ga0495634_0048984_1287_1751 154
511 3300046663 Ga0495635_0045516 Ga0495635_0045516_980_1444 154
512 3300046675 Ga0495657_0372748 Ga0495657_0372748_259_723 154
513 3300046678 Ga0495599_0026974 Ga0495599_0026974_1300_1764 154
514 3300046679 Ga0495623_0000341 Ga0495623_0000341_23714_24178 154
515 3300046680 Ga0495646_0285246 Ga0495646_0285246_229_693 154
516 3300046689 Ga0495613_0324368 Ga0495613_0324368_133_597 154
517 3300046809 Ga0495600_0004899 Ga0495600_0004899_7045_7509 154
518 3300047317 Ga0495604_0195533 Ga0495604_0195533_410_874 154
519 3300047319 Ga0495674_0194142 Ga0495674_0194142_627_1091 154
520 3300047322 Ga0495680_0070998 Ga0495680_0070998_248_712 154
521 3300047323 Ga0495683_0061528 Ga0495683_0061528_663_1127 154
522 3300047443 Ga0495687_012034 Ga0495687_012034_3046_3510 154
523 3300047444 Ga0495675_0165001 Ga0495675_0165001_248_712 154
524 3300047445 Ga0495677_0204527 Ga0495677_0204527_243_707 154
525 3300047471 Ga0495684_0006898 Ga0495684_0006898_7795_8259 154
526 3300047673 Ga0495593_0055198 Ga0495593_0055198_410_874 154
527 3300048088 Ga0495602_0093108 Ga0495602_0093108_661_1125 154
528 3300048903 Ga0496100_0444289 Ga0496100_0444289_110_574 154
529 3300048904 Ga0496101_1301156 Ga0496101_1301156_67_531 154
530 3300048905 Ga0496102_0053235 Ga0496102_0053235_3126_3590 154
531 3300048905 Ga0496102_0188945 Ga0496102_0188945_1287_1751 154
532 3300048906 Ga0496103_0010003 Ga0496103_0010003_4080_4544 154
533 3300048907 Ga0496104_0990835 Ga0496104_0990835_212_676 154
534 3300048908 Ga0496105_0084393 Ga0496105_0084393_343_807 154
535 3300048908 Ga0496105_0291140 Ga0496105_0291140_576_1040 154
536 3300048909 Ga0496106_0736498 Ga0496106_0736498_215_679 154
537 3300048911 Ga0496108_0178539 Ga0496108_0178539_1162_1626 154
538 3300048912 Ga0496109_0086022 Ga0496109_0086022_736_1200 154
539 3300048913 Ga0496110_0802640 Ga0496110_0802640_30_494 154
540 3300048914 Ga0496111_0136596 Ga0496111_0136596_842_1306 154
541 3300048915 Ga0496112_0169525 Ga0496112_0169525_46_510 154
542 3300048916 Ga0496113_0047490 Ga0496113_0047490_1061_1525 154
543 3300048918 Ga0496115_0855456 Ga0496115_0855456_126_590 154
544 3300048919 Ga0496116_0288610 Ga0496116_0288610_210_674 154
545 3300048921 Ga0496118_0087768 Ga0496118_0087768_382_846 154
546 3300048922 Ga0496119_0085667 Ga0496119_0085667_1269_1733 154
547 3300048923 Ga0496120_0236471 Ga0496120_0236471_301_765 154
548 3300048925 Ga0496122_0030192 Ga0496122_0030192_2129_2608 154
549 3300048926 Ga0496123_0030511 Ga0496123_0030511_3395_3874 154
550 3300048927 Ga0496124_0054449 Ga0496124_0054449_1088_1552 154
551 3300048927 Ga0496124_0248331 Ga0496124_0248331_569_1048 154
552 3300048927 Ga0496124_0311801 Ga0496124_0311801_329_793 154
553 3300048928 Ga0496125_0581198 Ga0496125_0581198_89_553 154
554 3300048929 Ga0496126_0047239 Ga0496126_0047239_2672_3136 154
555 3300048929 Ga0496126_1140048 Ga0496126_1140048_35_499 154
556 3300049822 Ga0501035_0243547 Ga0501035_0243547_985_1455 154
557 3300050489 nmdc:mga03683_94282_c1 nmdc:mga03683_94282_c1_585_1049 154
558 3300050490 nmdc:mga03n38_195692_c1 nmdc:mga03n38_195692_c1_367_831 154
559 3300050492 nmdc:mga0yw44_62046_c1 nmdc:mga0yw44_62046_c1_1257_1721 154
560 3300050492 nmdc:mga0yw44_984002_c1 nmdc:mga0yw44_984002_c1_10_489 154
561 3300050493 nmdc:mga0k408_107167_c1 nmdc:mga0k408_107167_c1_1092_1556 154
562 3300050493 nmdc:mga0k408_138269_c1 nmdc:mga0k408_138269_c1_711_1175 154
563 3300050494 nmdc:mga06z11_30363_c1 nmdc:mga06z11_30363_c1_1079_1543 154
564 3300050495 nmdc:mga04h51_42895_c1 nmdc:mga04h51_42895_c1_725_1189 154
565 3300050496 nmdc:mga07m45_32276_c1 nmdc:mga07m45_32276_c1_238_702 154
566 3300050516 nmdc:mga0sz30_122956_c1 nmdc:mga0sz30_122956_c1_362_826 154
567 3300050516 nmdc:mga0sz30_78966_c1 nmdc:mga0sz30_78966_c1_445_909 154
568 3300053085 Ga0495619_0009683 Ga0495619_0009683_4961_5425 154
569 3300053086 Ga0500578_0064541 Ga0500578_0064541_1026_1490 154
570 3300053153 Ga0500616_0005915 Ga0500616_0005915_4825_5289 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

90

185

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m4w-assembly1.cif.gz_D crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin 0.988 79 153
6m4v-assembly2.cif.gz_D crystal structure of mbp fused split fkbp in complex with rapamycin 0.9846 79 153
2y78-assembly1.cif.gz_A-2 crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei 0.9791 38 150
4ggq-assembly4.cif.gz_D crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9765 37 150
4dz2-assembly1.cif.gz_A crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506 0.9755 37 150
ID Description Score Start End Superfamily
1n1aB00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9648 45 153 3.10.50.40
af_B0G119_2_111_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.961 44 153 3.10.50.40
6b4pB00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9587 45 153 3.10.50.40
5b8iC00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9531 44 153 3.10.50.40
1jvwA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9506 38 152 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A4Q7G8R6-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9998 39 153 GO:0006457
GO:0140839
GO:0140840
AF-A0A7V7JLY4-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9978 36 153 GO:0003677
GO:0003755
GO:0006457
GO:0030527
AF-A0A3N5GY91-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9976 39 153 GO:0006457
GO:0140839
GO:0140840
AF-A0A321LIW6-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9951 38 153 GO:0016020
GO:0140839
GO:0140840
AF-A0A257PMH8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9942 38 153 GO:0006457
GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
84.37 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map