F464796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 315 | 569 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10103937|Ga0070691_101039372 |
| Length | 188 |
| Sequence | MSIVGPRVKSAPAETGAIATVYDAGRVRRPRTEFLMHAFARAVAILALVAGFGVAVEAAAIAPAAAQTAGKKIMTTASGLKYTDETVGTGPSPKPGQTAVVHYTGWLYVNGVKGAKFDSSVDRNEPFSFPVGKGRVIKGWDEGVATMKVGGKRTLIIPPALGYGASGAGGVIPPNATLMFDVELLAVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 63 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 64 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 92 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 93 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 94 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 95 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 192 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 193 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 194 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 195 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 307 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 309 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 310 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 311 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 313 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 315 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.63 |
| Nodule | 2.81 |
| Rhizoplane | 10.7 |
| Rhizosphere | 70.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10104580 | 3300002459 | Bacteria | 592 |
| 2 | JGI25153J46596_10000560 | 3300003215 | Bacteria | 23047 |
| 3 | JGI25160J50197_1003827 | 3300003354 | Bacteria | 6610 |
| 4 | Ga0055531_10003731 | 3300003794 | Bacteria | 9573 |
| 5 | Ga0065165_1004598 | 3300005262 | Bacteria | 8400 |
| 6 | Ga0065165_1060899 | 3300005262 | Bacteria | 1035 |
| 7 | Ga0070658_10196990 | 3300005327 | Bacteria | 1699 |
| 8 | Ga0070670_100202787 | 3300005331 | Bacteria | 1724 |
| 9 | Ga0070670_100337358 | 3300005331 | Bacteria | 1323 |
| 10 | Ga0070680_100024919 | 3300005336 | Bacteria | 4782 |
| 11 | Ga0070680_100214640 | 3300005336 | Bacteria | 1624 |
| 12 | Ga0070680_100412164 | 3300005336 | Bacteria | 1152 |
| 13 | Ga0070682_100678550 | 3300005337 | Bacteria | 824 |
| 14 | Ga0070660_100228074 | 3300005339 | Bacteria | 1515 |
| 15 | Ga0070660_100421867 | 3300005339 | Bacteria | 1105 |
| 16 | Ga0070689_100311399 | 3300005340 | Bacteria | 1313 |
| 17 | Ga0070691_10103937 | 3300005341 | Bacteria | 1414 |
| 18 | Ga0070668_100047473 | 3300005347 | Bacteria | 3301 |
| 19 | Ga0070668_101536339 | 3300005347 | Bacteria | 609 |
| 20 | Ga0070669_101145280 | 3300005353 | Bacteria | 671 |
| 21 | Ga0070675_100172821 | 3300005354 | Bacteria | 1864 |
| 22 | Ga0070675_101424738 | 3300005354 | Bacteria | 639 |
| 23 | Ga0070671_101593269 | 3300005355 | Bacteria | 579 |
| 24 | Ga0070674_100074026 | 3300005356 | Bacteria | 2416 |
| 25 | Ga0070673_100100290 | 3300005364 | Bacteria | 2383 |
| 26 | Ga0070673_101049537 | 3300005364 | Bacteria | 760 |
| 27 | Ga0070688_100041703 | 3300005365 | Bacteria | 2819 |
| 28 | Ga0070659_100213216 | 3300005366 | Bacteria | 1592 |
| 29 | Ga0070667_100279544 | 3300005367 | Bacteria | 1499 |
| 30 | Ga0070709_10000261 | 3300005434 | Bacteria | 33691 |
| 31 | Ga0070709_10347673 | 3300005434 | Bacteria | 1095 |
| 32 | Ga0070714_100037946 | 3300005435 | Bacteria | 4051 |
| 33 | Ga0070714_100153262 | 3300005435 | Bacteria | 2078 |
| 34 | Ga0070714_100325728 | 3300005435 | Bacteria | 1438 |
| 35 | Ga0070713_100040271 | 3300005436 | Bacteria | 3798 |
| 36 | Ga0070710_10000210 | 3300005437 | Bacteria | 27444 |
| 37 | Ga0070710_10046737 | 3300005437 | Bacteria | 2412 |
| 38 | Ga0070711_100025996 | 3300005439 | Bacteria | 3833 |
| 39 | Ga0070711_100216032 | 3300005439 | Bacteria | 1488 |
| 40 | Ga0070663_100013561 | 3300005455 | Bacteria | 5202 |
| 41 | Ga0070663_100109563 | 3300005455 | Bacteria | 2073 |
| 42 | Ga0070663_100273483 | 3300005455 | Bacteria | 1344 |
| 43 | Ga0070678_100076771 | 3300005456 | Bacteria | 2518 |
| 44 | Ga0070678_100227867 | 3300005456 | Bacteria | 1552 |
| 45 | Ga0070662_100268101 | 3300005457 | Bacteria | 1378 |
| 46 | Ga0070662_100368843 | 3300005457 | Bacteria | 1179 |
| 47 | Ga0070681_10048935 | 3300005458 | Bacteria | 4223 |
| 48 | Ga0070681_10071418 | 3300005458 | Bacteria | 3436 |
| 49 | Ga0070681_10115574 | 3300005458 | Bacteria | 2621 |
| 50 | Ga0070681_10134729 | 3300005458 | Bacteria | 2401 |
| 51 | Ga0070681_10368028 | 3300005458 | Bacteria | 1348 |
| 52 | Ga0070679_100165885 | 3300005530 | Bacteria | 2182 |
| 53 | Ga0070679_100387164 | 3300005530 | Bacteria | 1345 |
| 54 | Ga0070679_100794068 | 3300005530 | Bacteria | 890 |
| 55 | Ga0070679_101485394 | 3300005530 | Bacteria | 624 |
| 56 | Ga0070697_101715629 | 3300005536 | Bacteria | 562 |
| 57 | Ga0068853_100526611 | 3300005539 | Bacteria | 1118 |
| 58 | Ga0068853_101500504 | 3300005539 | Bacteria | 653 |
| 59 | Ga0070672_100054030 | 3300005543 | Bacteria | 3143 |
| 60 | Ga0070686_100753878 | 3300005544 | Bacteria | 781 |
| 61 | Ga0070665_100053032 | 3300005548 | Bacteria | 4067 |
| 62 | Ga0070665_100224569 | 3300005548 | Bacteria | 1878 |
| 63 | Ga0070665_100244008 | 3300005548 | Bacteria | 1797 |
| 64 | Ga0068855_100108082 | 3300005563 | Bacteria | 3195 |
| 65 | Ga0068855_100734852 | 3300005563 | Bacteria | 1054 |
| 66 | Ga0070664_101282821 | 3300005564 | Bacteria | 692 |
| 67 | Ga0068857_100088811 | 3300005577 | Bacteria | 2765 |
| 68 | Ga0068857_101082360 | 3300005577 | Bacteria | 774 |
| 69 | Ga0068857_101556984 | 3300005577 | Bacteria | 645 |
| 70 | Ga0068854_100152560 | 3300005578 | Bacteria | 1783 |
| 71 | Ga0068854_100270209 | 3300005578 | Bacteria | 1365 |
| 72 | Ga0068852_100215450 | 3300005616 | Bacteria | 1824 |
| 73 | Ga0068859_100100443 | 3300005617 | Bacteria | 2949 |
| 74 | Ga0068859_100588792 | 3300005617 | Bacteria | 1206 |
| 75 | Ga0068861_100652511 | 3300005719 | Bacteria | 972 |
| 76 | Ga0068863_100085365 | 3300005841 | Bacteria | 2991 |
| 77 | Ga0068858_100843865 | 3300005842 | Bacteria | 895 |
| 78 | Ga0068860_101322273 | 3300005843 | Bacteria | 742 |
| 79 | Ga0070717_10087927 | 3300006028 | Bacteria | 2618 |
| 80 | Ga0070717_10947980 | 3300006028 | Bacteria | 784 |
| 81 | Ga0070717_11318472 | 3300006028 | Bacteria | 656 |
| 82 | Ga0075365_10034633 | 3300006038 | Bacteria | 3262 |
| 83 | Ga0075365_10047090 | 3300006038 | Bacteria | 2833 |
| 84 | Ga0075365_10051895 | 3300006038 | Bacteria | 2710 |
| 85 | Ga0075365_10142828 | 3300006038 | Bacteria | 1662 |
| 86 | Ga0075368_10017272 | 3300006042 | Bacteria | 2699 |
| 87 | Ga0075368_10035322 | 3300006042 | Bacteria | 1950 |
| 88 | Ga0075368_10074422 | 3300006042 | Bacteria | 1376 |
| 89 | Ga0075363_100017468 | 3300006048 | Bacteria | 3558 |
| 90 | Ga0075363_100287963 | 3300006048 | Bacteria | 951 |
| 91 | Ga0075364_10148960 | 3300006051 | Bacteria | 1576 |
| 92 | Ga0075364_10461733 | 3300006051 | Bacteria | 868 |
| 93 | Ga0070715_10419022 | 3300006163 | Bacteria | 749 |
| 94 | Ga0070715_10489777 | 3300006163 | Bacteria | 702 |
| 95 | Ga0070716_100030058 | 3300006173 | Bacteria | 2943 |
| 96 | Ga0070712_100024163 | 3300006175 | Bacteria | 4023 |
| 97 | Ga0070712_100096022 | 3300006175 | Bacteria | 2182 |
| 98 | Ga0070712_100277452 | 3300006175 | Bacteria | 1349 |
| 99 | Ga0070712_100403527 | 3300006175 | Bacteria | 1129 |
| 100 | Ga0075362_10058713 | 3300006177 | Bacteria | 1736 |
| 101 | Ga0075362_10529034 | 3300006177 | Bacteria | 605 |
| 102 | Ga0075367_10089319 | 3300006178 | Bacteria | 1873 |
| 103 | Ga0075367_10116979 | 3300006178 | Bacteria | 1640 |
| 104 | Ga0075367_10298117 | 3300006178 | Bacteria | 1015 |
| 105 | Ga0075367_10447294 | 3300006178 | Bacteria | 819 |
| 106 | Ga0075366_10104244 | 3300006195 | Bacteria | 1704 |
| 107 | Ga0075366_10137737 | 3300006195 | Bacteria | 1475 |
| 108 | Ga0075366_10475472 | 3300006195 | Bacteria | 772 |
| 109 | Ga0097621_100728402 | 3300006237 | Bacteria | 915 |
| 110 | Ga0075370_10054875 | 3300006353 | Bacteria | 2263 |
| 111 | Ga0068871_101026812 | 3300006358 | Bacteria | 769 |
| 112 | Ga0097620_100100448 | 3300006931 | Bacteria | 2949 |
| 113 | Ga0097620_100588787 | 3300006931 | Bacteria | 1206 |
| 114 | Ga0099825_1037919 | 3300006941 | Bacteria | 1565 |
| 115 | Ga0099824_1036906 | 3300006942 | Bacteria | 1389 |
| 116 | Ga0099823_1015403 | 3300006944 | Bacteria | 7581 |
| 117 | Ga0075435_101297309 | 3300007076 | Bacteria | 638 |
| 118 | Ga0099795_10168293 | 3300007788 | Bacteria | 909 |
| 119 | Ga0105240_10023872 | 3300009093 | Bacteria | 8077 |
| 120 | Ga0105240_10111074 | 3300009093 | Bacteria | 3317 |
| 121 | Ga0105245_10282164 | 3300009098 | Bacteria | 1624 |
| 122 | Ga0105247_10075595 | 3300009101 | Bacteria | 2114 |
| 123 | Ga0105243_10020564 | 3300009148 | Bacteria | 5004 |
| 124 | Ga0105243_10740964 | 3300009148 | Bacteria | 962 |
| 125 | Ga0105241_10059790 | 3300009174 | Bacteria | 2931 |
| 126 | Ga0105241_11513428 | 3300009174 | Bacteria | 646 |
| 127 | Ga0105242_10063591 | 3300009176 | Bacteria | 3039 |
| 128 | Ga0105248_10038686 | 3300009177 | Bacteria | 5339 |
| 129 | Ga0105237_10381640 | 3300009545 | Bacteria | 1414 |
| 130 | Ga0105237_10867833 | 3300009545 | Bacteria | 909 |
| 131 | Ga0105238_10000577 | 3300009551 | Bacteria | 38524 |
| 132 | Ga0105238_10033988 | 3300009551 | Bacteria | 5188 |
| 133 | Ga0105238_11772453 | 3300009551 | Bacteria | 649 |
| 134 | Ga0105249_12170438 | 3300009553 | Bacteria | 628 |
| 135 | Ga0105249_12456027 | 3300009553 | Bacteria | 594 |
| 136 | Ga0105239_10002730 | 3300010375 | Bacteria | 22163 |
| 137 | Ga0105239_10006321 | 3300010375 | Bacteria | 13782 |
| 138 | Ga0105239_10052776 | 3300010375 | Bacteria | 4459 |
| 139 | Ga0105239_10430323 | 3300010375 | Bacteria | 1496 |
| 140 | Ga0105246_10044664 | 3300011119 | Bacteria | 3012 |
| 141 | Ga0157371_10064895 | 3300013102 | Bacteria | 2586 |
| 142 | Ga0157370_10131437 | 3300013104 | Bacteria | 2335 |
| 143 | Ga0157370_10373388 | 3300013104 | Bacteria | 1314 |
| 144 | Ga0157370_10468207 | 3300013104 | Bacteria | 1158 |
| 145 | Ga0157369_10008567 | 3300013105 | Bacteria | 11731 |
| 146 | Ga0157369_10596161 | 3300013105 | Bacteria | 1141 |
| 147 | Ga0157374_10095353 | 3300013296 | Bacteria | 2845 |
| 148 | Ga0157374_10513393 | 3300013296 | Bacteria | 1204 |
| 149 | Ga0157374_10751862 | 3300013296 | Bacteria | 989 |
| 150 | Ga0163162_10155605 | 3300013306 | Bacteria | 2406 |
| 151 | Ga0163163_10313012 | 3300014325 | Bacteria | 1623 |
| 152 | Ga0163163_10650854 | 3300014325 | Bacteria | 1117 |
| 153 | Ga0163163_10803370 | 3300014325 | Bacteria | 1004 |
| 154 | Ga0157380_10046758 | 3300014326 | Bacteria | 3401 |
| 155 | Ga0157380_10564542 | 3300014326 | Bacteria | 1119 |
| 156 | Ga0157377_10404261 | 3300014745 | Bacteria | 931 |
| 157 | Ga0157377_10914538 | 3300014745 | Bacteria | 657 |
| 158 | Ga0157379_10606306 | 3300014968 | Bacteria | 1022 |
| 159 | Ga0157379_10759465 | 3300014968 | Bacteria | 913 |
| 160 | Ga0157376_10298847 | 3300014969 | Bacteria | 1523 |
| 161 | Ga0182005_1212271 | 3300015265 | Bacteria | 586 |
| 162 | Ga0206353_10149552 | 3300020082 | Bacteria | 1929 |
| 163 | Ga0214542_1000058 | 3300021321 | Bacteria | 133923 |
| 164 | Ga0214542_1025427 | 3300021321 | Bacteria | 3092 |
| 165 | Ga0214545_1000026 | 3300021324 | Bacteria | 133811 |
| 166 | Ga0214545_1016362 | 3300021324 | Bacteria | 7682 |
| 167 | Ga0214543_1002325 | 3300021327 | Bacteria | 37311 |
| 168 | Ga0214543_1031379 | 3300021327 | Bacteria | 2123 |
| 169 | Ga0228598_1001342 | 3300024227 | Bacteria | 5411 |
| 170 | Ga0207425_1042066 | 3300025245 | Bacteria | 866 |
| 171 | Ga0209129_1051943 | 3300025258 | Bacteria | 624 |
| 172 | Ga0209564_1004700 | 3300025295 | Bacteria | 8186 |
| 173 | Ga0209564_1005701 | 3300025295 | Bacteria | 6979 |
| 174 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 175 | Ga0209758_1000940 | 3300025297 | Bacteria | 39289 |
| 176 | Ga0209758_1001336 | 3300025297 | Bacteria | 29877 |
| 177 | Ga0209256_1025400 | 3300025299 | Bacteria | 1725 |
| 178 | Ga0207426_1004163 | 3300025302 | Bacteria | 7231 |
| 179 | Ga0209257_1000158 | 3300025304 | Bacteria | 180079 |
| 180 | Ga0209257_1014253 | 3300025304 | Bacteria | 3432 |
| 181 | Ga0209257_1025655 | 3300025304 | Bacteria | 2008 |
| 182 | Ga0209257_1093316 | 3300025304 | Bacteria | 747 |
| 183 | Ga0207710_10112344 | 3300025900 | Bacteria | 1294 |
| 184 | Ga0207688_10108686 | 3300025901 | Bacteria | 1608 |
| 185 | Ga0207680_10406771 | 3300025903 | Bacteria | 962 |
| 186 | Ga0207680_10422890 | 3300025903 | Bacteria | 944 |
| 187 | Ga0207647_10002857 | 3300025904 | Bacteria | 13013 |
| 188 | Ga0207647_10325881 | 3300025904 | Bacteria | 872 |
| 189 | Ga0207699_10001210 | 3300025906 | Bacteria | 12240 |
| 190 | Ga0207705_10200663 | 3300025909 | Bacteria | 1511 |
| 191 | Ga0207705_10788485 | 3300025909 | Bacteria | 738 |
| 192 | Ga0207707_10034632 | 3300025912 | Bacteria | 4418 |
| 193 | Ga0207707_10079987 | 3300025912 | Bacteria | 2854 |
| 194 | Ga0207707_10119943 | 3300025912 | Bacteria | 2299 |
| 195 | Ga0207707_10222453 | 3300025912 | Bacteria | 1643 |
| 196 | Ga0207707_10573617 | 3300025912 | Bacteria | 957 |
| 197 | Ga0207707_10726693 | 3300025912 | Bacteria | 832 |
| 198 | Ga0207695_10022692 | 3300025913 | Bacteria | 7113 |
| 199 | Ga0207695_10091336 | 3300025913 | Bacteria | 3059 |
| 200 | Ga0207695_10323027 | 3300025913 | Bacteria | 1433 |
| 201 | Ga0207671_10049790 | 3300025914 | Bacteria | 3102 |
| 202 | Ga0207671_10941489 | 3300025914 | Bacteria | 682 |
| 203 | Ga0207693_10069824 | 3300025915 | Bacteria | 2749 |
| 204 | Ga0207693_10312774 | 3300025915 | Bacteria | 1230 |
| 205 | Ga0207663_10257083 | 3300025916 | Bacteria | 1288 |
| 206 | Ga0207660_10014919 | 3300025917 | Bacteria | 5122 |
| 207 | Ga0207660_10054432 | 3300025917 | Bacteria | 2856 |
| 208 | Ga0207660_10118064 | 3300025917 | Bacteria | 2006 |
| 209 | Ga0207660_10293694 | 3300025917 | Bacteria | 1293 |
| 210 | Ga0207662_10743115 | 3300025918 | Bacteria | 689 |
| 211 | Ga0207657_10711598 | 3300025919 | Bacteria | 780 |
| 212 | Ga0207657_10943293 | 3300025919 | Bacteria | 664 |
| 213 | Ga0207649_10622862 | 3300025920 | Bacteria | 832 |
| 214 | Ga0207652_10178507 | 3300025921 | Bacteria | 1907 |
| 215 | Ga0207652_10587906 | 3300025921 | Bacteria | 999 |
| 216 | Ga0207652_11356633 | 3300025921 | Bacteria | 614 |
| 217 | Ga0207681_10564332 | 3300025923 | Bacteria | 938 |
| 218 | Ga0207694_10000273 | 3300025924 | Bacteria | 49024 |
| 219 | Ga0207694_10725040 | 3300025924 | Bacteria | 839 |
| 220 | Ga0207650_10366702 | 3300025925 | Bacteria | 1187 |
| 221 | Ga0207659_10324274 | 3300025926 | Bacteria | 1271 |
| 222 | Ga0207687_10516293 | 3300025927 | Bacteria | 999 |
| 223 | Ga0207700_10045098 | 3300025928 | Bacteria | 3251 |
| 224 | Ga0207700_10074350 | 3300025928 | Bacteria | 2628 |
| 225 | Ga0207664_10014428 | 3300025929 | Bacteria | 5705 |
| 226 | Ga0207664_10031561 | 3300025929 | Bacteria | 4054 |
| 227 | Ga0207664_10289400 | 3300025929 | Bacteria | 1439 |
| 228 | Ga0207664_10324633 | 3300025929 | Bacteria | 1358 |
| 229 | Ga0207644_10287027 | 3300025931 | Bacteria | 1322 |
| 230 | Ga0207690_10415108 | 3300025932 | Bacteria | 1076 |
| 231 | Ga0207690_10792413 | 3300025932 | Bacteria | 783 |
| 232 | Ga0207706_10121113 | 3300025933 | Bacteria | 2301 |
| 233 | Ga0207706_10504587 | 3300025933 | Bacteria | 1044 |
| 234 | Ga0207709_10048060 | 3300025935 | Bacteria | 2598 |
| 235 | Ga0207709_11206876 | 3300025935 | Bacteria | 623 |
| 236 | Ga0207709_11409646 | 3300025935 | Bacteria | 577 |
| 237 | Ga0207670_10355276 | 3300025936 | Bacteria | 1161 |
| 238 | Ga0207669_10195511 | 3300025937 | Bacteria | 1463 |
| 239 | Ga0207665_10041535 | 3300025939 | Bacteria | 3072 |
| 240 | Ga0207691_10080020 | 3300025940 | Bacteria | 2940 |
| 241 | Ga0207691_10573623 | 3300025940 | Bacteria | 956 |
| 242 | Ga0207691_10780630 | 3300025940 | Bacteria | 803 |
| 243 | Ga0207711_10136789 | 3300025941 | Bacteria | 2201 |
| 244 | Ga0207711_10289924 | 3300025941 | Bacteria | 1508 |
| 245 | Ga0207661_10659873 | 3300025944 | Bacteria | 961 |
| 246 | Ga0207679_10764354 | 3300025945 | Bacteria | 879 |
| 247 | Ga0207667_10120365 | 3300025949 | Bacteria | 2705 |
| 248 | Ga0207712_10804055 | 3300025961 | Bacteria | 827 |
| 249 | Ga0207668_10129544 | 3300025972 | Bacteria | 1924 |
| 250 | Ga0207668_10253038 | 3300025972 | Bacteria | 1432 |
| 251 | Ga0207668_10330719 | 3300025972 | Bacteria | 1268 |
| 252 | Ga0207668_11626059 | 3300025972 | Bacteria | 583 |
| 253 | Ga0207640_10024770 | 3300025981 | Bacteria | 3625 |
| 254 | Ga0207640_10265321 | 3300025981 | Bacteria | 1340 |
| 255 | Ga0207640_10294831 | 3300025981 | Bacteria | 1280 |
| 256 | Ga0207703_10151346 | 3300026035 | Bacteria | 2024 |
| 257 | Ga0207639_10293963 | 3300026041 | Bacteria | 1433 |
| 258 | Ga0207639_11366888 | 3300026041 | Bacteria | 665 |
| 259 | Ga0207678_10066235 | 3300026067 | Bacteria | 3102 |
| 260 | Ga0207678_10092129 | 3300026067 | Bacteria | 2590 |
| 261 | Ga0207678_10147831 | 3300026067 | Bacteria | 2006 |
| 262 | Ga0207678_10766338 | 3300026067 | Bacteria | 851 |
| 263 | Ga0207641_11286072 | 3300026088 | Bacteria | 732 |
| 264 | Ga0207648_11016817 | 3300026089 | Bacteria | 776 |
| 265 | Ga0207676_10391316 | 3300026095 | Bacteria | 1297 |
| 266 | Ga0207674_10075312 | 3300026116 | Bacteria | 3385 |
| 267 | Ga0207674_10155357 | 3300026116 | Bacteria | 2243 |
| 268 | Ga0207675_100555059 | 3300026118 | Bacteria | 1148 |
| 269 | Ga0207675_100989443 | 3300026118 | Bacteria | 859 |
| 270 | Ga0207683_10307996 | 3300026121 | Bacteria | 1449 |
| 271 | Ga0207683_10786849 | 3300026121 | Bacteria | 883 |
| 272 | Ga0207683_10802805 | 3300026121 | Bacteria | 873 |
| 273 | Ga0207698_10226336 | 3300026142 | Bacteria | 1694 |
| 274 | Ga0207698_10541709 | 3300026142 | Bacteria | 1139 |
| 275 | Ga0207698_11186375 | 3300026142 | Bacteria | 777 |
| 276 | Ga0209389_1000073 | 3300027296 | Bacteria | 94298 |
| 277 | Ga0209389_1000160 | 3300027296 | Bacteria | 56126 |
| 278 | Ga0209589_1000484 | 3300027357 | Bacteria | 56126 |
| 279 | Ga0209489_100917 | 3300027361 | Bacteria | 58978 |
| 280 | Ga0209489_100982 | 3300027361 | Bacteria | 57399 |
| 281 | Ga0209700_100067 | 3300027363 | Bacteria | 144074 |
| 282 | Ga0209179_1025995 | 3300027512 | Bacteria | 1172 |
| 283 | Ga0209813_10161992 | 3300027866 | Bacteria | 808 |
| 284 | Ga0209813_10225101 | 3300027866 | Bacteria | 704 |
| 285 | Ga0268266_10021997 | 3300028379 | Bacteria | 5435 |
| 286 | Ga0268266_10082247 | 3300028379 | Bacteria | 2809 |
| 287 | Ga0268266_10114683 | 3300028379 | Bacteria | 2391 |
| 288 | Ga0268264_12637567 | 3300028381 | Bacteria | 507 |
| 289 | Ga0265338_10024838 | 3300028800 | Bacteria | 6106 |
| 290 | Ga0265330_10009652 | 3300031235 | Bacteria | 4576 |
| 291 | Ga0265325_10010920 | 3300031241 | Bacteria | 5232 |
| 292 | Ga0265340_10018433 | 3300031247 | Bacteria | 3600 |
| 293 | Ga0265331_10081675 | 3300031250 | Bacteria | 1500 |
| 294 | Ga0265327_10135276 | 3300031251 | Bacteria | 1156 |
| 295 | Ga0265316_10151065 | 3300031344 | Bacteria | 1740 |
| 296 | Ga0307408_100599776 | 3300031548 | Bacteria | 978 |
| 297 | Ga0265313_10018461 | 3300031595 | Bacteria | 3913 |
| 298 | Ga0307508_10000008 | 3300031616 | Bacteria | 265023 |
| 299 | Ga0265314_10020265 | 3300031711 | Bacteria | 5135 |
| 300 | Ga0265342_10011898 | 3300031712 | Bacteria | 5920 |
| 301 | Ga0265342_10049095 | 3300031712 | Bacteria | 2527 |
| 302 | Ga0307409_101579308 | 3300031995 | Bacteria | 684 |
| 303 | Ga0307416_100520317 | 3300032002 | Bacteria | 1258 |
| 304 | Ga0307411_10903524 | 3300032005 | Bacteria | 785 |
| 305 | Ga0373934_0332307 | 3300035086 | Bacteria | 632 |
| 306 | Ga0373923_0011100 | 3300035111 | Bacteria | 3296 |
| 307 | Ga0373939_0168874 | 3300035114 | Bacteria | 808 |
| 308 | Ga0373953_0021843 | 3300035117 | Bacteria | 2406 |
| 309 | Ga0373954_0005019 | 3300035118 | Bacteria | 5712 |
| 310 | Ga0373954_0064007 | 3300035118 | Bacteria | 1738 |
| 311 | Ga0373954_0318239 | 3300035118 | Bacteria | 768 |
| 312 | Ga0373956_0019909 | 3300035119 | Bacteria | 2850 |
| 313 | Ga0373956_0095221 | 3300035119 | Bacteria | 1377 |
| 314 | Ga0373956_0186124 | 3300035119 | Bacteria | 982 |
| 315 | Ga0373957_0095771 | 3300035120 | Bacteria | 1184 |
| 316 | Ga0373955_0051660 | 3300035172 | Bacteria | 2239 |
| 317 | Ga0373955_0190686 | 3300035172 | Bacteria | 1218 |
| 318 | Ga0373961_0059894 | 3300035241 | Bacteria | 1152 |
| 319 | Ga0373962_0026296 | 3300035242 | Bacteria | 1568 |
| 320 | Ga0373924_0103180 | 3300035410 | Bacteria | 1228 |
| 321 | Ga0373931_0004059 | 3300035691 | Bacteria | 6635 |
| 322 | Ga0373935_0160484 | 3300035692 | Bacteria | 1532 |
| 323 | Ga0373935_0238931 | 3300035692 | Bacteria | 1268 |
| 324 | Ga0373933_0014929 | 3300035724 | Bacteria | 4325 |
| 325 | Ga0373933_0060893 | 3300035724 | Bacteria | 2276 |
| 326 | Ga0373933_0071348 | 3300035724 | Bacteria | 2114 |
| 327 | Ga0373937_0014381 | 3300036401 | Bacteria | 6987 |
| 328 | Ga0373937_0016707 | 3300036401 | Bacteria | 6521 |
| 329 | Ga0373937_0102273 | 3300036401 | Bacteria | 2660 |
| 330 | Ga0373937_1084377 | 3300036401 | Bacteria | 749 |
| 331 | Ga0373937_1979711 | 3300036401 | Bacteria | 529 |
| 332 | Ga0395900_0317933 | 3300037418 | Bacteria | 1538 |
| 333 | Ga0395898_1295562 | 3300037466 | Bacteria | 658 |
| 334 | Ga0395901_0267384 | 3300038443 | Bacteria | 1779 |
| 335 | Ga0436362_0505536 | 3300039453 | Bacteria | 1004 |
| 336 | Ga0439453_0055680 | 3300041408 | Bacteria | 808 |
| 337 | Ga0451843_0662871 | 3300041509 | Bacteria | 1808 |
| 338 | Ga0439455_0082568 | 3300042012 | Bacteria | 875 |
| 339 | Ga0439456_005631 | 3300042013 | Bacteria | 2545 |
| 340 | Ga0466972_0143869 | 3300044658 | Bacteria | 1122 |
| 341 | Ga0466972_0239876 | 3300044658 | Bacteria | 848 |
| 342 | Ga0453683_0121072 | 3300044673 | Bacteria | 1647 |
| 343 | Ga0466965_0029688 | 3300044683 | Bacteria | 2661 |
| 344 | Ga0466965_0278880 | 3300044683 | Bacteria | 902 |
| 345 | Ga0466963_0024458 | 3300044694 | Bacteria | 3846 |
| 346 | Ga0466963_0187759 | 3300044694 | Bacteria | 1444 |
| 347 | Ga0466963_0213303 | 3300044694 | Bacteria | 1351 |
| 348 | Ga0466960_0788855 | 3300044901 | Bacteria | 574 |
| 349 | Ga0451576_0010701 | 3300045051 | Bacteria | 10504 |
| 350 | Ga0466967_0430878 | 3300045976 | Bacteria | 1286 |
| 351 | Ga0495592_0039033 | 3300046454 | Bacteria | 3569 |
| 352 | Ga0495592_0191798 | 3300046454 | Bacteria | 1384 |
| 353 | Ga0495590_0109117 | 3300046457 | Bacteria | 987 |
| 354 | Ga0495629_0042353 | 3300046459 | Bacteria | 3200 |
| 355 | Ga0495629_0424726 | 3300046459 | Bacteria | 902 |
| 356 | Ga0495651_0024676 | 3300046462 | Bacteria | 4677 |
| 357 | Ga0495651_0120000 | 3300046462 | Bacteria | 1933 |
| 358 | Ga0495651_0376206 | 3300046462 | Bacteria | 932 |
| 359 | Ga0495653_0088251 | 3300046463 | Bacteria | 2275 |
| 360 | Ga0495653_0107431 | 3300046463 | Bacteria | 2011 |
| 361 | Ga0495662_0226533 | 3300046476 | Bacteria | 922 |
| 362 | Ga0495664_0042411 | 3300046477 | Bacteria | 2695 |
| 363 | Ga0495585_0156756 | 3300046492 | Bacteria | 1184 |
| 364 | Ga0495594_0123990 | 3300046499 | Bacteria | 1461 |
| 365 | Ga0495607_0238425 | 3300046501 | Bacteria | 881 |
| 366 | Ga0495583_0099738 | 3300046506 | Bacteria | 1241 |
| 367 | Ga0495610_0183335 | 3300046512 | Bacteria | 869 |
| 368 | Ga0495616_0015442 | 3300046513 | Bacteria | 4248 |
| 369 | Ga0495618_0118927 | 3300046514 | Bacteria | 1692 |
| 370 | Ga0495618_0685713 | 3300046514 | Bacteria | 603 |
| 371 | Ga0495628_0069415 | 3300046516 | Bacteria | 2748 |
| 372 | Ga0495628_0108289 | 3300046516 | Bacteria | 2139 |
| 373 | Ga0495630_0515959 | 3300046517 | Bacteria | 916 |
| 374 | Ga0495644_0197177 | 3300046523 | Bacteria | 776 |
| 375 | Ga0495652_0022074 | 3300046529 | Bacteria | 5652 |
| 376 | Ga0495652_0673223 | 3300046529 | Bacteria | 699 |
| 377 | Ga0495652_0786196 | 3300046529 | Bacteria | 634 |
| 378 | Ga0495640_0042612 | 3300046533 | Bacteria | 3165 |
| 379 | Ga0495640_0105062 | 3300046533 | Bacteria | 1850 |
| 380 | Ga0495640_0170787 | 3300046533 | Bacteria | 1389 |
| 381 | Ga0495587_0010933 | 3300046536 | Bacteria | 5758 |
| 382 | Ga0495587_0165902 | 3300046536 | Bacteria | 1255 |
| 383 | Ga0495597_0023924 | 3300046542 | Bacteria | 2823 |
| 384 | Ga0495645_0106584 | 3300046543 | Bacteria | 1987 |
| 385 | Ga0495667_0045953 | 3300046559 | Bacteria | 2888 |
| 386 | Ga0495667_0116418 | 3300046559 | Bacteria | 1726 |
| 387 | Ga0495667_0178462 | 3300046559 | Bacteria | 1364 |
| 388 | Ga0495656_0707089 | 3300046615 | Bacteria | 542 |
| 389 | Ga0495668_0028092 | 3300046616 | Bacteria | 3183 |
| 390 | Ga0495634_0048984 | 3300046642 | Bacteria | 2842 |
| 391 | Ga0495634_0187689 | 3300046642 | Bacteria | 1291 |
| 392 | Ga0495625_0457460 | 3300046660 | Bacteria | 787 |
| 393 | Ga0495635_0045516 | 3300046663 | Bacteria | 3028 |
| 394 | Ga0495635_0631943 | 3300046663 | Bacteria | 697 |
| 395 | Ga0495657_0372748 | 3300046675 | Bacteria | 842 |
| 396 | Ga0495599_0026974 | 3300046678 | Bacteria | 3599 |
| 397 | Ga0495623_0000341 | 3300046679 | Bacteria | 30684 |
| 398 | Ga0495646_0285246 | 3300046680 | Bacteria | 876 |
| 399 | Ga0495658_0068452 | 3300046683 | Bacteria | 2056 |
| 400 | Ga0495669_0349370 | 3300046684 | Bacteria | 715 |
| 401 | Ga0495613_0324368 | 3300046689 | Bacteria | 1062 |
| 402 | Ga0495624_0434352 | 3300046690 | Bacteria | 787 |
| 403 | Ga0495600_0004899 | 3300046809 | Bacteria | 8041 |
| 404 | Ga0495600_0089630 | 3300046809 | Bacteria | 2006 |
| 405 | Ga0495600_0178910 | 3300046809 | Bacteria | 1367 |
| 406 | Ga0495581_0064444 | 3300047315 | Bacteria | 2117 |
| 407 | Ga0495604_0107051 | 3300047317 | Bacteria | 2044 |
| 408 | Ga0495604_0195533 | 3300047317 | Bacteria | 1406 |
| 409 | Ga0495674_0194142 | 3300047319 | Bacteria | 1686 |
| 410 | Ga0495680_0070998 | 3300047322 | Bacteria | 2652 |
| 411 | Ga0495680_0234886 | 3300047322 | Bacteria | 1304 |
| 412 | Ga0495680_0397848 | 3300047322 | Bacteria | 951 |
| 413 | Ga0495680_0414872 | 3300047322 | Bacteria | 927 |
| 414 | Ga0495683_0061528 | 3300047323 | Bacteria | 1859 |
| 415 | Ga0495687_012034 | 3300047443 | Bacteria | 4602 |
| 416 | Ga0495675_0165001 | 3300047444 | Bacteria | 1362 |
| 417 | Ga0495677_0204527 | 3300047445 | Bacteria | 768 |
| 418 | Ga0495684_0006898 | 3300047471 | Bacteria | 8816 |
| 419 | Ga0495684_0198669 | 3300047471 | Bacteria | 1479 |
| 420 | Ga0495593_0055198 | 3300047673 | Bacteria | 2091 |
| 421 | Ga0495593_0236323 | 3300047673 | Bacteria | 916 |
| 422 | Ga0495602_0050066 | 3300048088 | Bacteria | 3736 |
| 423 | Ga0495602_0093108 | 3300048088 | Bacteria | 2494 |
| 424 | Ga0495602_0685029 | 3300048088 | Bacteria | 697 |
| 425 | Ga0496100_0073278 | 3300048903 | Bacteria | 2291 |
| 426 | Ga0496100_0141071 | 3300048903 | Bacteria | 1708 |
| 427 | Ga0496100_0170164 | 3300048903 | Bacteria | 1568 |
| 428 | Ga0496100_0440341 | 3300048903 | Bacteria | 998 |
| 429 | Ga0496100_0444289 | 3300048903 | Bacteria | 993 |
| 430 | Ga0496100_0452993 | 3300048903 | Bacteria | 984 |
| 431 | Ga0496101_0111646 | 3300048904 | Bacteria | 2058 |
| 432 | Ga0496101_1148515 | 3300048904 | Bacteria | 609 |
| 433 | Ga0496101_1301156 | 3300048904 | Bacteria | 568 |
| 434 | Ga0496102_0052448 | 3300048905 | Bacteria | 3716 |
| 435 | Ga0496102_0053235 | 3300048905 | Bacteria | 3689 |
| 436 | Ga0496102_0188945 | 3300048905 | Bacteria | 1941 |
| 437 | Ga0496102_0461272 | 3300048905 | Bacteria | 1191 |
| 438 | Ga0496103_0010003 | 3300048906 | Bacteria | 5610 |
| 439 | Ga0496103_0020039 | 3300048906 | Bacteria | 4016 |
| 440 | Ga0496103_0414236 | 3300048906 | Bacteria | 865 |
| 441 | Ga0496104_0006100 | 3300048907 | Bacteria | 10578 |
| 442 | Ga0496104_0149697 | 3300048907 | Bacteria | 2241 |
| 443 | Ga0496104_0250767 | 3300048907 | Bacteria | 1683 |
| 444 | Ga0496104_0252097 | 3300048907 | Bacteria | 1678 |
| 445 | Ga0496104_0990835 | 3300048907 | Bacteria | 744 |
| 446 | Ga0496105_0018424 | 3300048908 | Bacteria | 5611 |
| 447 | Ga0496105_0084393 | 3300048908 | Bacteria | 2624 |
| 448 | Ga0496105_0291140 | 3300048908 | Bacteria | 1314 |
| 449 | Ga0496106_0008322 | 3300048909 | Bacteria | 7676 |
| 450 | Ga0496106_0078331 | 3300048909 | Bacteria | 2536 |
| 451 | Ga0496106_0080504 | 3300048909 | Bacteria | 2501 |
| 452 | Ga0496106_0736498 | 3300048909 | Bacteria | 784 |
| 453 | Ga0496107_0011233 | 3300048910 | Bacteria | 6232 |
| 454 | Ga0496107_0014344 | 3300048910 | Bacteria | 5548 |
| 455 | Ga0496107_0699170 | 3300048910 | Bacteria | 746 |
| 456 | Ga0496108_0000884 | 3300048911 | Bacteria | 23347 |
| 457 | Ga0496108_0178539 | 3300048911 | Bacteria | 1838 |
| 458 | Ga0496108_0589067 | 3300048911 | Bacteria | 969 |
| 459 | Ga0496109_0000680 | 3300048912 | Bacteria | 28264 |
| 460 | Ga0496109_0024895 | 3300048912 | Bacteria | 5328 |
| 461 | Ga0496109_0086022 | 3300048912 | Bacteria | 2903 |
| 462 | Ga0496109_0251551 | 3300048912 | Bacteria | 1664 |
| 463 | Ga0496110_0011875 | 3300048913 | Bacteria | 7153 |
| 464 | Ga0496110_0025539 | 3300048913 | Bacteria | 5049 |
| 465 | Ga0496110_0802640 | 3300048913 | Bacteria | 845 |
| 466 | Ga0496111_0015146 | 3300048914 | Bacteria | 5285 |
| 467 | Ga0496111_0120136 | 3300048914 | Bacteria | 1941 |
| 468 | Ga0496111_0136596 | 3300048914 | Bacteria | 1816 |
| 469 | Ga0496112_0012627 | 3300048915 | Bacteria | 7765 |
| 470 | Ga0496112_0169525 | 3300048915 | Bacteria | 2148 |
| 471 | Ga0496112_0727352 | 3300048915 | Bacteria | 919 |
| 472 | Ga0496112_0935360 | 3300048915 | Bacteria | 788 |
| 473 | Ga0496112_1290578 | 3300048915 | Bacteria | 646 |
| 474 | Ga0496113_0004759 | 3300048916 | Bacteria | 8382 |
| 475 | Ga0496113_0010432 | 3300048916 | Bacteria | 6144 |
| 476 | Ga0496113_0047490 | 3300048916 | Bacteria | 3190 |
| 477 | Ga0496113_0635305 | 3300048916 | Bacteria | 854 |
| 478 | Ga0496114_0031891 | 3300048917 | Bacteria | 4334 |
| 479 | Ga0496114_0096668 | 3300048917 | Bacteria | 2515 |
| 480 | Ga0496115_0022612 | 3300048918 | Bacteria | 4874 |
| 481 | Ga0496115_0097185 | 3300048918 | Bacteria | 2412 |
| 482 | Ga0496115_0152657 | 3300048918 | Bacteria | 1907 |
| 483 | Ga0496115_0176283 | 3300048918 | Bacteria | 1768 |
| 484 | Ga0496115_0248151 | 3300048918 | Bacteria | 1466 |
| 485 | Ga0496115_0855456 | 3300048918 | Bacteria | 704 |
| 486 | Ga0496116_0288610 | 3300048919 | Bacteria | 789 |
| 487 | Ga0496118_0087768 | 3300048921 | Bacteria | 2155 |
| 488 | Ga0496119_0085667 | 3300048922 | Bacteria | 1803 |
| 489 | Ga0496119_0264831 | 3300048922 | Bacteria | 861 |
| 490 | Ga0496120_0236471 | 3300048923 | Bacteria | 865 |
| 491 | Ga0496121_0089542 | 3300048924 | Bacteria | 2409 |
| 492 | Ga0496122_0030192 | 3300048925 | Bacteria | 4551 |
| 493 | Ga0496123_0030511 | 3300048926 | Bacteria | 3945 |
| 494 | Ga0496124_0054449 | 3300048927 | Bacteria | 3386 |
| 495 | Ga0496124_0248331 | 3300048927 | Bacteria | 1318 |
| 496 | Ga0496124_0311801 | 3300048927 | Bacteria | 1131 |
| 497 | Ga0496125_0581198 | 3300048928 | Bacteria | 615 |
| 498 | Ga0496126_0047239 | 3300048929 | Bacteria | 3942 |
| 499 | Ga0496126_0323982 | 3300048929 | Bacteria | 1266 |
| 500 | Ga0496126_1140048 | 3300048929 | Bacteria | 577 |
| 501 | Ga0501034_0023099 | 3300049571 | Bacteria | 6337 |
| 502 | Ga0501036_0039523 | 3300049572 | Bacteria | 3992 |
| 503 | Ga0501036_0316531 | 3300049572 | Bacteria | 1304 |
| 504 | Ga0501036_0463401 | 3300049572 | Bacteria | 1055 |
| 505 | Ga0501036_0606801 | 3300049572 | Bacteria | 907 |
| 506 | Ga0501038_0008832 | 3300049574 | Bacteria | 9243 |
| 507 | Ga0501038_0036774 | 3300049574 | Bacteria | 4296 |
| 508 | Ga0501038_0104900 | 3300049574 | Bacteria | 2348 |
| 509 | Ga0501039_0954829 | 3300049575 | Bacteria | 667 |
| 510 | Ga0501043_0045910 | 3300049579 | Bacteria | 3434 |
| 511 | Ga0501046_0144378 | 3300049580 | Bacteria | 1798 |
| 512 | Ga0501047_0054296 | 3300049581 | Bacteria | 3875 |
| 513 | Ga0501047_0062754 | 3300049581 | Bacteria | 3584 |
| 514 | Ga0501047_0333100 | 3300049581 | Bacteria | 1356 |
| 515 | Ga0501048_0568307 | 3300049582 | Bacteria | 814 |
| 516 | Ga0501048_1062450 | 3300049582 | Bacteria | 582 |
| 517 | Ga0501069_0056137 | 3300049585 | Bacteria | 2193 |
| 518 | Ga0501070_0024235 | 3300049586 | Bacteria | 5088 |
| 519 | Ga0501070_0204870 | 3300049586 | Bacteria | 1620 |
| 520 | Ga0501071_0024104 | 3300049587 | Bacteria | 4253 |
| 521 | Ga0501072_0934317 | 3300049588 | Bacteria | 677 |
| 522 | Ga0501074_0068432 | 3300049590 | Bacteria | 2552 |
| 523 | Ga0501080_0103000 | 3300049742 | Bacteria | 2647 |
| 524 | Ga0501080_0378141 | 3300049742 | Bacteria | 1276 |
| 525 | Ga0501035_0010160 | 3300049822 | Bacteria | 8736 |
| 526 | Ga0501035_0178906 | 3300049822 | Bacteria | 1828 |
| 527 | Ga0501035_0243547 | 3300049822 | Bacteria | 1529 |
| 528 | Ga0501044_0116009 | 3300049823 | Bacteria | 2683 |
| 529 | Ga0501044_0116324 | 3300049823 | Bacteria | 2679 |
| 530 | nmdc:mga03683_94282_c1 | 3300050489 | Bacteria | 1308 |
| 531 | nmdc:mga03n38_124071_c1 | 3300050490 | Bacteria | 1273 |
| 532 | nmdc:mga03n38_195692_c1 | 3300050490 | Bacteria | 1044 |
| 533 | nmdc:mga0yw44_174299_c1 | 3300050492 | Bacteria | 1413 |
| 534 | nmdc:mga0yw44_367669_c1 | 3300050492 | Bacteria | 970 |
| 535 | nmdc:mga0yw44_62046_c1 | 3300050492 | Bacteria | 2295 |
| 536 | nmdc:mga0yw44_7789_c1 | 3300050492 | Bacteria | 5296 |
| 537 | nmdc:mga0yw44_984002_c1 | 3300050492 | Bacteria | 571 |
| 538 | nmdc:mga0k408_107167_c1 | 3300050493 | Bacteria | 1651 |
| 539 | nmdc:mga0k408_138269_c1 | 3300050493 | Bacteria | 1448 |
| 540 | nmdc:mga0k408_212620_c1 | 3300050493 | Bacteria | 1155 |
| 541 | nmdc:mga06z11_26111_c1 | 3300050494 | Bacteria | 2776 |
| 542 | nmdc:mga06z11_30363_c1 | 3300050494 | Bacteria | 1563 |
| 543 | nmdc:mga06z11_955657_c1 | 3300050494 | Bacteria | 522 |
| 544 | nmdc:mga04h51_157738_c1 | 3300050495 | Bacteria | 871 |
| 545 | nmdc:mga04h51_362125_c1 | 3300050495 | Bacteria | 601 |
| 546 | nmdc:mga04h51_42895_c1 | 3300050495 | Bacteria | 1486 |
| 547 | nmdc:mga07m45_32276_c1 | 3300050496 | Bacteria | 2904 |
| 548 | nmdc:mga0n895_778385_c1 | 3300050512 | Bacteria | 948 |
| 549 | nmdc:mga08x19_167424_c1 | 3300050514 | Bacteria | 1495 |
| 550 | nmdc:mga0sz30_122956_c1 | 3300050516 | Bacteria | 1141 |
| 551 | nmdc:mga0sz30_78966_c1 | 3300050516 | Bacteria | 1423 |
| 552 | Ga0495601_0170045 | 3300053077 | Bacteria | 1425 |
| 553 | Ga0495595_0008422 | 3300053084 | Bacteria | 4231 |
| 554 | Ga0495595_0012617 | 3300053084 | Bacteria | 3555 |
| 555 | Ga0495619_0009683 | 3300053085 | Bacteria | 6075 |
| 556 | Ga0495619_0089093 | 3300053085 | Bacteria | 2087 |
| 557 | Ga0495619_0135907 | 3300053085 | Bacteria | 1691 |
| 558 | Ga0495619_0393371 | 3300053085 | Bacteria | 957 |
| 559 | Ga0500578_0064541 | 3300053086 | Bacteria | 2335 |
| 560 | Ga0500644_0000753 | 3300053088 | Bacteria | 11169 |
| 561 | Ga0500646_0084450 | 3300053090 | Bacteria | 974 |
| 562 | Ga0500651_0011520 | 3300053093 | Bacteria | 5336 |
| 563 | Ga0500652_001919 | 3300053131 | Bacteria | 6255 |
| 564 | Ga0500658_0011848 | 3300053134 | Bacteria | 3215 |
| 565 | Ga0500577_0248427 | 3300053142 | Bacteria | 773 |
| 566 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 567 | Ga0500616_0005915 | 3300053153 | Bacteria | 8176 |
| 568 | Ga0500645_000252 | 3300053730 | Bacteria | 39375 |
| 569 | Ga0500645_040976 | 3300053730 | Bacteria | 1368 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0121072 | Ga0453683_0121072_60_596 | 135 |
| 2 | 3300045051 | Ga0451576_0010701 | Ga0451576_0010701_9172_9681 | 135 |
| 3 | 3300007788 | Ga0099795_10168293 | Ga0099795_101682932 | 136 |
| 4 | 3300025912 | Ga0207707_10726693 | Ga0207707_107266931 | 136 |
| 5 | 3300005354 | Ga0070675_100172821 | Ga0070675_1001728213 | 137 |
| 6 | 3300005530 | Ga0070679_100794068 | Ga0070679_1007940682 | 143 |
| 7 | 3300025912 | Ga0207707_10079987 | Ga0207707_100799873 | 143 |
| 8 | 3300025913 | Ga0207695_10323027 | Ga0207695_103230272 | 143 |
| 9 | 3300025917 | Ga0207660_10293694 | Ga0207660_102936942 | 143 |
| 10 | 3300006163 | Ga0070715_10419022 | Ga0070715_104190222 | 144 |
| 11 | 3300049575 | Ga0501039_0954829 | Ga0501039_0954829_159_620 | 144 |
| 12 | 3300006051 | Ga0075364_10461733 | Ga0075364_104617332 | 145 |
| 13 | 3300044694 | Ga0466963_0024458 | Ga0466963_0024458_416_967 | 145 |
| 14 | 3300049588 | Ga0501072_0934317 | Ga0501072_0934317_64_528 | 145 |
| 15 | 3300050514 | nmdc:mga08x19_167424_c1 | nmdc:mga08x19_167424_c1_662_1132 | 145 |
| 16 | 3300015265 | Ga0182005_1212271 | Ga0182005_12122711 | 146 |
| 17 | 3300025921 | Ga0207652_11356633 | Ga0207652_113566331 | 146 |
| 18 | 3300006038 | Ga0075365_10047090 | Ga0075365_100470904 | 147 |
| 19 | 3300006177 | Ga0075362_10058713 | Ga0075362_100587132 | 147 |
| 20 | 3300006178 | Ga0075367_10298117 | Ga0075367_102981171 | 147 |
| 21 | 3300035118 | Ga0373954_0005019 | Ga0373954_0005019_5215_5685 | 147 |
| 22 | 3300035119 | Ga0373956_0186124 | Ga0373956_0186124_229_699 | 147 |
| 23 | 3300035172 | Ga0373955_0190686 | Ga0373955_0190686_572_1042 | 147 |
| 24 | 3300035724 | Ga0373933_0014929 | Ga0373933_0014929_2705_3175 | 147 |
| 25 | 3300036401 | Ga0373937_0016707 | Ga0373937_0016707_1619_2089 | 147 |
| 26 | 3300036401 | Ga0373937_0102273 | Ga0373937_0102273_291_761 | 147 |
| 27 | 3300036401 | Ga0373937_1979711 | Ga0373937_1979711_38_496 | 147 |
| 28 | 3300046533 | Ga0495640_0042612 | Ga0495640_0042612_2589_3059 | 147 |
| 29 | 3300046559 | Ga0495667_0178462 | Ga0495667_0178462_21_491 | 147 |
| 30 | 3300047322 | Ga0495680_0414872 | Ga0495680_0414872_145_615 | 147 |
| 31 | 3300048088 | Ga0495602_0685029 | Ga0495602_0685029_197_667 | 147 |
| 32 | 3300048903 | Ga0496100_0073278 | Ga0496100_0073278_726_1184 | 147 |
| 33 | 3300048903 | Ga0496100_0452993 | Ga0496100_0452993_419_913 | 147 |
| 34 | 3300048907 | Ga0496104_0250767 | Ga0496104_0250767_336_794 | 147 |
| 35 | 3300048909 | Ga0496106_0080504 | Ga0496106_0080504_1560_2018 | 147 |
| 36 | 3300048910 | Ga0496107_0011233 | Ga0496107_0011233_2649_3107 | 147 |
| 37 | 3300048911 | Ga0496108_0000884 | Ga0496108_0000884_12240_12698 | 147 |
| 38 | 3300048912 | Ga0496109_0000680 | Ga0496109_0000680_24516_24974 | 147 |
| 39 | 3300048913 | Ga0496110_0025539 | Ga0496110_0025539_29_487 | 147 |
| 40 | 3300048914 | Ga0496111_0120136 | Ga0496111_0120136_116_574 | 147 |
| 41 | 3300048915 | Ga0496112_0012627 | Ga0496112_0012627_1767_2225 | 147 |
| 42 | 3300048916 | Ga0496113_0010432 | Ga0496113_0010432_2303_2761 | 147 |
| 43 | 3300048918 | Ga0496115_0097185 | Ga0496115_0097185_127_585 | 147 |
| 44 | 3300050492 | nmdc:mga0yw44_7789_c1 | nmdc:mga0yw44_7789_c1_535_993 | 147 |
| 45 | 3300050494 | nmdc:mga06z11_26111_c1 | nmdc:mga06z11_26111_c1_1424_1882 | 147 |
| 46 | 3300050495 | nmdc:mga04h51_362125_c1 | nmdc:mga04h51_362125_c1_52_510 | 147 |
| 47 | 3300053077 | Ga0495601_0170045 | Ga0495601_0170045_275_733 | 147 |
| 48 | 3300053084 | Ga0495595_0008422 | Ga0495595_0008422_1694_2164 | 147 |
| 49 | 3300053085 | Ga0495619_0089093 | Ga0495619_0089093_1528_1998 | 147 |
| 50 | 3300053085 | Ga0495619_0135907 | Ga0495619_0135907_1037_1507 | 147 |
| 51 | 3300005435 | Ga0070714_100325728 | Ga0070714_1003257282 | 148 |
| 52 | 3300025929 | Ga0207664_10324633 | Ga0207664_103246331 | 148 |
| 53 | 3300005336 | Ga0070680_100214640 | Ga0070680_1002146402 | 150 |
| 54 | 3300005530 | Ga0070679_101485394 | Ga0070679_1014853941 | 150 |
| 55 | 3300005539 | Ga0068853_100526611 | Ga0068853_1005266113 | 150 |
| 56 | 3300006175 | Ga0070712_100096022 | Ga0070712_1000960222 | 150 |
| 57 | 3300009551 | Ga0105238_11772453 | Ga0105238_117724531 | 150 |
| 58 | 3300027512 | Ga0209179_1025995 | Ga0209179_10259952 | 150 |
| 59 | 3300031616 | Ga0307508_10000008 | Ga0307508_1000000822 | 150 |
| 60 | 3300044694 | Ga0466963_0213303 | Ga0466963_0213303_588_1082 | 150 |
| 61 | iso_pu_bacteria | 8019659431 | 8019660584 | 150 |
| 62 | 3300005356 | Ga0070674_100074026 | Ga0070674_1000740264 | 151 |
| 63 | 3300005364 | Ga0070673_101049537 | Ga0070673_1010495371 | 151 |
| 64 | 3300005437 | Ga0070710_10046737 | Ga0070710_100467372 | 151 |
| 65 | 3300005439 | Ga0070711_100025996 | Ga0070711_1000259966 | 151 |
| 66 | 3300005456 | Ga0070678_100076771 | Ga0070678_1000767712 | 151 |
| 67 | 3300005458 | Ga0070681_10134729 | Ga0070681_101347293 | 151 |
| 68 | 3300006038 | Ga0075365_10034633 | Ga0075365_100346335 | 151 |
| 69 | 3300009098 | Ga0105245_10282164 | Ga0105245_102821642 | 151 |
| 70 | 3300009101 | Ga0105247_10075595 | Ga0105247_100755953 | 151 |
| 71 | 3300009553 | Ga0105249_12170438 | Ga0105249_121704382 | 151 |
| 72 | 3300009553 | Ga0105249_12456027 | Ga0105249_124560271 | 151 |
| 73 | 3300013105 | Ga0157369_10008567 | Ga0157369_1000856714 | 151 |
| 74 | 3300013296 | Ga0157374_10095353 | Ga0157374_100953532 | 151 |
| 75 | 3300014326 | Ga0157380_10046758 | Ga0157380_100467585 | 151 |
| 76 | 3300014326 | Ga0157380_10564542 | Ga0157380_105645422 | 151 |
| 77 | 3300014745 | Ga0157377_10404261 | Ga0157377_104042612 | 151 |
| 78 | 3300014745 | Ga0157377_10914538 | Ga0157377_109145381 | 151 |
| 79 | 3300025912 | Ga0207707_10222453 | Ga0207707_102224532 | 151 |
| 80 | 3300025935 | Ga0207709_11409646 | Ga0207709_114096461 | 151 |
| 81 | 3300025972 | Ga0207668_10253038 | Ga0207668_102530383 | 151 |
| 82 | 3300031250 | Ga0265331_10081675 | Ga0265331_100816752 | 151 |
| 83 | 3300044694 | Ga0466963_0187759 | Ga0466963_0187759_622_1083 | 151 |
| 84 | 3300045976 | Ga0466967_0430878 | Ga0466967_0430878_27_506 | 151 |
| 85 | 3300046615 | Ga0495656_0707089 | Ga0495656_0707089_70_528 | 151 |
| 86 | 3300048910 | Ga0496107_0699170 | Ga0496107_0699170_214_672 | 151 |
| 87 | 3300049571 | Ga0501034_0023099 | Ga0501034_0023099_3521_3991 | 151 |
| 88 | 3300049572 | Ga0501036_0039523 | Ga0501036_0039523_1456_1926 | 151 |
| 89 | 3300049572 | Ga0501036_0316531 | Ga0501036_0316531_672_1169 | 151 |
| 90 | 3300049572 | Ga0501036_0463401 | Ga0501036_0463401_550_1029 | 151 |
| 91 | 3300049572 | Ga0501036_0606801 | Ga0501036_0606801_166_630 | 151 |
| 92 | 3300049574 | Ga0501038_0008832 | Ga0501038_0008832_4362_4826 | 151 |
| 93 | 3300049574 | Ga0501038_0036774 | Ga0501038_0036774_335_805 | 151 |
| 94 | 3300049574 | Ga0501038_0104900 | Ga0501038_0104900_553_1032 | 151 |
| 95 | 3300049579 | Ga0501043_0045910 | Ga0501043_0045910_430_909 | 151 |
| 96 | 3300049580 | Ga0501046_0144378 | Ga0501046_0144378_312_782 | 151 |
| 97 | 3300049581 | Ga0501047_0054296 | Ga0501047_0054296_2259_2723 | 151 |
| 98 | 3300049581 | Ga0501047_0062754 | Ga0501047_0062754_1681_2151 | 151 |
| 99 | 3300049581 | Ga0501047_0333100 | Ga0501047_0333100_127_606 | 151 |
| 100 | 3300049582 | Ga0501048_0568307 | Ga0501048_0568307_151_615 | 151 |
| 101 | 3300049582 | Ga0501048_1062450 | Ga0501048_1062450_28_498 | 151 |
| 102 | 3300049585 | Ga0501069_0056137 | Ga0501069_0056137_263_733 | 151 |
| 103 | 3300049586 | Ga0501070_0024235 | Ga0501070_0024235_345_815 | 151 |
| 104 | 3300049586 | Ga0501070_0204870 | Ga0501070_0204870_121_585 | 151 |
| 105 | 3300049587 | Ga0501071_0024104 | Ga0501071_0024104_3467_3937 | 151 |
| 106 | 3300049590 | Ga0501074_0068432 | Ga0501074_0068432_1999_2469 | 151 |
| 107 | 3300049742 | Ga0501080_0103000 | Ga0501080_0103000_2067_2537 | 151 |
| 108 | 3300049742 | Ga0501080_0378141 | Ga0501080_0378141_544_1008 | 151 |
| 109 | 3300049822 | Ga0501035_0010160 | Ga0501035_0010160_3379_3849 | 151 |
| 110 | 3300049822 | Ga0501035_0178906 | Ga0501035_0178906_862_1326 | 151 |
| 111 | 3300049823 | Ga0501044_0116009 | Ga0501044_0116009_1719_2189 | 151 |
| 112 | 3300049823 | Ga0501044_0116324 | Ga0501044_0116324_1207_1671 | 151 |
| 113 | 3300050492 | nmdc:mga0yw44_174299_c1 | nmdc:mga0yw44_174299_c1_83_541 | 151 |
| 114 | 3300053090 | Ga0500646_0084450 | Ga0500646_0084450_102_584 | 151 |
| 115 | 3300005327 | Ga0070658_10196990 | Ga0070658_101969902 | 152 |
| 116 | 3300005336 | Ga0070680_100024919 | Ga0070680_1000249195 | 152 |
| 117 | 3300005336 | Ga0070680_100412164 | Ga0070680_1004121642 | 152 |
| 118 | 3300005337 | Ga0070682_100678550 | Ga0070682_1006785501 | 152 |
| 119 | 3300005341 | Ga0070691_10103937 | Ga0070691_101039372 | 152 |
| 120 | 3300005434 | Ga0070709_10000261 | Ga0070709_1000026120 | 152 |
| 121 | 3300005435 | Ga0070714_100037946 | Ga0070714_1000379465 | 152 |
| 122 | 3300005436 | Ga0070713_100040271 | Ga0070713_1000402712 | 152 |
| 123 | 3300005437 | Ga0070710_10000210 | Ga0070710_100002109 | 152 |
| 124 | 3300005455 | Ga0070663_100273483 | Ga0070663_1002734832 | 152 |
| 125 | 3300005456 | Ga0070678_100227867 | Ga0070678_1002278672 | 152 |
| 126 | 3300005458 | Ga0070681_10048935 | Ga0070681_100489354 | 152 |
| 127 | 3300005458 | Ga0070681_10071418 | Ga0070681_100714183 | 152 |
| 128 | 3300005458 | Ga0070681_10368028 | Ga0070681_103680282 | 152 |
| 129 | 3300005530 | Ga0070679_100165885 | Ga0070679_1001658852 | 152 |
| 130 | 3300005530 | Ga0070679_100387164 | Ga0070679_1003871642 | 152 |
| 131 | 3300005548 | Ga0070665_100053032 | Ga0070665_1000530323 | 152 |
| 132 | 3300005563 | Ga0068855_100108082 | Ga0068855_1001080822 | 152 |
| 133 | 3300005577 | Ga0068857_101082360 | Ga0068857_1010823602 | 152 |
| 134 | 3300005578 | Ga0068854_100152560 | Ga0068854_1001525602 | 152 |
| 135 | 3300005578 | Ga0068854_100270209 | Ga0068854_1002702092 | 152 |
| 136 | 3300006028 | Ga0070717_10947980 | Ga0070717_109479802 | 152 |
| 137 | 3300006028 | Ga0070717_11318472 | Ga0070717_113184722 | 152 |
| 138 | 3300006038 | Ga0075365_10051895 | Ga0075365_100518952 | 152 |
| 139 | 3300006042 | Ga0075368_10035322 | Ga0075368_100353222 | 152 |
| 140 | 3300006042 | Ga0075368_10074422 | Ga0075368_100744222 | 152 |
| 141 | 3300006048 | Ga0075363_100287963 | Ga0075363_1002879632 | 152 |
| 142 | 3300006173 | Ga0070716_100030058 | Ga0070716_1000300582 | 152 |
| 143 | 3300006175 | Ga0070712_100024163 | Ga0070712_1000241633 | 152 |
| 144 | 3300006178 | Ga0075367_10089319 | Ga0075367_100893193 | 152 |
| 145 | 3300006178 | Ga0075367_10447294 | Ga0075367_104472942 | 152 |
| 146 | 3300006195 | Ga0075366_10475472 | Ga0075366_104754722 | 152 |
| 147 | 3300006237 | Ga0097621_100728402 | Ga0097621_1007284022 | 152 |
| 148 | 3300006353 | Ga0075370_10054875 | Ga0075370_100548752 | 152 |
| 149 | 3300009093 | Ga0105240_10023872 | Ga0105240_100238726 | 152 |
| 150 | 3300009174 | Ga0105241_10059790 | Ga0105241_100597904 | 152 |
| 151 | 3300009176 | Ga0105242_10063591 | Ga0105242_100635913 | 152 |
| 152 | 3300009551 | Ga0105238_10000577 | Ga0105238_1000057721 | 152 |
| 153 | 3300009551 | Ga0105238_10033988 | Ga0105238_100339886 | 152 |
| 154 | 3300010375 | Ga0105239_10002730 | Ga0105239_100027307 | 152 |
| 155 | 3300010375 | Ga0105239_10006321 | Ga0105239_1000632120 | 152 |
| 156 | 3300013102 | Ga0157371_10064895 | Ga0157371_100648952 | 152 |
| 157 | 3300013104 | Ga0157370_10131437 | Ga0157370_101314373 | 152 |
| 158 | 3300013104 | Ga0157370_10468207 | Ga0157370_104682072 | 152 |
| 159 | 3300013105 | Ga0157369_10596161 | Ga0157369_105961611 | 152 |
| 160 | 3300013306 | Ga0163162_10155605 | Ga0163162_101556052 | 152 |
| 161 | 3300014325 | Ga0163163_10803370 | Ga0163163_108033702 | 152 |
| 162 | 3300014968 | Ga0157379_10759465 | Ga0157379_107594652 | 152 |
| 163 | 3300014969 | Ga0157376_10298847 | Ga0157376_102988472 | 152 |
| 164 | 3300020082 | Ga0206353_10149552 | Ga0206353_101495521 | 152 |
| 165 | 3300025900 | Ga0207710_10112344 | Ga0207710_101123442 | 152 |
| 166 | 3300025906 | Ga0207699_10001210 | Ga0207699_100012105 | 152 |
| 167 | 3300025909 | Ga0207705_10200663 | Ga0207705_102006632 | 152 |
| 168 | 3300025912 | Ga0207707_10034632 | Ga0207707_100346322 | 152 |
| 169 | 3300025912 | Ga0207707_10119943 | Ga0207707_101199432 | 152 |
| 170 | 3300025912 | Ga0207707_10573617 | Ga0207707_105736172 | 152 |
| 171 | 3300025913 | Ga0207695_10022692 | Ga0207695_1002269210 | 152 |
| 172 | 3300025913 | Ga0207695_10091336 | Ga0207695_100913362 | 152 |
| 173 | 3300025915 | Ga0207693_10069824 | Ga0207693_100698242 | 152 |
| 174 | 3300025917 | Ga0207660_10014919 | Ga0207660_100149192 | 152 |
| 175 | 3300025917 | Ga0207660_10054432 | Ga0207660_100544322 | 152 |
| 176 | 3300025920 | Ga0207649_10622862 | Ga0207649_106228621 | 152 |
| 177 | 3300025921 | Ga0207652_10178507 | Ga0207652_101785071 | 152 |
| 178 | 3300025921 | Ga0207652_10587906 | Ga0207652_105879062 | 152 |
| 179 | 3300025924 | Ga0207694_10000273 | Ga0207694_1000027356 | 152 |
| 180 | 3300025928 | Ga0207700_10045098 | Ga0207700_100450983 | 152 |
| 181 | 3300025929 | Ga0207664_10014428 | Ga0207664_100144283 | 152 |
| 182 | 3300025929 | Ga0207664_10031561 | Ga0207664_100315612 | 152 |
| 183 | 3300025939 | Ga0207665_10041535 | Ga0207665_100415354 | 152 |
| 184 | 3300025940 | Ga0207691_10780630 | Ga0207691_107806301 | 152 |
| 185 | 3300025944 | Ga0207661_10659873 | Ga0207661_106598732 | 152 |
| 186 | 3300025949 | Ga0207667_10120365 | Ga0207667_101203652 | 152 |
| 187 | 3300025981 | Ga0207640_10024770 | Ga0207640_100247703 | 152 |
| 188 | 3300025981 | Ga0207640_10265321 | Ga0207640_102653212 | 152 |
| 189 | 3300025981 | Ga0207640_10294831 | Ga0207640_102948312 | 152 |
| 190 | 3300026041 | Ga0207639_10293963 | Ga0207639_102939631 | 152 |
| 191 | 3300026067 | Ga0207678_10066235 | Ga0207678_100662353 | 152 |
| 192 | 3300026089 | Ga0207648_11016817 | Ga0207648_110168171 | 152 |
| 193 | 3300026116 | Ga0207674_10075312 | Ga0207674_100753122 | 152 |
| 194 | 3300026121 | Ga0207683_10307996 | Ga0207683_103079962 | 152 |
| 195 | 3300026142 | Ga0207698_10226336 | Ga0207698_102263362 | 152 |
| 196 | 3300026142 | Ga0207698_10541709 | Ga0207698_105417092 | 152 |
| 197 | 3300027866 | Ga0209813_10161992 | Ga0209813_101619922 | 152 |
| 198 | 3300028379 | Ga0268266_10021997 | Ga0268266_100219973 | 152 |
| 199 | 3300028800 | Ga0265338_10024838 | Ga0265338_100248383 | 152 |
| 200 | 3300031235 | Ga0265330_10009652 | Ga0265330_100096523 | 152 |
| 201 | 3300031241 | Ga0265325_10010920 | Ga0265325_100109204 | 152 |
| 202 | 3300031247 | Ga0265340_10018433 | Ga0265340_100184333 | 152 |
| 203 | 3300031344 | Ga0265316_10151065 | Ga0265316_101510652 | 152 |
| 204 | 3300031548 | Ga0307408_100599776 | Ga0307408_1005997762 | 152 |
| 205 | 3300031711 | Ga0265314_10020265 | Ga0265314_100202651 | 152 |
| 206 | 3300031712 | Ga0265342_10011898 | Ga0265342_100118984 | 152 |
| 207 | 3300031712 | Ga0265342_10049095 | Ga0265342_100490952 | 152 |
| 208 | 3300031995 | Ga0307409_101579308 | Ga0307409_1015793082 | 152 |
| 209 | 3300032002 | Ga0307416_100520317 | Ga0307416_1005203171 | 152 |
| 210 | 3300032005 | Ga0307411_10903524 | Ga0307411_109035242 | 152 |
| 211 | 3300035114 | Ga0373939_0168874 | Ga0373939_0168874_288_749 | 152 |
| 212 | 3300035242 | Ga0373962_0026296 | Ga0373962_0026296_610_1071 | 152 |
| 213 | 3300035691 | Ga0373931_0004059 | Ga0373931_0004059_4773_5234 | 152 |
| 214 | 3300035692 | Ga0373935_0160484 | Ga0373935_0160484_286_747 | 152 |
| 215 | 3300039453 | Ga0436362_0505536 | Ga0436362_0505536_150_614 | 152 |
| 216 | 3300041408 | Ga0439453_0055680 | Ga0439453_0055680_43_504 | 152 |
| 217 | 3300042013 | Ga0439456_005631 | Ga0439456_005631_120_581 | 152 |
| 218 | 3300046459 | Ga0495629_0424726 | Ga0495629_0424726_393_851 | 152 |
| 219 | 3300046462 | Ga0495651_0120000 | Ga0495651_0120000_1399_1860 | 152 |
| 220 | 3300046462 | Ga0495651_0376206 | Ga0495651_0376206_204_662 | 152 |
| 221 | 3300046523 | Ga0495644_0197177 | Ga0495644_0197177_189_647 | 152 |
| 222 | 3300046529 | Ga0495652_0673223 | Ga0495652_0673223_178_639 | 152 |
| 223 | 3300046660 | Ga0495625_0457460 | Ga0495625_0457460_29_547 | 152 |
| 224 | 3300046683 | Ga0495658_0068452 | Ga0495658_0068452_75_533 | 152 |
| 225 | 3300046684 | Ga0495669_0349370 | Ga0495669_0349370_96_554 | 152 |
| 226 | 3300046809 | Ga0495600_0178910 | Ga0495600_0178910_80_538 | 152 |
| 227 | 3300047315 | Ga0495581_0064444 | Ga0495581_0064444_882_1340 | 152 |
| 228 | 3300047322 | Ga0495680_0234886 | Ga0495680_0234886_544_1002 | 152 |
| 229 | 3300048903 | Ga0496100_0170164 | Ga0496100_0170164_464_925 | 152 |
| 230 | 3300048903 | Ga0496100_0440341 | Ga0496100_0440341_294_752 | 152 |
| 231 | 3300048904 | Ga0496101_0111646 | Ga0496101_0111646_712_1173 | 152 |
| 232 | 3300048905 | Ga0496102_0052448 | Ga0496102_0052448_607_1068 | 152 |
| 233 | 3300048906 | Ga0496103_0020039 | Ga0496103_0020039_954_1415 | 152 |
| 234 | 3300048906 | Ga0496103_0414236 | Ga0496103_0414236_62_520 | 152 |
| 235 | 3300048907 | Ga0496104_0252097 | Ga0496104_0252097_1174_1632 | 152 |
| 236 | 3300048909 | Ga0496106_0008322 | Ga0496106_0008322_4153_4614 | 152 |
| 237 | 3300048909 | Ga0496106_0078331 | Ga0496106_0078331_1576_2034 | 152 |
| 238 | 3300048910 | Ga0496107_0014344 | Ga0496107_0014344_2220_2681 | 152 |
| 239 | 3300048913 | Ga0496110_0011875 | Ga0496110_0011875_6110_6571 | 152 |
| 240 | 3300048914 | Ga0496111_0015146 | Ga0496111_0015146_4019_4480 | 152 |
| 241 | 3300048915 | Ga0496112_0727352 | Ga0496112_0727352_37_498 | 152 |
| 242 | 3300048915 | Ga0496112_1290578 | Ga0496112_1290578_23_481 | 152 |
| 243 | 3300048916 | Ga0496113_0004759 | Ga0496113_0004759_2718_3179 | 152 |
| 244 | 3300048916 | Ga0496113_0635305 | Ga0496113_0635305_53_511 | 152 |
| 245 | 3300048917 | Ga0496114_0031891 | Ga0496114_0031891_3632_4093 | 152 |
| 246 | 3300048918 | Ga0496115_0152657 | Ga0496115_0152657_241_702 | 152 |
| 247 | 3300048918 | Ga0496115_0176283 | Ga0496115_0176283_425_883 | 152 |
| 248 | 3300048922 | Ga0496119_0264831 | Ga0496119_0264831_267_725 | 152 |
| 249 | 3300048924 | Ga0496121_0089542 | Ga0496121_0089542_555_1013 | 152 |
| 250 | 3300048929 | Ga0496126_0323982 | Ga0496126_0323982_514_978 | 152 |
| 251 | 3300050490 | nmdc:mga03n38_124071_c1 | nmdc:mga03n38_124071_c1_735_1193 | 152 |
| 252 | 3300050492 | nmdc:mga0yw44_367669_c1 | nmdc:mga0yw44_367669_c1_21_479 | 152 |
| 253 | 3300050493 | nmdc:mga0k408_212620_c1 | nmdc:mga0k408_212620_c1_49_507 | 152 |
| 254 | 3300050494 | nmdc:mga06z11_955657_c1 | nmdc:mga06z11_955657_c1_39_506 | 152 |
| 255 | 3300050495 | nmdc:mga04h51_157738_c1 | nmdc:mga04h51_157738_c1_112_570 | 152 |
| 256 | 3300050512 | nmdc:mga0n895_778385_c1 | nmdc:mga0n895_778385_c1_346_804 | 152 |
| 257 | 3300053088 | Ga0500644_0000753 | Ga0500644_0000753_1512_1985 | 152 |
| 258 | 3300053093 | Ga0500651_0011520 | Ga0500651_0011520_2814_3275 | 152 |
| 259 | 3300053131 | Ga0500652_001919 | Ga0500652_001919_995_1456 | 152 |
| 260 | 3300053134 | Ga0500658_0011848 | Ga0500658_0011848_1130_1588 | 152 |
| 261 | 3300053142 | Ga0500577_0248427 | Ga0500577_0248427_108_569 | 152 |
| 262 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_983451_983912 | 152 |
| 263 | 3300053730 | Ga0500645_000252 | Ga0500645_000252_26774_27235 | 152 |
| 264 | 3300053730 | Ga0500645_040976 | Ga0500645_040976_740_1198 | 152 |
| 265 | 3300005331 | Ga0070670_100202787 | Ga0070670_1002027873 | 153 |
| 266 | 3300005339 | Ga0070660_100228074 | Ga0070660_1002280742 | 153 |
| 267 | 3300005340 | Ga0070689_100311399 | Ga0070689_1003113992 | 153 |
| 268 | 3300005347 | Ga0070668_101536339 | Ga0070668_1015363391 | 153 |
| 269 | 3300005353 | Ga0070669_101145280 | Ga0070669_1011452801 | 153 |
| 270 | 3300005354 | Ga0070675_101424738 | Ga0070675_1014247381 | 153 |
| 271 | 3300005364 | Ga0070673_100100290 | Ga0070673_1001002906 | 153 |
| 272 | 3300005365 | Ga0070688_100041703 | Ga0070688_1000417031 | 153 |
| 273 | 3300005367 | Ga0070667_100279544 | Ga0070667_1002795442 | 153 |
| 274 | 3300005434 | Ga0070709_10347673 | Ga0070709_103476732 | 153 |
| 275 | 3300005435 | Ga0070714_100153262 | Ga0070714_1001532623 | 153 |
| 276 | 3300005439 | Ga0070711_100216032 | Ga0070711_1002160322 | 153 |
| 277 | 3300005458 | Ga0070681_10115574 | Ga0070681_101155743 | 153 |
| 278 | 3300005543 | Ga0070672_100054030 | Ga0070672_1000540303 | 153 |
| 279 | 3300005544 | Ga0070686_100753878 | Ga0070686_1007538782 | 153 |
| 280 | 3300005548 | Ga0070665_100244008 | Ga0070665_1002440082 | 153 |
| 281 | 3300005564 | Ga0070664_101282821 | Ga0070664_1012828211 | 153 |
| 282 | 3300005577 | Ga0068857_101556984 | Ga0068857_1015569841 | 153 |
| 283 | 3300005617 | Ga0068859_100100443 | Ga0068859_1001004434 | 153 |
| 284 | 3300005719 | Ga0068861_100652511 | Ga0068861_1006525112 | 153 |
| 285 | 3300006028 | Ga0070717_10087927 | Ga0070717_100879272 | 153 |
| 286 | 3300006163 | Ga0070715_10489777 | Ga0070715_104897771 | 153 |
| 287 | 3300006175 | Ga0070712_100277452 | Ga0070712_1002774521 | 153 |
| 288 | 3300006931 | Ga0097620_100100448 | Ga0097620_1001004484 | 153 |
| 289 | 3300007076 | Ga0075435_101297309 | Ga0075435_1012973091 | 153 |
| 290 | 3300009148 | Ga0105243_10020564 | Ga0105243_100205644 | 153 |
| 291 | 3300009174 | Ga0105241_11513428 | Ga0105241_115134281 | 153 |
| 292 | 3300013104 | Ga0157370_10373388 | Ga0157370_103733881 | 153 |
| 293 | 3300013296 | Ga0157374_10513393 | Ga0157374_105133932 | 153 |
| 294 | 3300014325 | Ga0163163_10313012 | Ga0163163_103130122 | 153 |
| 295 | 3300014968 | Ga0157379_10606306 | Ga0157379_106063061 | 153 |
| 296 | 3300024227 | Ga0228598_1001342 | Ga0228598_10013425 | 153 |
| 297 | 3300025903 | Ga0207680_10422890 | Ga0207680_104228902 | 153 |
| 298 | 3300025916 | Ga0207663_10257083 | Ga0207663_102570832 | 153 |
| 299 | 3300025917 | Ga0207660_10118064 | Ga0207660_101180643 | 153 |
| 300 | 3300025918 | Ga0207662_10743115 | Ga0207662_107431151 | 153 |
| 301 | 3300025919 | Ga0207657_10711598 | Ga0207657_107115981 | 153 |
| 302 | 3300025924 | Ga0207694_10725040 | Ga0207694_107250401 | 153 |
| 303 | 3300025926 | Ga0207659_10324274 | Ga0207659_103242741 | 153 |
| 304 | 3300025927 | Ga0207687_10516293 | Ga0207687_105162931 | 153 |
| 305 | 3300025928 | Ga0207700_10074350 | Ga0207700_100743504 | 153 |
| 306 | 3300025929 | Ga0207664_10289400 | Ga0207664_102894001 | 153 |
| 307 | 3300025935 | Ga0207709_10048060 | Ga0207709_100480602 | 153 |
| 308 | 3300025936 | Ga0207670_10355276 | Ga0207670_103552762 | 153 |
| 309 | 3300025937 | Ga0207669_10195511 | Ga0207669_101955112 | 153 |
| 310 | 3300025940 | Ga0207691_10080020 | Ga0207691_100800203 | 153 |
| 311 | 3300025941 | Ga0207711_10136789 | Ga0207711_101367893 | 153 |
| 312 | 3300025945 | Ga0207679_10764354 | Ga0207679_107643542 | 153 |
| 313 | 3300025972 | Ga0207668_10330719 | Ga0207668_103307191 | 153 |
| 314 | 3300025972 | Ga0207668_11626059 | Ga0207668_116260591 | 153 |
| 315 | 3300026067 | Ga0207678_10147831 | Ga0207678_101478313 | 153 |
| 316 | 3300026095 | Ga0207676_10391316 | Ga0207676_103913162 | 153 |
| 317 | 3300026118 | Ga0207675_100555059 | Ga0207675_1005550591 | 153 |
| 318 | 3300026121 | Ga0207683_10786849 | Ga0207683_107868492 | 153 |
| 319 | 3300026121 | Ga0207683_10802805 | Ga0207683_108028052 | 153 |
| 320 | 3300028379 | Ga0268266_10082247 | Ga0268266_100822473 | 153 |
| 321 | 3300028381 | Ga0268264_12637567 | Ga0268264_126375671 | 153 |
| 322 | 3300035086 | Ga0373934_0332307 | Ga0373934_0332307_106_570 | 153 |
| 323 | 3300035118 | Ga0373954_0318239 | Ga0373954_0318239_137_601 | 153 |
| 324 | 3300035119 | Ga0373956_0095221 | Ga0373956_0095221_115_579 | 153 |
| 325 | 3300035692 | Ga0373935_0238931 | Ga0373935_0238931_76_540 | 153 |
| 326 | 3300035724 | Ga0373933_0071348 | Ga0373933_0071348_1612_2076 | 153 |
| 327 | 3300036401 | Ga0373937_1084377 | Ga0373937_1084377_57_521 | 153 |
| 328 | 3300044901 | Ga0466960_0788855 | Ga0466960_0788855_28_489 | 153 |
| 329 | 3300046454 | Ga0495592_0191798 | Ga0495592_0191798_413_877 | 153 |
| 330 | 3300046462 | Ga0495651_0024676 | Ga0495651_0024676_4172_4636 | 153 |
| 331 | 3300046463 | Ga0495653_0107431 | Ga0495653_0107431_1228_1692 | 153 |
| 332 | 3300046476 | Ga0495662_0226533 | Ga0495662_0226533_378_842 | 153 |
| 333 | 3300046477 | Ga0495664_0042411 | Ga0495664_0042411_1273_1737 | 153 |
| 334 | 3300046499 | Ga0495594_0123990 | Ga0495594_0123990_40_504 | 153 |
| 335 | 3300046514 | Ga0495618_0685713 | Ga0495618_0685713_23_487 | 153 |
| 336 | 3300046516 | Ga0495628_0069415 | Ga0495628_0069415_2008_2472 | 153 |
| 337 | 3300046517 | Ga0495630_0515959 | Ga0495630_0515959_223_687 | 153 |
| 338 | 3300046529 | Ga0495652_0786196 | Ga0495652_0786196_41_505 | 153 |
| 339 | 3300046533 | Ga0495640_0105062 | Ga0495640_0105062_480_944 | 153 |
| 340 | 3300046536 | Ga0495587_0010933 | Ga0495587_0010933_4544_5008 | 153 |
| 341 | 3300046559 | Ga0495667_0045953 | Ga0495667_0045953_715_1179 | 153 |
| 342 | 3300046642 | Ga0495634_0187689 | Ga0495634_0187689_636_1100 | 153 |
| 343 | 3300046663 | Ga0495635_0631943 | Ga0495635_0631943_122_586 | 153 |
| 344 | 3300046690 | Ga0495624_0434352 | Ga0495624_0434352_204_668 | 153 |
| 345 | 3300046809 | Ga0495600_0089630 | Ga0495600_0089630_393_857 | 153 |
| 346 | 3300047317 | Ga0495604_0107051 | Ga0495604_0107051_995_1459 | 153 |
| 347 | 3300047322 | Ga0495680_0397848 | Ga0495680_0397848_147_611 | 153 |
| 348 | 3300047471 | Ga0495684_0198669 | Ga0495684_0198669_641_1105 | 153 |
| 349 | 3300047673 | Ga0495593_0236323 | Ga0495593_0236323_415_879 | 153 |
| 350 | 3300048088 | Ga0495602_0050066 | Ga0495602_0050066_1063_1527 | 153 |
| 351 | 3300048903 | Ga0496100_0141071 | Ga0496100_0141071_353_817 | 153 |
| 352 | 3300048904 | Ga0496101_1148515 | Ga0496101_1148515_131_595 | 153 |
| 353 | 3300048905 | Ga0496102_0461272 | Ga0496102_0461272_699_1163 | 153 |
| 354 | 3300048907 | Ga0496104_0006100 | Ga0496104_0006100_9989_10453 | 153 |
| 355 | 3300048907 | Ga0496104_0149697 | Ga0496104_0149697_563_1027 | 153 |
| 356 | 3300048908 | Ga0496105_0018424 | Ga0496105_0018424_1585_2049 | 153 |
| 357 | 3300048911 | Ga0496108_0589067 | Ga0496108_0589067_339_803 | 153 |
| 358 | 3300048912 | Ga0496109_0024895 | Ga0496109_0024895_1557_2021 | 153 |
| 359 | 3300048912 | Ga0496109_0251551 | Ga0496109_0251551_605_1069 | 153 |
| 360 | 3300048915 | Ga0496112_0935360 | Ga0496112_0935360_306_770 | 153 |
| 361 | 3300048917 | Ga0496114_0096668 | Ga0496114_0096668_1608_2072 | 153 |
| 362 | 3300048918 | Ga0496115_0022612 | Ga0496115_0022612_2489_2953 | 153 |
| 363 | 3300048918 | Ga0496115_0248151 | Ga0496115_0248151_754_1218 | 153 |
| 364 | 3300053084 | Ga0495595_0012617 | Ga0495595_0012617_1779_2243 | 153 |
| 365 | 3300053085 | Ga0495619_0393371 | Ga0495619_0393371_436_900 | 153 |
| 366 | 3300002459 | JGI24751J29686_10104580 | JGI24751J29686_101045801 | 154 |
| 367 | 3300003215 | JGI25153J46596_10000560 | JGI25153J46596_100005609 | 154 |
| 368 | 3300003354 | JGI25160J50197_1003827 | JGI25160J50197_10038275 | 154 |
| 369 | 3300003794 | Ga0055531_10003731 | Ga0055531_100037314 | 154 |
| 370 | 3300005262 | Ga0065165_1004598 | Ga0065165_10045985 | 154 |
| 371 | 3300005262 | Ga0065165_1060899 | Ga0065165_10608992 | 154 |
| 372 | 3300005331 | Ga0070670_100337358 | Ga0070670_1003373581 | 154 |
| 373 | 3300005339 | Ga0070660_100421867 | Ga0070660_1004218671 | 154 |
| 374 | 3300005347 | Ga0070668_100047473 | Ga0070668_1000474733 | 154 |
| 375 | 3300005355 | Ga0070671_101593269 | Ga0070671_1015932691 | 154 |
| 376 | 3300005366 | Ga0070659_100213216 | Ga0070659_1002132162 | 154 |
| 377 | 3300005455 | Ga0070663_100013561 | Ga0070663_1000135614 | 154 |
| 378 | 3300005455 | Ga0070663_100109563 | Ga0070663_1001095632 | 154 |
| 379 | 3300005457 | Ga0070662_100268101 | Ga0070662_1002681012 | 154 |
| 380 | 3300005457 | Ga0070662_100368843 | Ga0070662_1003688432 | 154 |
| 381 | 3300005536 | Ga0070697_101715629 | Ga0070697_1017156291 | 154 |
| 382 | 3300005539 | Ga0068853_101500504 | Ga0068853_1015005041 | 154 |
| 383 | 3300005548 | Ga0070665_100224569 | Ga0070665_1002245692 | 154 |
| 384 | 3300005563 | Ga0068855_100734852 | Ga0068855_1007348521 | 154 |
| 385 | 3300005577 | Ga0068857_100088811 | Ga0068857_1000888114 | 154 |
| 386 | 3300005616 | Ga0068852_100215450 | Ga0068852_1002154503 | 154 |
| 387 | 3300005617 | Ga0068859_100588792 | Ga0068859_1005887923 | 154 |
| 388 | 3300005841 | Ga0068863_100085365 | Ga0068863_1000853655 | 154 |
| 389 | 3300005842 | Ga0068858_100843865 | Ga0068858_1008438652 | 154 |
| 390 | 3300005843 | Ga0068860_101322273 | Ga0068860_1013222732 | 154 |
| 391 | 3300006038 | Ga0075365_10142828 | Ga0075365_101428283 | 154 |
| 392 | 3300006042 | Ga0075368_10017272 | Ga0075368_100172723 | 154 |
| 393 | 3300006048 | Ga0075363_100017468 | Ga0075363_1000174682 | 154 |
| 394 | 3300006051 | Ga0075364_10148960 | Ga0075364_101489602 | 154 |
| 395 | 3300006175 | Ga0070712_100403527 | Ga0070712_1004035272 | 154 |
| 396 | 3300006177 | Ga0075362_10529034 | Ga0075362_105290341 | 154 |
| 397 | 3300006178 | Ga0075367_10116979 | Ga0075367_101169792 | 154 |
| 398 | 3300006195 | Ga0075366_10104244 | Ga0075366_101042443 | 154 |
| 399 | 3300006195 | Ga0075366_10137737 | Ga0075366_101377372 | 154 |
| 400 | 3300006358 | Ga0068871_101026812 | Ga0068871_1010268121 | 154 |
| 401 | 3300006931 | Ga0097620_100588787 | Ga0097620_1005887873 | 154 |
| 402 | 3300006941 | Ga0099825_1037919 | Ga0099825_10379192 | 154 |
| 403 | 3300006942 | Ga0099824_1036906 | Ga0099824_10369061 | 154 |
| 404 | 3300006944 | Ga0099823_1015403 | Ga0099823_10154036 | 154 |
| 405 | 3300009093 | Ga0105240_10111074 | Ga0105240_101110745 | 154 |
| 406 | 3300009148 | Ga0105243_10740964 | Ga0105243_107409642 | 154 |
| 407 | 3300009177 | Ga0105248_10038686 | Ga0105248_100386862 | 154 |
| 408 | 3300009545 | Ga0105237_10381640 | Ga0105237_103816401 | 154 |
| 409 | 3300009545 | Ga0105237_10867833 | Ga0105237_108678332 | 154 |
| 410 | 3300010375 | Ga0105239_10052776 | Ga0105239_100527762 | 154 |
| 411 | 3300010375 | Ga0105239_10430323 | Ga0105239_104303232 | 154 |
| 412 | 3300011119 | Ga0105246_10044664 | Ga0105246_100446645 | 154 |
| 413 | 3300013296 | Ga0157374_10751862 | Ga0157374_107518621 | 154 |
| 414 | 3300014325 | Ga0163163_10650854 | Ga0163163_106508541 | 154 |
| 415 | 3300021321 | Ga0214542_1000058 | Ga0214542_100005817 | 154 |
| 416 | 3300021321 | Ga0214542_1025427 | Ga0214542_10254272 | 154 |
| 417 | 3300021324 | Ga0214545_1000026 | Ga0214545_1000026113 | 154 |
| 418 | 3300021324 | Ga0214545_1016362 | Ga0214545_10163625 | 154 |
| 419 | 3300021327 | Ga0214543_1002325 | Ga0214543_100232517 | 154 |
| 420 | 3300021327 | Ga0214543_1031379 | Ga0214543_10313792 | 154 |
| 421 | 3300025245 | Ga0207425_1042066 | Ga0207425_10420662 | 154 |
| 422 | 3300025258 | Ga0209129_1051943 | Ga0209129_10519431 | 154 |
| 423 | 3300025295 | Ga0209564_1004700 | Ga0209564_10047007 | 154 |
| 424 | 3300025295 | Ga0209564_1005701 | Ga0209564_10057013 | 154 |
| 425 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011916 | 154 |
| 426 | 3300025297 | Ga0209758_1000940 | Ga0209758_10009403 | 154 |
| 427 | 3300025297 | Ga0209758_1001336 | Ga0209758_100133617 | 154 |
| 428 | 3300025299 | Ga0209256_1025400 | Ga0209256_10254002 | 154 |
| 429 | 3300025302 | Ga0207426_1004163 | Ga0207426_10041638 | 154 |
| 430 | 3300025304 | Ga0209257_1000158 | Ga0209257_100015816 | 154 |
| 431 | 3300025304 | Ga0209257_1014253 | Ga0209257_10142536 | 154 |
| 432 | 3300025304 | Ga0209257_1025655 | Ga0209257_10256553 | 154 |
| 433 | 3300025304 | Ga0209257_1093316 | Ga0209257_10933162 | 154 |
| 434 | 3300025901 | Ga0207688_10108686 | Ga0207688_101086862 | 154 |
| 435 | 3300025903 | Ga0207680_10406771 | Ga0207680_104067712 | 154 |
| 436 | 3300025904 | Ga0207647_10002857 | Ga0207647_1000285716 | 154 |
| 437 | 3300025904 | Ga0207647_10325881 | Ga0207647_103258811 | 154 |
| 438 | 3300025909 | Ga0207705_10788485 | Ga0207705_107884852 | 154 |
| 439 | 3300025914 | Ga0207671_10049790 | Ga0207671_100497905 | 154 |
| 440 | 3300025914 | Ga0207671_10941489 | Ga0207671_109414892 | 154 |
| 441 | 3300025915 | Ga0207693_10312774 | Ga0207693_103127741 | 154 |
| 442 | 3300025919 | Ga0207657_10943293 | Ga0207657_109432931 | 154 |
| 443 | 3300025923 | Ga0207681_10564332 | Ga0207681_105643321 | 154 |
| 444 | 3300025925 | Ga0207650_10366702 | Ga0207650_103667022 | 154 |
| 445 | 3300025931 | Ga0207644_10287027 | Ga0207644_102870272 | 154 |
| 446 | 3300025932 | Ga0207690_10415108 | Ga0207690_104151082 | 154 |
| 447 | 3300025932 | Ga0207690_10792413 | Ga0207690_107924132 | 154 |
| 448 | 3300025933 | Ga0207706_10121113 | Ga0207706_101211132 | 154 |
| 449 | 3300025933 | Ga0207706_10504587 | Ga0207706_105045872 | 154 |
| 450 | 3300025935 | Ga0207709_11206876 | Ga0207709_112068761 | 154 |
| 451 | 3300025940 | Ga0207691_10573623 | Ga0207691_105736232 | 154 |
| 452 | 3300025941 | Ga0207711_10289924 | Ga0207711_102899242 | 154 |
| 453 | 3300025961 | Ga0207712_10804055 | Ga0207712_108040551 | 154 |
| 454 | 3300025972 | Ga0207668_10129544 | Ga0207668_101295443 | 154 |
| 455 | 3300026035 | Ga0207703_10151346 | Ga0207703_101513462 | 154 |
| 456 | 3300026041 | Ga0207639_11366888 | Ga0207639_113668881 | 154 |
| 457 | 3300026067 | Ga0207678_10092129 | Ga0207678_100921292 | 154 |
| 458 | 3300026067 | Ga0207678_10766338 | Ga0207678_107663382 | 154 |
| 459 | 3300026088 | Ga0207641_11286072 | Ga0207641_112860721 | 154 |
| 460 | 3300026116 | Ga0207674_10155357 | Ga0207674_101553572 | 154 |
| 461 | 3300026118 | Ga0207675_100989443 | Ga0207675_1009894431 | 154 |
| 462 | 3300026142 | Ga0207698_11186375 | Ga0207698_111863752 | 154 |
| 463 | 3300027296 | Ga0209389_1000073 | Ga0209389_100007314 | 154 |
| 464 | 3300027296 | Ga0209389_1000160 | Ga0209389_10001605 | 154 |
| 465 | 3300027357 | Ga0209589_1000484 | Ga0209589_10004845 | 154 |
| 466 | 3300027361 | Ga0209489_100917 | Ga0209489_1009177 | 154 |
| 467 | 3300027361 | Ga0209489_100982 | Ga0209489_10098239 | 154 |
| 468 | 3300027363 | Ga0209700_100067 | Ga0209700_10006714 | 154 |
| 469 | 3300027866 | Ga0209813_10225101 | Ga0209813_102251011 | 154 |
| 470 | 3300028379 | Ga0268266_10114683 | Ga0268266_101146832 | 154 |
| 471 | 3300031251 | Ga0265327_10135276 | Ga0265327_101352761 | 154 |
| 472 | 3300031595 | Ga0265313_10018461 | Ga0265313_100184614 | 154 |
| 473 | 3300035111 | Ga0373923_0011100 | Ga0373923_0011100_902_1366 | 154 |
| 474 | 3300035117 | Ga0373953_0021843 | Ga0373953_0021843_280_744 | 154 |
| 475 | 3300035118 | Ga0373954_0064007 | Ga0373954_0064007_1189_1653 | 154 |
| 476 | 3300035119 | Ga0373956_0019909 | Ga0373956_0019909_149_613 | 154 |
| 477 | 3300035120 | Ga0373957_0095771 | Ga0373957_0095771_388_852 | 154 |
| 478 | 3300035172 | Ga0373955_0051660 | Ga0373955_0051660_48_512 | 154 |
| 479 | 3300035241 | Ga0373961_0059894 | Ga0373961_0059894_197_739 | 154 |
| 480 | 3300035410 | Ga0373924_0103180 | Ga0373924_0103180_177_641 | 154 |
| 481 | 3300035724 | Ga0373933_0060893 | Ga0373933_0060893_1280_1744 | 154 |
| 482 | 3300036401 | Ga0373937_0014381 | Ga0373937_0014381_5587_6051 | 154 |
| 483 | 3300037418 | Ga0395900_0317933 | Ga0395900_0317933_938_1402 | 154 |
| 484 | 3300037466 | Ga0395898_1295562 | Ga0395898_1295562_137_601 | 154 |
| 485 | 3300038443 | Ga0395901_0267384 | Ga0395901_0267384_707_1171 | 154 |
| 486 | 3300041509 | Ga0451843_0662871 | Ga0451843_0662871_631_1095 | 154 |
| 487 | 3300042012 | Ga0439455_0082568 | Ga0439455_0082568_370_834 | 154 |
| 488 | 3300044658 | Ga0466972_0143869 | Ga0466972_0143869_379_843 | 154 |
| 489 | 3300044658 | Ga0466972_0239876 | Ga0466972_0239876_143_607 | 154 |
| 490 | 3300044683 | Ga0466965_0029688 | Ga0466965_0029688_1548_2012 | 154 |
| 491 | 3300044683 | Ga0466965_0278880 | Ga0466965_0278880_379_843 | 154 |
| 492 | 3300046454 | Ga0495592_0039033 | Ga0495592_0039033_1103_1567 | 154 |
| 493 | 3300046457 | Ga0495590_0109117 | Ga0495590_0109117_174_638 | 154 |
| 494 | 3300046459 | Ga0495629_0042353 | Ga0495629_0042353_1941_2405 | 154 |
| 495 | 3300046463 | Ga0495653_0088251 | Ga0495653_0088251_1016_1480 | 154 |
| 496 | 3300046492 | Ga0495585_0156756 | Ga0495585_0156756_280_744 | 154 |
| 497 | 3300046501 | Ga0495607_0238425 | Ga0495607_0238425_154_618 | 154 |
| 498 | 3300046506 | Ga0495583_0099738 | Ga0495583_0099738_663_1127 | 154 |
| 499 | 3300046512 | Ga0495610_0183335 | Ga0495610_0183335_151_615 | 154 |
| 500 | 3300046513 | Ga0495616_0015442 | Ga0495616_0015442_123_587 | 154 |
| 501 | 3300046514 | Ga0495618_0118927 | Ga0495618_0118927_751_1215 | 154 |
| 502 | 3300046516 | Ga0495628_0108289 | Ga0495628_0108289_1252_1716 | 154 |
| 503 | 3300046529 | Ga0495652_0022074 | Ga0495652_0022074_4380_4844 | 154 |
| 504 | 3300046533 | Ga0495640_0170787 | Ga0495640_0170787_113_577 | 154 |
| 505 | 3300046536 | Ga0495587_0165902 | Ga0495587_0165902_533_997 | 154 |
| 506 | 3300046542 | Ga0495597_0023924 | Ga0495597_0023924_1268_1732 | 154 |
| 507 | 3300046543 | Ga0495645_0106584 | Ga0495645_0106584_1070_1534 | 154 |
| 508 | 3300046559 | Ga0495667_0116418 | Ga0495667_0116418_248_712 | 154 |
| 509 | 3300046616 | Ga0495668_0028092 | Ga0495668_0028092_1575_2039 | 154 |
| 510 | 3300046642 | Ga0495634_0048984 | Ga0495634_0048984_1287_1751 | 154 |
| 511 | 3300046663 | Ga0495635_0045516 | Ga0495635_0045516_980_1444 | 154 |
| 512 | 3300046675 | Ga0495657_0372748 | Ga0495657_0372748_259_723 | 154 |
| 513 | 3300046678 | Ga0495599_0026974 | Ga0495599_0026974_1300_1764 | 154 |
| 514 | 3300046679 | Ga0495623_0000341 | Ga0495623_0000341_23714_24178 | 154 |
| 515 | 3300046680 | Ga0495646_0285246 | Ga0495646_0285246_229_693 | 154 |
| 516 | 3300046689 | Ga0495613_0324368 | Ga0495613_0324368_133_597 | 154 |
| 517 | 3300046809 | Ga0495600_0004899 | Ga0495600_0004899_7045_7509 | 154 |
| 518 | 3300047317 | Ga0495604_0195533 | Ga0495604_0195533_410_874 | 154 |
| 519 | 3300047319 | Ga0495674_0194142 | Ga0495674_0194142_627_1091 | 154 |
| 520 | 3300047322 | Ga0495680_0070998 | Ga0495680_0070998_248_712 | 154 |
| 521 | 3300047323 | Ga0495683_0061528 | Ga0495683_0061528_663_1127 | 154 |
| 522 | 3300047443 | Ga0495687_012034 | Ga0495687_012034_3046_3510 | 154 |
| 523 | 3300047444 | Ga0495675_0165001 | Ga0495675_0165001_248_712 | 154 |
| 524 | 3300047445 | Ga0495677_0204527 | Ga0495677_0204527_243_707 | 154 |
| 525 | 3300047471 | Ga0495684_0006898 | Ga0495684_0006898_7795_8259 | 154 |
| 526 | 3300047673 | Ga0495593_0055198 | Ga0495593_0055198_410_874 | 154 |
| 527 | 3300048088 | Ga0495602_0093108 | Ga0495602_0093108_661_1125 | 154 |
| 528 | 3300048903 | Ga0496100_0444289 | Ga0496100_0444289_110_574 | 154 |
| 529 | 3300048904 | Ga0496101_1301156 | Ga0496101_1301156_67_531 | 154 |
| 530 | 3300048905 | Ga0496102_0053235 | Ga0496102_0053235_3126_3590 | 154 |
| 531 | 3300048905 | Ga0496102_0188945 | Ga0496102_0188945_1287_1751 | 154 |
| 532 | 3300048906 | Ga0496103_0010003 | Ga0496103_0010003_4080_4544 | 154 |
| 533 | 3300048907 | Ga0496104_0990835 | Ga0496104_0990835_212_676 | 154 |
| 534 | 3300048908 | Ga0496105_0084393 | Ga0496105_0084393_343_807 | 154 |
| 535 | 3300048908 | Ga0496105_0291140 | Ga0496105_0291140_576_1040 | 154 |
| 536 | 3300048909 | Ga0496106_0736498 | Ga0496106_0736498_215_679 | 154 |
| 537 | 3300048911 | Ga0496108_0178539 | Ga0496108_0178539_1162_1626 | 154 |
| 538 | 3300048912 | Ga0496109_0086022 | Ga0496109_0086022_736_1200 | 154 |
| 539 | 3300048913 | Ga0496110_0802640 | Ga0496110_0802640_30_494 | 154 |
| 540 | 3300048914 | Ga0496111_0136596 | Ga0496111_0136596_842_1306 | 154 |
| 541 | 3300048915 | Ga0496112_0169525 | Ga0496112_0169525_46_510 | 154 |
| 542 | 3300048916 | Ga0496113_0047490 | Ga0496113_0047490_1061_1525 | 154 |
| 543 | 3300048918 | Ga0496115_0855456 | Ga0496115_0855456_126_590 | 154 |
| 544 | 3300048919 | Ga0496116_0288610 | Ga0496116_0288610_210_674 | 154 |
| 545 | 3300048921 | Ga0496118_0087768 | Ga0496118_0087768_382_846 | 154 |
| 546 | 3300048922 | Ga0496119_0085667 | Ga0496119_0085667_1269_1733 | 154 |
| 547 | 3300048923 | Ga0496120_0236471 | Ga0496120_0236471_301_765 | 154 |
| 548 | 3300048925 | Ga0496122_0030192 | Ga0496122_0030192_2129_2608 | 154 |
| 549 | 3300048926 | Ga0496123_0030511 | Ga0496123_0030511_3395_3874 | 154 |
| 550 | 3300048927 | Ga0496124_0054449 | Ga0496124_0054449_1088_1552 | 154 |
| 551 | 3300048927 | Ga0496124_0248331 | Ga0496124_0248331_569_1048 | 154 |
| 552 | 3300048927 | Ga0496124_0311801 | Ga0496124_0311801_329_793 | 154 |
| 553 | 3300048928 | Ga0496125_0581198 | Ga0496125_0581198_89_553 | 154 |
| 554 | 3300048929 | Ga0496126_0047239 | Ga0496126_0047239_2672_3136 | 154 |
| 555 | 3300048929 | Ga0496126_1140048 | Ga0496126_1140048_35_499 | 154 |
| 556 | 3300049822 | Ga0501035_0243547 | Ga0501035_0243547_985_1455 | 154 |
| 557 | 3300050489 | nmdc:mga03683_94282_c1 | nmdc:mga03683_94282_c1_585_1049 | 154 |
| 558 | 3300050490 | nmdc:mga03n38_195692_c1 | nmdc:mga03n38_195692_c1_367_831 | 154 |
| 559 | 3300050492 | nmdc:mga0yw44_62046_c1 | nmdc:mga0yw44_62046_c1_1257_1721 | 154 |
| 560 | 3300050492 | nmdc:mga0yw44_984002_c1 | nmdc:mga0yw44_984002_c1_10_489 | 154 |
| 561 | 3300050493 | nmdc:mga0k408_107167_c1 | nmdc:mga0k408_107167_c1_1092_1556 | 154 |
| 562 | 3300050493 | nmdc:mga0k408_138269_c1 | nmdc:mga0k408_138269_c1_711_1175 | 154 |
| 563 | 3300050494 | nmdc:mga06z11_30363_c1 | nmdc:mga06z11_30363_c1_1079_1543 | 154 |
| 564 | 3300050495 | nmdc:mga04h51_42895_c1 | nmdc:mga04h51_42895_c1_725_1189 | 154 |
| 565 | 3300050496 | nmdc:mga07m45_32276_c1 | nmdc:mga07m45_32276_c1_238_702 | 154 |
| 566 | 3300050516 | nmdc:mga0sz30_122956_c1 | nmdc:mga0sz30_122956_c1_362_826 | 154 |
| 567 | 3300050516 | nmdc:mga0sz30_78966_c1 | nmdc:mga0sz30_78966_c1_445_909 | 154 |
| 568 | 3300053085 | Ga0495619_0009683 | Ga0495619_0009683_4961_5425 | 154 |
| 569 | 3300053086 | Ga0500578_0064541 | Ga0500578_0064541_1026_1490 | 154 |
| 570 | 3300053153 | Ga0500616_0005915 | Ga0500616_0005915_4825_5289 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m4w-assembly1.cif.gz_D | crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin | 0.988 | 79 | 153 |
| 6m4v-assembly2.cif.gz_D | crystal structure of mbp fused split fkbp in complex with rapamycin | 0.9846 | 79 | 153 |
| 2y78-assembly1.cif.gz_A-2 | crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei | 0.9791 | 38 | 150 |
| 4ggq-assembly4.cif.gz_D | crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 | 0.9765 | 37 | 150 |
| 4dz2-assembly1.cif.gz_A | crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506 | 0.9755 | 37 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n1aB00 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.9648 | 45 | 153 | 3.10.50.40 |
| af_B0G119_2_111_3.10.50.40 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.961 | 44 | 153 | 3.10.50.40 |
| 6b4pB00 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.9587 | 45 | 153 | 3.10.50.40 |
| 5b8iC00 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.9531 | 44 | 153 | 3.10.50.40 |
| 1jvwA00 | Alpha Beta;Roll;Chitinase A; domain 3; | 0.9506 | 38 | 152 | 3.10.50.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7G8R6-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) | 0.9998 | 39 | 153 |
GO:0006457
GO:0140839 GO:0140840 |
| AF-A0A7V7JLY4-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) | 0.9978 | 36 | 153 |
GO:0003677
GO:0003755 GO:0006457 GO:0030527 |
| AF-A0A3N5GY91-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) | 0.9976 | 39 | 153 |
GO:0006457
GO:0140839 GO:0140840 |
| AF-A0A321LIW6-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) | 0.9951 | 38 | 153 |
GO:0016020
GO:0140839 GO:0140840 |
| AF-A0A257PMH8-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) | 0.9942 | 38 | 153 |
GO:0006457
GO:0140839 GO:0140840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar