F464804

General Info

Members Datasets Scaffolds Average Seq Length
570 336 1140 105

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101475703|Ga0070711_1014757032
Length 107
Sequence VTIRRIRKGDSVVVIAGRDKGKRGDVKQIVDADHVVVAGVNQVKKHTRPNPMKNQQGGILTKEMPIHVSNIAIYNPVTQKPDRIGFRKLDDGRKVRFYKSNGEVLGA

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
208 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
232 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
236 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
237 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
240 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
245 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
331 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
332 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
336 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 3.51
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 4.91
Rhizosphere 90.88
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_101475703 3300005439 Bacteria 593
2 2214745064 2209111006 Bacteria 501
3 Ga0006778J45830_1046096 3300003162 Bacteria 1201
4 Ga0006759J45824_1080837 3300003163 Unclassified 1035
5 Ga0007417J51691_1047155 3300003544 Unclassified 889
6 Ga0007409J51694_1058104 3300003575 Bacteria 1131
7 Ga0007416J51690_1088879 3300003577 Bacteria 615
8 Ga0007429J51699_1046885 3300003579 Bacteria 1026
9 Ga0007429J51699_1099558 3300003579 Unclassified 1159
10 Ga0032354_1057883 3300003693 Bacteria 1091
11 Ga0032354_1090511 3300003693 Unclassified 1232
12 Ga0006780_1025585 3300003735 Bacteria 659
13 Ga0006780_1034386 3300003735 Bacteria 579
14 Ga0065704_10461491 3300005289 Bacteria 697
15 Ga0065715_10264410 3300005293 Bacteria 1088
16 Ga0070683_100053815 3300005329 Bacteria 3730
17 Ga0070690_100010582 3300005330 Bacteria 5373
18 Ga0070670_100023628 3300005331 Bacteria 5290
19 Ga0070670_100183006 3300005331 Bacteria 1819
20 Ga0068869_100100938 3300005334 Bacteria 2182
21 Ga0068869_100395476 3300005334 Bacteria 1135
22 Ga0070666_10041378 3300005335 Bacteria 3079
23 Ga0070680_100018240 3300005336 Bacteria 5543
24 Ga0070682_100006466 3300005337 Bacteria 6589
25 Ga0070682_100007042 3300005337 Bacteria 6327
26 Ga0070682_100121635 3300005337 Bacteria 1753
27 Ga0070682_100196386 3300005337 Bacteria 1420
28 Ga0070682_100733884 3300005337 Bacteria 795
29 Ga0070682_100805625 3300005337 Bacteria 763
30 Ga0068868_100267580 3300005338 Bacteria 1443
31 Ga0068868_102421474 3300005338 Bacteria 501
32 Ga0070660_100391215 3300005339 Bacteria 1148
33 Ga0070689_100003982 3300005340 Bacteria 9925
34 Ga0070689_100194297 3300005340 Bacteria 1653
35 Ga0070687_100095086 3300005343 Bacteria 1656
36 Ga0070661_100130867 3300005344 Bacteria 1884
37 Ga0070692_10230349 3300005345 Bacteria 1100
38 Ga0070692_10352773 3300005345 Bacteria 914
39 Ga0070668_100749280 3300005347 Bacteria 864
40 Ga0070669_100205146 3300005353 Bacteria 1553
41 Ga0070669_100294044 3300005353 Bacteria 1305
42 Ga0070669_100618704 3300005353 Bacteria 909
43 Ga0070675_100125471 3300005354 Bacteria 2183
44 Ga0070675_100524077 3300005354 Bacteria 1069
45 Ga0070675_100883705 3300005354 Bacteria 819
46 Ga0070671_100133678 3300005355 Bacteria 2090
47 Ga0070671_101236598 3300005355 Bacteria 658
48 Ga0070674_100004150 3300005356 Bacteria 8229
49 Ga0070674_100685579 3300005356 Bacteria 874
50 Ga0070673_100008504 3300005364 Bacteria 6826
51 Ga0070673_100118715 3300005364 Bacteria 2203
52 Ga0070673_100168997 3300005364 Bacteria 1865
53 Ga0070673_102246440 3300005364 Bacteria 518
54 Ga0070688_100002345 3300005365 Bacteria 9550
55 Ga0070688_100325685 3300005365 Bacteria 1118
56 Ga0070659_100096145 3300005366 Bacteria 2379
57 Ga0070667_100145643 3300005367 Bacteria 2077
58 Ga0070667_100225186 3300005367 Bacteria 1670
59 Ga0070709_10019345 3300005434 Bacteria 3934
60 Ga0070714_100121149 3300005435 Bacteria 2327
61 Ga0070714_101819222 3300005435 Bacteria 595
62 Ga0070713_100028191 3300005436 Bacteria 4432
63 Ga0070710_10593259 3300005437 Bacteria 770
64 Ga0070710_10751361 3300005437 Bacteria 692
65 Ga0070701_10323033 3300005438 Bacteria 955
66 Ga0070701_10759810 3300005438 Bacteria 657
67 Ga0070711_100008240 3300005439 Bacteria 6376
68 Ga0070711_101700020 3300005439 Bacteria 553
69 Ga0070705_100241009 3300005440 Bacteria 1263
70 Ga0070700_100111081 3300005441 Bacteria 1822
71 Ga0070694_100053717 3300005444 Bacteria 2727
72 Ga0070708_100080145 3300005445 Bacteria 2954
73 Ga0070708_100327113 3300005445 Bacteria 1444
74 Ga0070663_100085826 3300005455 Bacteria 2323
75 Ga0070663_100458942 3300005455 Bacteria 1051
76 Ga0070663_100663998 3300005455 Bacteria 883
77 Ga0070678_100016595 3300005456 Bacteria 4716
78 Ga0070662_100211742 3300005457 Bacteria 1542
79 Ga0070662_100271439 3300005457 Bacteria 1369
80 Ga0070681_11959989 3300005458 Bacteria 513
81 Ga0068867_100095351 3300005459 Bacteria 2263
82 Ga0068867_100396728 3300005459 Bacteria 1163
83 Ga0070685_10094060 3300005466 Bacteria 1819
84 Ga0070685_10280864 3300005466 Bacteria 1115
85 Ga0070685_10311142 3300005466 Bacteria 1064
86 Ga0070685_10448229 3300005466 Bacteria 903
87 Ga0070685_10691976 3300005466 Bacteria 743
88 Ga0070685_10776002 3300005466 Bacteria 704
89 Ga0070685_11148365 3300005466 Bacteria 588
90 Ga0070706_100018649 3300005467 Bacteria 6397
91 Ga0070707_100045940 3300005468 Bacteria 4179
92 Ga0070698_100051877 3300005471 Bacteria 4176
93 Ga0070698_101752916 3300005471 Bacteria 574
94 Ga0070698_101896285 3300005471 Bacteria 549
95 Ga0070699_100011946 3300005518 Bacteria 7495
96 Ga0070699_101924902 3300005518 Bacteria 541
97 Ga0070679_100023544 3300005530 Bacteria 6029
98 Ga0070679_100723651 3300005530 Bacteria 938
99 Ga0070684_100514140 3300005535 Bacteria 1110
100 Ga0070697_100018681 3300005536 Bacteria 5469
101 Ga0068853_100104452 3300005539 Bacteria 2508
102 Ga0070672_100064148 3300005543 Bacteria 2902
103 Ga0070686_100170608 3300005544 Bacteria 1538
104 Ga0070695_100017025 3300005545 Bacteria 4408
105 Ga0070696_100030255 3300005546 Bacteria 3706
106 Ga0070693_100102970 3300005547 Bacteria 1742
107 Ga0070665_100029414 3300005548 Bacteria 5529
108 Ga0070665_102050597 3300005548 Bacteria 577
109 Ga0070704_100001908 3300005549 Bacteria 11506
110 Ga0070664_100985756 3300005564 Bacteria 792
111 Ga0070664_100986569 3300005564 Bacteria 791
112 Ga0068857_100117666 3300005577 Bacteria 2391
113 Ga0068857_100558046 3300005577 Bacteria 1079
114 Ga0068857_100829381 3300005577 Bacteria 884
115 Ga0068854_100089190 3300005578 Bacteria 2291
116 Ga0068854_101105113 3300005578 Bacteria 706
117 Ga0068854_102170168 3300005578 Bacteria 513
118 Ga0068856_100332676 3300005614 Bacteria 1536
119 Ga0068856_101018128 3300005614 Bacteria 846
120 Ga0070702_100021262 3300005615 Bacteria 3411
121 Ga0068852_100045707 3300005616 Bacteria 3726
122 Ga0068852_100434751 3300005616 Bacteria 1296
123 Ga0068852_100869390 3300005616 Bacteria 918
124 Ga0068852_101822576 3300005616 Bacteria 631
125 Ga0068859_100006170 3300005617 Bacteria 12179
126 Ga0068864_100003967 3300005618 Bacteria 12179
127 Ga0068864_100033986 3300005618 Bacteria 4335
128 Ga0068864_100355350 3300005618 Bacteria 1383
129 Ga0068866_10002726 3300005718 Bacteria 7282
130 Ga0068861_100145584 3300005719 Bacteria 1939
131 Ga0068861_100174659 3300005719 Bacteria 1783
132 Ga0068861_100969414 3300005719 Bacteria 810
133 Ga0068851_10430612 3300005834 Bacteria 781
134 Ga0068870_10078377 3300005840 Bacteria 1820
135 Ga0068863_100011076 3300005841 Bacteria 8745
136 Ga0068863_100018124 3300005841 Bacteria 6742
137 Ga0068863_100181690 3300005841 Bacteria 2019
138 Ga0068858_100014524 3300005842 Bacteria 7419
139 Ga0068858_101300696 3300005842 Bacteria 716
140 Ga0068858_101987777 3300005842 Bacteria 575
141 Ga0068858_102115330 3300005842 Bacteria 556
142 Ga0068860_100125358 3300005843 Bacteria 2461
143 Ga0068860_100133724 3300005843 Bacteria 2381
144 Ga0068860_101039769 3300005843 Bacteria 837
145 Ga0068860_101195133 3300005843 Bacteria 781
146 Ga0068860_102801077 3300005843 Bacteria 505
147 Ga0068862_100451017 3300005844 Bacteria 1213
148 Ga0068862_101321872 3300005844 Bacteria 722
149 Ga0070717_10368806 3300006028 Bacteria 1286
150 Ga0070715_10057592 3300006163 Bacteria 1694
151 Ga0070715_10457662 3300006163 Bacteria 722
152 Ga0070716_100187911 3300006173 Bacteria 1362
153 Ga0070716_100210637 3300006173 Bacteria 1298
154 Ga0070712_100296952 3300006175 Bacteria 1306
155 Ga0075362_10332971 3300006177 Bacteria 758
156 Ga0075366_10147967 3300006195 Bacteria 1421
157 Ga0097621_100139427 3300006237 Bacteria 2071
158 Ga0097621_100154914 3300006237 Bacteria 1966
159 Ga0097621_100213968 3300006237 Bacteria 1677
160 Ga0068871_100226252 3300006358 Bacteria 1622
161 Ga0068871_100438049 3300006358 Bacteria 1169
162 Ga0068871_100530119 3300006358 Bacteria 1064
163 Ga0068871_100572813 3300006358 Bacteria 1024
164 Ga0068871_100809745 3300006358 Bacteria 864
165 Ga0068871_101922859 3300006358 Bacteria 563
166 Ga0075434_100472878 3300006871 Bacteria 1275
167 Ga0068865_100028985 3300006881 Bacteria 3668
168 Ga0068865_100761349 3300006881 Bacteria 832
169 Ga0075436_101147992 3300006914 Bacteria 585
170 Ga0097620_100006169 3300006931 Bacteria 12179
171 Ga0075435_100050036 3300007076 Bacteria 3362
172 Ga0105240_10034455 3300009093 Bacteria 6530
173 Ga0105240_12681081 3300009093 Bacteria 514
174 Ga0105245_10087460 3300009098 Bacteria 2860
175 Ga0105245_10804668 3300009098 Bacteria 978
176 Ga0105245_11630252 3300009098 Bacteria 697
177 Ga0105247_10795704 3300009101 Bacteria 721
178 Ga0105243_10653335 3300009148 Bacteria 1019
179 Ga0105241_10117250 3300009174 Bacteria 2139
180 Ga0105241_10143819 3300009174 Bacteria 1945
181 Ga0105242_10098887 3300009176 Bacteria 2468
182 Ga0105242_10206784 3300009176 Bacteria 1746
183 Ga0105248_10210369 3300009177 Bacteria 2191
184 Ga0105248_10659389 3300009177 Bacteria 1181
185 Ga0105237_10433594 3300009545 Bacteria 1320
186 Ga0105237_10973824 3300009545 Bacteria 855
187 Ga0105238_11540677 3300009551 Bacteria 694
188 Ga0105249_10949072 3300009553 Bacteria 928
189 Ga0105239_10482126 3300010375 Bacteria 1409
190 Ga0157373_10221765 3300013100 Bacteria 1334
191 Ga0157370_10022524 3300013104 Bacteria 6268
192 Ga0157370_10925755 3300013104 Bacteria 790
193 Ga0157369_10191343 3300013105 Bacteria 2150
194 Ga0157374_10000565 3300013296 Bacteria 32833
195 Ga0157374_10039033 3300013296 Bacteria 4368
196 Ga0157374_10299081 3300013296 Bacteria 1592
197 Ga0157374_12310678 3300013296 Bacteria 565
198 Ga0157378_10191397 3300013297 Bacteria 1930
199 Ga0157378_11573041 3300013297 Bacteria 703
200 Ga0157378_13144066 3300013297 Bacteria 513
201 Ga0163162_10289312 3300013306 Bacteria 1770
202 Ga0163162_10900335 3300013306 Bacteria 998
203 Ga0163162_11773449 3300013306 Bacteria 705
204 Ga0163162_11892675 3300013306 Bacteria 683
205 Ga0157372_11665392 3300013307 Bacteria 734
206 Ga0157375_10039139 3300013308 Bacteria 4560
207 Ga0163163_10000689 3300014325 Bacteria 28712
208 Ga0157380_11428835 3300014326 Bacteria 743
209 Ga0157380_11743176 3300014326 Bacteria 681
210 Ga0157380_12296327 3300014326 Bacteria 604
211 Ga0157377_10258433 3300014745 Bacteria 1132
212 Ga0157379_10014338 3300014968 Bacteria 6955
213 Ga0157379_10037733 3300014968 Bacteria 4309
214 Ga0157376_11108697 3300014969 Bacteria 817
215 Ga0157376_11804060 3300014969 Bacteria 648
216 Ga0157376_11804067 3300014969 Bacteria 648
217 Ga0182007_10186930 3300015262 Bacteria 719
218 Ga0163161_10121656 3300017792 Bacteria 1962
219 Ga0163161_10153250 3300017792 Bacteria 1753
220 Ga0213876_10144688 3300021384 Bacteria 1264
221 Ga0224712_10363123 3300022467 Bacteria 686
222 Ga0207666_1007648 3300025271 Bacteria 1427
223 Ga0207656_10047811 3300025321 Bacteria 1840
224 Ga0207656_10201224 3300025321 Bacteria 962
225 Ga0207682_10023578 3300025893 Bacteria 2432
226 Ga0207682_10228677 3300025893 Bacteria 862
227 Ga0207692_10163194 3300025898 Bacteria 1286
228 Ga0207642_10011396 3300025899 Bacteria 3170
229 Ga0207642_10812397 3300025899 Bacteria 595
230 Ga0207710_10507234 3300025900 Bacteria 626
231 Ga0207680_10010180 3300025903 Bacteria 4694
232 Ga0207680_11283510 3300025903 Bacteria 521
233 Ga0207685_10010891 3300025905 Bacteria 2709
234 Ga0207685_10195087 3300025905 Bacteria 948
235 Ga0207699_10050656 3300025906 Bacteria 2450
236 Ga0207699_10088740 3300025906 Bacteria 1936
237 Ga0207645_10027678 3300025907 Bacteria 3659
238 Ga0207645_10049650 3300025907 Bacteria 2679
239 Ga0207643_10014781 3300025908 Bacteria 4245
240 Ga0207684_10221801 3300025910 Bacteria 1631
241 Ga0207654_10053235 3300025911 Bacteria 2336
242 Ga0207654_10437571 3300025911 Bacteria 915
243 Ga0207707_10144644 3300025912 Bacteria 2078
244 Ga0207695_10096000 3300025913 Bacteria 2967
245 Ga0207671_10066252 3300025914 Bacteria 2688
246 Ga0207693_10292792 3300025915 Bacteria 1276
247 Ga0207693_10293235 3300025915 Bacteria 1275
248 Ga0207663_10397922 3300025916 Bacteria 1053
249 Ga0207663_11043154 3300025916 Bacteria 656
250 Ga0207662_10034975 3300025918 Bacteria 2933
251 Ga0207657_10000280 3300025919 Bacteria 54274
252 Ga0207649_10288262 3300025920 Bacteria 1196
253 Ga0207652_10047579 3300025921 Bacteria 3664
254 Ga0207646_11151875 3300025922 Bacteria 681
255 Ga0207681_10044851 3300025923 Bacteria 2965
256 Ga0207681_10082649 3300025923 Bacteria 2271
257 Ga0207681_10788204 3300025923 Bacteria 793
258 Ga0207681_11872073 3300025923 Bacteria 500
259 Ga0207694_10111371 3300025924 Bacteria 2178
260 Ga0207650_10051370 3300025925 Bacteria 3051
261 Ga0207650_10159884 3300025925 Bacteria 1784
262 Ga0207659_10020666 3300025926 Bacteria 4355
263 Ga0207659_10061691 3300025926 Bacteria 2703
264 Ga0207659_11007083 3300025926 Bacteria 717
265 Ga0207687_10009212 3300025927 Bacteria 6460
266 Ga0207687_10450705 3300025927 Bacteria 1067
267 Ga0207687_10469513 3300025927 Bacteria 1046
268 Ga0207687_11055330 3300025927 Bacteria 697
269 Ga0207700_10000077 3300025928 Bacteria 60197
270 Ga0207700_10003616 3300025928 Bacteria 9010
271 Ga0207700_10456890 3300025928 Bacteria 1126
272 Ga0207664_10089418 3300025929 Bacteria 2521
273 Ga0207664_10825101 3300025929 Bacteria 834
274 Ga0207644_10003510 3300025931 Bacteria 10149
275 Ga0207644_10470688 3300025931 Bacteria 1034
276 Ga0207706_10049971 3300025933 Bacteria 3695
277 Ga0207706_10068780 3300025933 Bacteria 3115
278 Ga0207706_11057902 3300025933 Bacteria 680
279 Ga0207686_10000521 3300025934 Bacteria 24900
280 Ga0207709_11809647 3300025935 Bacteria 508
281 Ga0207670_10031394 3300025936 Bacteria 3404
282 Ga0207670_10126684 3300025936 Bacteria 1864
283 Ga0207669_10034982 3300025937 Bacteria 2853
284 Ga0207669_11332938 3300025937 Bacteria 610
285 Ga0207704_10371140 3300025938 Bacteria 1120
286 Ga0207665_10163137 3300025939 Bacteria 1604
287 Ga0207665_10168544 3300025939 Bacteria 1580
288 Ga0207691_10119402 3300025940 Bacteria 2338
289 Ga0207711_10007779 3300025941 Bacteria 8957
290 Ga0207711_10116126 3300025941 Bacteria 2385
291 Ga0207689_10017314 3300025942 Bacteria 6099
292 Ga0207689_10087941 3300025942 Bacteria 2552
293 Ga0207661_10084193 3300025944 Bacteria 2633
294 Ga0207679_10008024 3300025945 Bacteria 6714
295 Ga0207667_10034246 3300025949 Bacteria 5455
296 Ga0207651_10038713 3300025960 Bacteria 3136
297 Ga0207651_10160226 3300025960 Bacteria 1763
298 Ga0207651_10240352 3300025960 Bacteria 1475
299 Ga0207668_10781075 3300025972 Bacteria 844
300 Ga0207640_10213756 3300025981 Bacteria 1471
301 Ga0207640_12157991 3300025981 Bacteria 505
302 Ga0207658_10108614 3300025986 Bacteria 2188
303 Ga0207658_10426508 3300025986 Bacteria 1170
304 Ga0207658_10682584 3300025986 Bacteria 927
305 Ga0207658_11177486 3300025986 Bacteria 700
306 Ga0207677_10001880 3300026023 Bacteria 11094
307 Ga0207677_10460751 3300026023 Bacteria 1091
308 Ga0207703_10000517 3300026035 Bacteria 39928
309 Ga0207703_10508833 3300026035 Bacteria 1131
310 Ga0207703_11834358 3300026035 Bacteria 582
311 Ga0207639_10386764 3300026041 Bacteria 1257
312 Ga0207639_10407450 3300026041 Bacteria 1226
313 Ga0207639_10872319 3300026041 Bacteria 840
314 Ga0207678_10049262 3300026067 Bacteria 3641
315 Ga0207678_10221380 3300026067 Bacteria 1620
316 Ga0207678_10418186 3300026067 Bacteria 1162
317 Ga0207708_10036414 3300026075 Bacteria 3746
318 Ga0207702_10023468 3300026078 Bacteria 5117
319 Ga0207702_10710077 3300026078 Bacteria 991
320 Ga0207641_10002453 3300026088 Bacteria 17140
321 Ga0207641_10194844 3300026088 Bacteria 1864
322 Ga0207641_12313739 3300026088 Bacteria 537
323 Ga0207648_10067573 3300026089 Bacteria 3116
324 Ga0207648_10110547 3300026089 Bacteria 2412
325 Ga0207676_10000167 3300026095 Bacteria 57507
326 Ga0207676_10989280 3300026095 Bacteria 828
327 Ga0207674_10005648 3300026116 Bacteria 14829
328 Ga0207674_10272624 3300026116 Bacteria 1640
329 Ga0207674_11366379 3300026116 Bacteria 678
330 Ga0207683_10000965 3300026121 Bacteria 26325
331 Ga0207683_10326955 3300026121 Bacteria 1405
332 Ga0207698_10223680 3300026142 Bacteria 1703
333 Ga0207698_11189483 3300026142 Bacteria 776
334 Ga0207698_11537700 3300026142 Bacteria 681
335 Ga0207698_12161812 3300026142 Bacteria 570
336 Ga0268266_10034899 3300028379 Bacteria 4278
337 Ga0268266_11043146 3300028379 Bacteria 791
338 Ga0268265_12584532 3300028380 Bacteria 513
339 Ga0268264_10256879 3300028381 Bacteria 1626
340 Ga0268264_11053895 3300028381 Bacteria 821
341 Ga0268264_12213809 3300028381 Bacteria 557
342 Ga0307511_10199460 3300030521 Bacteria 1042
343 Ga0265331_10222810 3300031250 Bacteria 847
344 Ga0265327_10096239 3300031251 Bacteria 1436
345 Ga0265316_10187269 3300031344 Bacteria 1539
346 Ga0307513_10007825 3300031456 Bacteria 13780
347 Ga0307513_10058418 3300031456 Bacteria 4100
348 Ga0307513_10894178 3300031456 Bacteria 595
349 Ga0307509_10129451 3300031507 Bacteria 2483
350 Ga0316579_10001358 3300031691 Bacteria 8860
351 Ga0265314_10079888 3300031711 Bacteria 2161
352 Ga0316576_11289160 3300031727 Bacteria 514
353 Ga0316578_10139542 3300031728 Bacteria 1460
354 Ga0307405_11240420 3300031731 Bacteria 646
355 Ga0307405_11627211 3300031731 Bacteria 570
356 Ga0316577_10018529 3300031733 Bacteria 3851
357 Ga0307413_10035769 3300031824 Bacteria 2852
358 Ga0307413_10323245 3300031824 Bacteria 1179
359 Ga0307410_10002645 3300031852 Bacteria 8733
360 Ga0307406_10023518 3300031901 Bacteria 3667
361 Ga0307407_10197478 3300031903 Bacteria 1345
362 Ga0307407_10279264 3300031903 Bacteria 1156
363 Ga0307407_11086775 3300031903 Bacteria 621
364 Ga0307412_10070851 3300031911 Bacteria 2378
365 Ga0307412_10418752 3300031911 Bacteria 1095
366 Ga0307409_100018987 3300031995 Bacteria 4642
367 Ga0307409_100072562 3300031995 Bacteria 2742
368 Ga0307409_100572042 3300031995 Bacteria 1112
369 Ga0307409_101421592 3300031995 Bacteria 720
370 Ga0307416_100012582 3300032002 Bacteria 5710
371 Ga0307416_100988698 3300032002 Bacteria 944
372 Ga0307416_102860052 3300032002 Bacteria 577
373 Ga0307414_11340863 3300032004 Bacteria 664
374 Ga0307414_11358646 3300032004 Bacteria 660
375 Ga0307411_10154439 3300032005 Bacteria 1710
376 Ga0307415_100221059 3300032126 Bacteria 1518
377 Ga0307415_100567320 3300032126 Bacteria 1004
378 Ga0307415_101362344 3300032126 Bacteria 674
379 Ga0307415_102409007 3300032126 Bacteria 517
380 Ga0316585_10166370 3300032137 Unclassified 728
381 Ga0316593_10001014 3300032168 Bacteria 5811
382 Ga0316593_10001205 3300032168 Bacteria 5552
383 Ga0316593_10011448 3300032168 Bacteria 2577
384 Ga0316593_10062108 3300032168 Bacteria 1279
385 Ga0316596_1000037 3300033541 Bacteria 13851
386 Ga0316596_1000651 3300033541 Bacteria 6226
387 Ga0316596_1005103 3300033541 Bacteria 2985
388 Ga0316596_1006327 3300033541 Bacteria 2750
389 Ga0373926_0089744 3300035083 Bacteria 1142
390 Ga0373926_0340831 3300035083 Bacteria 588
391 Ga0373944_0031983 3300035089 Bacteria 1586
392 Ga0373923_0003643 3300035111 Bacteria 4979
393 Ga0373945_0132188 3300035116 Bacteria 1000
394 Ga0373953_0029254 3300035117 Bacteria 2129
395 Ga0373953_0329538 3300035117 Bacteria 668
396 Ga0373954_0010327 3300035118 Bacteria 4119
397 Ga0373954_0322541 3300035118 Bacteria 762
398 Ga0373956_0035945 3300035119 Bacteria 2186
399 Ga0373956_0440188 3300035119 Bacteria 622
400 Ga0373943_0039852 3300035170 Bacteria 2265
401 Ga0373943_0148506 3300035170 Bacteria 1268
402 Ga0373943_0935396 3300035170 Bacteria 518
403 Ga0373946_0093046 3300035171 Bacteria 1339
404 Ga0373946_0122109 3300035171 Bacteria 1190
405 Ga0373955_0008568 3300035172 Bacteria 4754
406 Ga0373955_0507826 3300035172 Bacteria 736
407 Ga0373924_0000835 3300035410 Bacteria 9645
408 Ga0373924_0005225 3300035410 Bacteria 4585
409 Ga0373935_0057224 3300035692 Bacteria 2487
410 Ga0373935_0110058 3300035692 Bacteria 1827
411 Ga0373935_0380554 3300035692 Bacteria 1010
412 Ga0373927_0034603 3300035695 Bacteria 3286
413 Ga0373927_0144358 3300035695 Bacteria 1557
414 Ga0373927_0205126 3300035695 Bacteria 1294
415 Ga0373933_0190910 3300035724 Bacteria 1308
416 Ga0373947_0067034 3300035725 Bacteria 2191
417 Ga0373947_0206318 3300035725 Bacteria 1287
418 Ga0373947_0550473 3300035725 Bacteria 785
419 Ga0373947_0786874 3300035725 Bacteria 649
420 Ga0373937_0069568 3300036401 Bacteria 3245
421 Ga0373937_0562074 3300036401 Bacteria 1083
422 Ga0316582_0001466 3300036647 Bacteria 10378
423 Ga0316584_0005838 3300036712 Bacteria 8309
424 Ga0316584_0015064 3300036712 Bacteria 5524
425 Ga0373925_0058172 3300037068 Bacteria 2898
426 Ga0373925_0063911 3300037068 Bacteria 2769
427 Ga0373925_0660708 3300037068 Bacteria 861
428 Ga0373925_1419748 3300037068 Bacteria 568
429 Ga0316581_0007450 3300037588 Bacteria 2937
430 Ga0436365_0157965 3300039437 Bacteria 624
431 Ga0436365_0659106 3300039437 Bacteria 1438
432 Ga0451787_785113 3300041441 Bacteria 616
433 Ga0451789_0763061 3300041443 Bacteria 695
434 Ga0451793_1558171 3300041452 Bacteria 1106
435 Ga0451797_0883384 3300041453 Bacteria 521
436 Ga0451798_0442740 3300041458 Bacteria 1442
437 Ga0451800_1431532 3300041459 Bacteria 602
438 Ga0451804_0590630 3300041463 Bacteria 739
439 Ga0451807_0976509 3300041486 Bacteria 574
440 Ga0451807_2463887 3300041486 Bacteria 567
441 Ga0451851_0973768 3300041507 Bacteria 813
442 Ga0451855_0706880 3300041511 Bacteria 592
443 Ga0451853_1002462 3300041512 Bacteria 882
444 Ga0451853_2064316 3300041512 Bacteria 1252
445 Ga0451853_3830933 3300041512 Bacteria 766
446 Ga0439448_0047876 3300042005 Bacteria 1395
447 Ga0450898_005452 3300042134 Bacteria 1923
448 Ga0450898_062440 3300042134 Bacteria 735
449 Ga0439459_0059427 3300042438 Bacteria 860
450 Ga0439460_0007876 3300042461 Bacteria 2677
451 Ga0451577_0000210 3300042876 Bacteria 122637
452 Ga0451577_0030002 3300042876 Bacteria 4913
453 Ga0453684_0902460 3300044712 Bacteria 946
454 Ga0453684_2496754 3300044712 Bacteria 510
455 Ga0451576_0000741 3300045051 Bacteria 65303
456 Ga0495603_0095784 3300046455 Bacteria 1734
457 Ga0495590_0008779 3300046457 Bacteria 3845
458 Ga0495629_0087873 3300046459 Bacteria 2168
459 Ga0495638_0192712 3300046460 Bacteria 1156
460 Ga0495638_0230521 3300046460 Bacteria 1031
461 Ga0495651_0075629 3300046462 Bacteria 2553
462 Ga0495653_0181464 3300046463 Bacteria 1444
463 Ga0495580_0024838 3300046472 Bacteria 4382
464 Ga0495582_0005514 3300046473 Bacteria 7048
465 Ga0495639_0016200 3300046475 Bacteria 3234
466 Ga0495662_0052388 3300046476 Bacteria 1970
467 Ga0495664_0083745 3300046477 Bacteria 1914
468 Ga0495584_0108022 3300046491 Bacteria 1407
469 Ga0495585_0524790 3300046492 Bacteria 561
470 Ga0495583_0229809 3300046506 Bacteria 748
471 Ga0495608_0054037 3300046511 Bacteria 2656
472 Ga0495610_0196589 3300046512 Bacteria 829
473 Ga0495616_0006494 3300046513 Bacteria 7072
474 Ga0495616_0100606 3300046513 Bacteria 1356
475 Ga0495628_0142359 3300046516 Bacteria 1830
476 Ga0495628_1077631 3300046516 Bacteria 550
477 Ga0495630_0520532 3300046517 Bacteria 912
478 Ga0495632_0181361 3300046519 Bacteria 964
479 Ga0495652_0463616 3300046529 Bacteria 885
480 Ga0495654_0117315 3300046530 Bacteria 1208
481 Ga0495665_0012732 3300046531 Bacteria 4551
482 Ga0495665_0321378 3300046531 Bacteria 790
483 Ga0495586_0081286 3300046535 Bacteria 1781
484 Ga0495621_0052186 3300046539 Bacteria 1465
485 Ga0495645_0044382 3300046543 Bacteria 3242
486 Ga0495633_0093207 3300046558 Bacteria 1400
487 Ga0495667_0151109 3300046559 Bacteria 1495
488 Ga0495668_0438023 3300046616 Bacteria 719
489 Ga0495668_0488391 3300046616 Bacteria 678
490 Ga0495634_0299776 3300046642 Bacteria 972
491 Ga0495634_0635465 3300046642 Bacteria 617
492 Ga0495625_0020303 3300046660 Bacteria 5131
493 Ga0495625_0138933 3300046660 Bacteria 1640
494 Ga0495625_0289967 3300046660 Bacteria 1050
495 Ga0495635_0028671 3300046663 Bacteria 3869
496 Ga0495635_0684962 3300046663 Bacteria 665
497 Ga0495588_0635487 3300046674 Bacteria 559
498 Ga0495657_0222398 3300046675 Bacteria 1144
499 Ga0495647_0050239 3300046681 Bacteria 1617
500 Ga0495658_0004803 3300046683 Bacteria 6626
501 Ga0495669_0619178 3300046684 Bacteria 526
502 Ga0495613_0007458 3300046689 Bacteria 8147
503 Ga0495649_0063250 3300046694 Bacteria 1988
504 Ga0495649_0140027 3300046694 Bacteria 1274
505 Ga0495600_0073547 3300046809 Bacteria 2232
506 Ga0495600_0121769 3300046809 Bacteria 1697
507 Ga0495581_0002892 3300047315 Bacteria 9824
508 Ga0495674_0205458 3300047319 Bacteria 1633
509 Ga0495672_0415005 3300047320 Bacteria 613
510 Ga0495680_0328117 3300047322 Bacteria 1070
511 Ga0495675_0397083 3300047444 Bacteria 804
512 Ga0495677_0201442 3300047445 Bacteria 774
513 Ga0495673_0112797 3300047469 Bacteria 1085
514 Ga0495684_0086399 3300047471 Bacteria 2377
515 Ga0495684_0813217 3300047471 Bacteria 609
516 Ga0495686_0054615 3300047472 Bacteria 2500
517 Ga0495686_0202197 3300047472 Bacteria 1139
518 Ga0495593_0120323 3300047673 Bacteria 1336
519 Ga0495614_0034982 3300048089 Bacteria 2159
520 Ga0495626_0091370 3300048091 Bacteria 1338
521 Ga0496100_0077634 3300048903 Bacteria 2233
522 Ga0496101_0009169 3300048904 Bacteria 6495
523 Ga0496102_0024884 3300048905 Bacteria 5324
524 Ga0496104_0015885 3300048907 Bacteria 6831
525 Ga0496104_0642852 3300048907 Bacteria 970
526 Ga0496105_0097194 3300048908 Bacteria 2432
527 Ga0496106_0081553 3300048909 Bacteria 2485
528 Ga0496106_0135606 3300048909 Bacteria 1933
529 Ga0496108_0091599 3300048911 Bacteria 2584
530 Ga0496108_0366367 3300048911 Bacteria 1258
531 Ga0496109_0022741 3300048912 Bacteria 5554
532 Ga0496110_1477400 3300048913 Bacteria 589
533 Ga0496111_0458832 3300048914 Bacteria 940
534 Ga0496112_0022409 3300048915 Bacteria 6020
535 Ga0496112_1172567 3300048915 Bacteria 685
536 Ga0496114_0292872 3300048917 Bacteria 1436
537 Ga0496114_0312953 3300048917 Bacteria 1387
538 Ga0496115_0106529 3300048918 Bacteria 2301
539 Ga0496115_0881200 3300048918 Bacteria 691
540 Ga0501038_0941681 3300049574 Bacteria 636
541 Ga0501040_1211462 3300049576 Bacteria 548
542 Ga0501042_0290769 3300049578 Bacteria 1180
543 Ga0501042_0431693 3300049578 Bacteria 955
544 Ga0501069_0203588 3300049585 Bacteria 1147
545 Ga0501070_0044881 3300049586 Bacteria 3676
546 Ga0501070_0086478 3300049586 Bacteria 2595
547 Ga0501074_0018349 3300049590 Bacteria 5081
548 Ga0501074_0258508 3300049590 Bacteria 1238
549 Ga0501080_0028144 3300049742 Bacteria 5226
550 nmdc:mga03683_496039_c1 3300050489 Bacteria 591
551 nmdc:mga0k408_205408_c1 3300050493 Bacteria 1176
552 nmdc:mga0k408_353455_c1 3300050493 Bacteria 876
553 nmdc:mga0k408_436542_c1 3300050493 Bacteria 778
554 nmdc:mga0n895_152982_c1 3300050512 Bacteria 2337
555 nmdc:mga0rr50_34673_c1 3300050513 Bacteria 3616
556 Ga0495601_0178356 3300053077 Bacteria 1389
557 Ga0495601_0505756 3300053077 Bacteria 779
558 Ga0495612_0184342 3300053078 Bacteria 917
559 Ga0495655_0248040 3300053083 Bacteria 598
560 Ga0495595_0037169 3300053084 Bacteria 2213
561 Ga0495619_0004860 3300053085 Bacteria 8527
562 Ga0495619_0842350 3300053085 Bacteria 619
563 Ga0500644_0024450 3300053088 Bacteria 1847
564 Ga0500611_001920 3300053727 Bacteria 2398
565 Ga0500611_172857 3300053727 Bacteria 602
566 Ga0590071_033626 3300059421 Bacteria 1226
567 Ga0590075_108650 3300059424 Bacteria 724
568 Ga0501082_0502504 3300060353 Bacteria 1060
569 2894510842 2894510363 Bacteria 5121143
570 8001524072 8001522603 Bacteria 4726425
571 Ga0070711_101475703
572 2214745064
573 Ga0006778J45830_1046096
574 Ga0006759J45824_1080837
575 Ga0007417J51691_1047155
576 Ga0007409J51694_1058104
577 Ga0007416J51690_1088879
578 Ga0007429J51699_1046885
579 Ga0007429J51699_1099558
580 Ga0032354_1057883
581 Ga0032354_1090511
582 Ga0006780_1025585
583 Ga0006780_1034386
584 Ga0065704_10461491
585 Ga0065715_10264410
586 Ga0070683_100053815
587 Ga0070690_100010582
588 Ga0070670_100023628
589 Ga0070670_100183006
590 Ga0068869_100100938
591 Ga0068869_100395476
592 Ga0070666_10041378
593 Ga0070680_100018240
594 Ga0070682_100006466
595 Ga0070682_100007042
596 Ga0070682_100121635
597 Ga0070682_100196386
598 Ga0070682_100733884
599 Ga0070682_100805625
600 Ga0068868_100267580
601 Ga0068868_102421474
602 Ga0070660_100391215
603 Ga0070689_100003982
604 Ga0070689_100194297
605 Ga0070687_100095086
606 Ga0070661_100130867
607 Ga0070692_10230349
608 Ga0070692_10352773
609 Ga0070668_100749280
610 Ga0070669_100205146
611 Ga0070669_100294044
612 Ga0070669_100618704
613 Ga0070675_100125471
614 Ga0070675_100524077
615 Ga0070675_100883705
616 Ga0070671_100133678
617 Ga0070671_101236598
618 Ga0070674_100004150
619 Ga0070674_100685579
620 Ga0070673_100008504
621 Ga0070673_100118715
622 Ga0070673_100168997
623 Ga0070673_102246440
624 Ga0070688_100002345
625 Ga0070688_100325685
626 Ga0070659_100096145
627 Ga0070667_100145643
628 Ga0070667_100225186
629 Ga0070709_10019345
630 Ga0070714_100121149
631 Ga0070714_101819222
632 Ga0070713_100028191
633 Ga0070710_10593259
634 Ga0070710_10751361
635 Ga0070701_10323033
636 Ga0070701_10759810
637 Ga0070711_100008240
638 Ga0070711_101700020
639 Ga0070705_100241009
640 Ga0070700_100111081
641 Ga0070694_100053717
642 Ga0070708_100080145
643 Ga0070708_100327113
644 Ga0070663_100085826
645 Ga0070663_100458942
646 Ga0070663_100663998
647 Ga0070678_100016595
648 Ga0070662_100211742
649 Ga0070662_100271439
650 Ga0070681_11959989
651 Ga0068867_100095351
652 Ga0068867_100396728
653 Ga0070685_10094060
654 Ga0070685_10280864
655 Ga0070685_10311142
656 Ga0070685_10448229
657 Ga0070685_10691976
658 Ga0070685_10776002
659 Ga0070685_11148365
660 Ga0070706_100018649
661 Ga0070707_100045940
662 Ga0070698_100051877
663 Ga0070698_101752916
664 Ga0070698_101896285
665 Ga0070699_100011946
666 Ga0070699_101924902
667 Ga0070679_100023544
668 Ga0070679_100723651
669 Ga0070684_100514140
670 Ga0070697_100018681
671 Ga0068853_100104452
672 Ga0070672_100064148
673 Ga0070686_100170608
674 Ga0070695_100017025
675 Ga0070696_100030255
676 Ga0070693_100102970
677 Ga0070665_100029414
678 Ga0070665_102050597
679 Ga0070704_100001908
680 Ga0070664_100985756
681 Ga0070664_100986569
682 Ga0068857_100117666
683 Ga0068857_100558046
684 Ga0068857_100829381
685 Ga0068854_100089190
686 Ga0068854_101105113
687 Ga0068854_102170168
688 Ga0068856_100332676
689 Ga0068856_101018128
690 Ga0070702_100021262
691 Ga0068852_100045707
692 Ga0068852_100434751
693 Ga0068852_100869390
694 Ga0068852_101822576
695 Ga0068859_100006170
696 Ga0068864_100003967
697 Ga0068864_100033986
698 Ga0068864_100355350
699 Ga0068866_10002726
700 Ga0068861_100145584
701 Ga0068861_100174659
702 Ga0068861_100969414
703 Ga0068851_10430612
704 Ga0068870_10078377
705 Ga0068863_100011076
706 Ga0068863_100018124
707 Ga0068863_100181690
708 Ga0068858_100014524
709 Ga0068858_101300696
710 Ga0068858_101987777
711 Ga0068858_102115330
712 Ga0068860_100125358
713 Ga0068860_100133724
714 Ga0068860_101039769
715 Ga0068860_101195133
716 Ga0068860_102801077
717 Ga0068862_100451017
718 Ga0068862_101321872
719 Ga0070717_10368806
720 Ga0070715_10057592
721 Ga0070715_10457662
722 Ga0070716_100187911
723 Ga0070716_100210637
724 Ga0070712_100296952
725 Ga0075362_10332971
726 Ga0075366_10147967
727 Ga0097621_100139427
728 Ga0097621_100154914
729 Ga0097621_100213968
730 Ga0068871_100226252
731 Ga0068871_100438049
732 Ga0068871_100530119
733 Ga0068871_100572813
734 Ga0068871_100809745
735 Ga0068871_101922859
736 Ga0075434_100472878
737 Ga0068865_100028985
738 Ga0068865_100761349
739 Ga0075436_101147992
740 Ga0097620_100006169
741 Ga0075435_100050036
742 Ga0105240_10034455
743 Ga0105240_12681081
744 Ga0105245_10087460
745 Ga0105245_10804668
746 Ga0105245_11630252
747 Ga0105247_10795704
748 Ga0105243_10653335
749 Ga0105241_10117250
750 Ga0105241_10143819
751 Ga0105242_10098887
752 Ga0105242_10206784
753 Ga0105248_10210369
754 Ga0105248_10659389
755 Ga0105237_10433594
756 Ga0105237_10973824
757 Ga0105238_11540677
758 Ga0105249_10949072
759 Ga0105239_10482126
760 Ga0157373_10221765
761 Ga0157370_10022524
762 Ga0157370_10925755
763 Ga0157369_10191343
764 Ga0157374_10000565
765 Ga0157374_10039033
766 Ga0157374_10299081
767 Ga0157374_12310678
768 Ga0157378_10191397
769 Ga0157378_11573041
770 Ga0157378_13144066
771 Ga0163162_10289312
772 Ga0163162_10900335
773 Ga0163162_11773449
774 Ga0163162_11892675
775 Ga0157372_11665392
776 Ga0157375_10039139
777 Ga0163163_10000689
778 Ga0157380_11428835
779 Ga0157380_11743176
780 Ga0157380_12296327
781 Ga0157377_10258433
782 Ga0157379_10014338
783 Ga0157379_10037733
784 Ga0157376_11108697
785 Ga0157376_11804060
786 Ga0157376_11804067
787 Ga0182007_10186930
788 Ga0163161_10121656
789 Ga0163161_10153250
790 Ga0213876_10144688
791 Ga0224712_10363123
792 Ga0207666_1007648
793 Ga0207656_10047811
794 Ga0207656_10201224
795 Ga0207682_10023578
796 Ga0207682_10228677
797 Ga0207692_10163194
798 Ga0207642_10011396
799 Ga0207642_10812397
800 Ga0207710_10507234
801 Ga0207680_10010180
802 Ga0207680_11283510
803 Ga0207685_10010891
804 Ga0207685_10195087
805 Ga0207699_10050656
806 Ga0207699_10088740
807 Ga0207645_10027678
808 Ga0207645_10049650
809 Ga0207643_10014781
810 Ga0207684_10221801
811 Ga0207654_10053235
812 Ga0207654_10437571
813 Ga0207707_10144644
814 Ga0207695_10096000
815 Ga0207671_10066252
816 Ga0207693_10292792
817 Ga0207693_10293235
818 Ga0207663_10397922
819 Ga0207663_11043154
820 Ga0207662_10034975
821 Ga0207657_10000280
822 Ga0207649_10288262
823 Ga0207652_10047579
824 Ga0207646_11151875
825 Ga0207681_10044851
826 Ga0207681_10082649
827 Ga0207681_10788204
828 Ga0207681_11872073
829 Ga0207694_10111371
830 Ga0207650_10051370
831 Ga0207650_10159884
832 Ga0207659_10020666
833 Ga0207659_10061691
834 Ga0207659_11007083
835 Ga0207687_10009212
836 Ga0207687_10450705
837 Ga0207687_10469513
838 Ga0207687_11055330
839 Ga0207700_10000077
840 Ga0207700_10003616
841 Ga0207700_10456890
842 Ga0207664_10089418
843 Ga0207664_10825101
844 Ga0207644_10003510
845 Ga0207644_10470688
846 Ga0207706_10049971
847 Ga0207706_10068780
848 Ga0207706_11057902
849 Ga0207686_10000521
850 Ga0207709_11809647
851 Ga0207670_10031394
852 Ga0207670_10126684
853 Ga0207669_10034982
854 Ga0207669_11332938
855 Ga0207704_10371140
856 Ga0207665_10163137
857 Ga0207665_10168544
858 Ga0207691_10119402
859 Ga0207711_10007779
860 Ga0207711_10116126
861 Ga0207689_10017314
862 Ga0207689_10087941
863 Ga0207661_10084193
864 Ga0207679_10008024
865 Ga0207667_10034246
866 Ga0207651_10038713
867 Ga0207651_10160226
868 Ga0207651_10240352
869 Ga0207668_10781075
870 Ga0207640_10213756
871 Ga0207640_12157991
872 Ga0207658_10108614
873 Ga0207658_10426508
874 Ga0207658_10682584
875 Ga0207658_11177486
876 Ga0207677_10001880
877 Ga0207677_10460751
878 Ga0207703_10000517
879 Ga0207703_10508833
880 Ga0207703_11834358
881 Ga0207639_10386764
882 Ga0207639_10407450
883 Ga0207639_10872319
884 Ga0207678_10049262
885 Ga0207678_10221380
886 Ga0207678_10418186
887 Ga0207708_10036414
888 Ga0207702_10023468
889 Ga0207702_10710077
890 Ga0207641_10002453
891 Ga0207641_10194844
892 Ga0207641_12313739
893 Ga0207648_10067573
894 Ga0207648_10110547
895 Ga0207676_10000167
896 Ga0207676_10989280
897 Ga0207674_10005648
898 Ga0207674_10272624
899 Ga0207674_11366379
900 Ga0207683_10000965
901 Ga0207683_10326955
902 Ga0207698_10223680
903 Ga0207698_11189483
904 Ga0207698_11537700
905 Ga0207698_12161812
906 Ga0268266_10034899
907 Ga0268266_11043146
908 Ga0268265_12584532
909 Ga0268264_10256879
910 Ga0268264_11053895
911 Ga0268264_12213809
912 Ga0307511_10199460
913 Ga0265331_10222810
914 Ga0265327_10096239
915 Ga0265316_10187269
916 Ga0307513_10007825
917 Ga0307513_10058418
918 Ga0307513_10894178
919 Ga0307509_10129451
920 Ga0316579_10001358
921 Ga0265314_10079888
922 Ga0316576_11289160
923 Ga0316578_10139542
924 Ga0307405_11240420
925 Ga0307405_11627211
926 Ga0316577_10018529
927 Ga0307413_10035769
928 Ga0307413_10323245
929 Ga0307410_10002645
930 Ga0307406_10023518
931 Ga0307407_10197478
932 Ga0307407_10279264
933 Ga0307407_11086775
934 Ga0307412_10070851
935 Ga0307412_10418752
936 Ga0307409_100018987
937 Ga0307409_100072562
938 Ga0307409_100572042
939 Ga0307409_101421592
940 Ga0307416_100012582
941 Ga0307416_100988698
942 Ga0307416_102860052
943 Ga0307414_11340863
944 Ga0307414_11358646
945 Ga0307411_10154439
946 Ga0307415_100221059
947 Ga0307415_100567320
948 Ga0307415_101362344
949 Ga0307415_102409007
950 Ga0316585_10166370
951 Ga0316593_10001014
952 Ga0316593_10001205
953 Ga0316593_10011448
954 Ga0316593_10062108
955 Ga0316596_1000037
956 Ga0316596_1000651
957 Ga0316596_1005103
958 Ga0316596_1006327
959 Ga0373926_0089744
960 Ga0373926_0340831
961 Ga0373944_0031983
962 Ga0373923_0003643
963 Ga0373945_0132188
964 Ga0373953_0029254
965 Ga0373953_0329538
966 Ga0373954_0010327
967 Ga0373954_0322541
968 Ga0373956_0035945
969 Ga0373956_0440188
970 Ga0373943_0039852
971 Ga0373943_0148506
972 Ga0373943_0935396
973 Ga0373946_0093046
974 Ga0373946_0122109
975 Ga0373955_0008568
976 Ga0373955_0507826
977 Ga0373924_0000835
978 Ga0373924_0005225
979 Ga0373935_0057224
980 Ga0373935_0110058
981 Ga0373935_0380554
982 Ga0373927_0034603
983 Ga0373927_0144358
984 Ga0373927_0205126
985 Ga0373933_0190910
986 Ga0373947_0067034
987 Ga0373947_0206318
988 Ga0373947_0550473
989 Ga0373947_0786874
990 Ga0373937_0069568
991 Ga0373937_0562074
992 Ga0316582_0001466
993 Ga0316584_0005838
994 Ga0316584_0015064
995 Ga0373925_0058172
996 Ga0373925_0063911
997 Ga0373925_0660708
998 Ga0373925_1419748
999 Ga0316581_0007450
1000 Ga0436365_0157965
1001 Ga0436365_0659106
1002 Ga0451787_785113
1003 Ga0451789_0763061
1004 Ga0451793_1558171
1005 Ga0451797_0883384
1006 Ga0451798_0442740
1007 Ga0451800_1431532
1008 Ga0451804_0590630
1009 Ga0451807_0976509
1010 Ga0451807_2463887
1011 Ga0451851_0973768
1012 Ga0451855_0706880
1013 Ga0451853_1002462
1014 Ga0451853_2064316
1015 Ga0451853_3830933
1016 Ga0439448_0047876
1017 Ga0450898_005452
1018 Ga0450898_062440
1019 Ga0439459_0059427
1020 Ga0439460_0007876
1021 Ga0451577_0000210
1022 Ga0451577_0030002
1023 Ga0453684_0902460
1024 Ga0453684_2496754
1025 Ga0451576_0000741
1026 Ga0495603_0095784
1027 Ga0495590_0008779
1028 Ga0495629_0087873
1029 Ga0495638_0192712
1030 Ga0495638_0230521
1031 Ga0495651_0075629
1032 Ga0495653_0181464
1033 Ga0495580_0024838
1034 Ga0495582_0005514
1035 Ga0495639_0016200
1036 Ga0495662_0052388
1037 Ga0495664_0083745
1038 Ga0495584_0108022
1039 Ga0495585_0524790
1040 Ga0495583_0229809
1041 Ga0495608_0054037
1042 Ga0495610_0196589
1043 Ga0495616_0006494
1044 Ga0495616_0100606
1045 Ga0495628_0142359
1046 Ga0495628_1077631
1047 Ga0495630_0520532
1048 Ga0495632_0181361
1049 Ga0495652_0463616
1050 Ga0495654_0117315
1051 Ga0495665_0012732
1052 Ga0495665_0321378
1053 Ga0495586_0081286
1054 Ga0495621_0052186
1055 Ga0495645_0044382
1056 Ga0495633_0093207
1057 Ga0495667_0151109
1058 Ga0495668_0438023
1059 Ga0495668_0488391
1060 Ga0495634_0299776
1061 Ga0495634_0635465
1062 Ga0495625_0020303
1063 Ga0495625_0138933
1064 Ga0495625_0289967
1065 Ga0495635_0028671
1066 Ga0495635_0684962
1067 Ga0495588_0635487
1068 Ga0495657_0222398
1069 Ga0495647_0050239
1070 Ga0495658_0004803
1071 Ga0495669_0619178
1072 Ga0495613_0007458
1073 Ga0495649_0063250
1074 Ga0495649_0140027
1075 Ga0495600_0073547
1076 Ga0495600_0121769
1077 Ga0495581_0002892
1078 Ga0495674_0205458
1079 Ga0495672_0415005
1080 Ga0495680_0328117
1081 Ga0495675_0397083
1082 Ga0495677_0201442
1083 Ga0495673_0112797
1084 Ga0495684_0086399
1085 Ga0495684_0813217
1086 Ga0495686_0054615
1087 Ga0495686_0202197
1088 Ga0495593_0120323
1089 Ga0495614_0034982
1090 Ga0495626_0091370
1091 Ga0496100_0077634
1092 Ga0496101_0009169
1093 Ga0496102_0024884
1094 Ga0496104_0015885
1095 Ga0496104_0642852
1096 Ga0496105_0097194
1097 Ga0496106_0081553
1098 Ga0496106_0135606
1099 Ga0496108_0091599
1100 Ga0496108_0366367
1101 Ga0496109_0022741
1102 Ga0496110_1477400
1103 Ga0496111_0458832
1104 Ga0496112_0022409
1105 Ga0496112_1172567
1106 Ga0496114_0292872
1107 Ga0496114_0312953
1108 Ga0496115_0106529
1109 Ga0496115_0881200
1110 Ga0501038_0941681
1111 Ga0501040_1211462
1112 Ga0501042_0290769
1113 Ga0501042_0431693
1114 Ga0501069_0203588
1115 Ga0501070_0044881
1116 Ga0501070_0086478
1117 Ga0501074_0018349
1118 Ga0501074_0258508
1119 Ga0501080_0028144
1120 nmdc:mga03683_496039_c1
1121 nmdc:mga0k408_205408_c1
1122 nmdc:mga0k408_353455_c1
1123 nmdc:mga0k408_436542_c1
1124 nmdc:mga0n895_152982_c1
1125 nmdc:mga0rr50_34673_c1
1126 Ga0495601_0178356
1127 Ga0495601_0505756
1128 Ga0495612_0184342
1129 Ga0495655_0248040
1130 Ga0495595_0037169
1131 Ga0495619_0004860
1132 Ga0495619_0842350
1133 Ga0500644_0024450
1134 Ga0500611_001920
1135 Ga0500611_172857
1136 Ga0590071_033626
1137 Ga0590075_108650
1138 Ga0501082_0502504
1139 2894510842
1140 8001524072

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

40

105

0.94

PF00467

KOW

KOW motif

8

38

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9434 1 103
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9413 3 103
8cgk-assembly1.cif.gz_t lincomycin and avilamycin bound to the 50s subunit 0.9399 1 103
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9343 1 103
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9337 1 103
ID Description Score Start End Superfamily
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.893 1 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8905 1 101 2.30.30.30
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8695 1 100 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8649 4 101 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.86 4 100 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A2E2ZH91-F1-model_v4 Large ribosomal subunit protein uL24 0.934 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E0ICJ6-F1-model_v4 Large ribosomal subunit protein uL24 0.9333 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E2ZH91-F1-model_v4 Large ribosomal subunit protein uL24 0.9254 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E0ICJ6-F1-model_v4 Large ribosomal subunit protein uL24 0.9248 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-E0TJ37-F1-model_v4 Large ribosomal subunit protein uL24 0.9243 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map