F464839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 570 | 265 | 569 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300028577|Ga0265318_10014015|Ga0265318_100140153 |
| Length | 264 |
| Sequence | MSDSAASPPPGGSEHPTVEDATAKEVLGHGDLKPILPGPGGSDYERYLLTDELLQLQKTPEQMVHRDELLFQTVHQSSELWLKLAVFETDEAIARMAEDDLVLAVRLLGRAHHCVILVTDALHVLERLSPWEYHVVRTALGHGSGFDSPGWKELRRQAAPLWDAFTGVLARRDLVLSDAYVRERQHPSVYDLAEGLIELDERIAIWRSVHVKMVQRVIGGGAVGTQGTPVAVLAGMTTKELFPQLWAVRNRLTEIAAGPDAGPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 147 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 160 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 161 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 162 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 163 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 164 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 168 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 169 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 170 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 171 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 172 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 264 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.6 |
| Metatranscriptomes | 1.23 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 12.63 |
| Rhizosphere | 86.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10080291 | 3300003203 | Bacteria | 1002 |
| 2 | JGI25407J50210_10014442 | 3300003373 | Bacteria | 2034 |
| 3 | Ga0070658_10016451 | 3300005327 | Bacteria | 5920 |
| 4 | Ga0070658_10040928 | 3300005327 | Bacteria | 3738 |
| 5 | Ga0070658_10049017 | 3300005327 | Bacteria | 3421 |
| 6 | Ga0070658_10092206 | 3300005327 | Bacteria | 2498 |
| 7 | Ga0070658_10387276 | 3300005327 | Unclassified | 1200 |
| 8 | Ga0070683_100061095 | 3300005329 | Bacteria | 3503 |
| 9 | Ga0070683_100066728 | 3300005329 | Bacteria | 3352 |
| 10 | Ga0070683_100110188 | 3300005329 | Bacteria | 2597 |
| 11 | Ga0070683_100770465 | 3300005329 | Bacteria | 922 |
| 12 | Ga0070690_100085767 | 3300005330 | Bacteria | 2066 |
| 13 | Ga0070670_100025990 | 3300005331 | Bacteria | 5039 |
| 14 | Ga0070666_10177948 | 3300005335 | Bacteria | 1491 |
| 15 | Ga0070680_100003049 | 3300005336 | Bacteria | 12438 |
| 16 | Ga0070680_100010216 | 3300005336 | Bacteria | 7237 |
| 17 | Ga0070680_100033936 | 3300005336 | Bacteria | 4115 |
| 18 | Ga0070660_100001274 | 3300005339 | Bacteria | 17185 |
| 19 | Ga0070660_100006046 | 3300005339 | Bacteria | 8369 |
| 20 | Ga0070660_100008306 | 3300005339 | Bacteria | 7258 |
| 21 | Ga0070660_100080032 | 3300005339 | Bacteria | 2563 |
| 22 | Ga0070660_100271023 | 3300005339 | Bacteria | 1387 |
| 23 | Ga0070660_100288991 | 3300005339 | Bacteria | 1342 |
| 24 | Ga0070687_100059109 | 3300005343 | Bacteria | 2017 |
| 25 | Ga0070687_100143275 | 3300005343 | Unclassified | 1394 |
| 26 | Ga0070661_100471004 | 3300005344 | Bacteria | 1002 |
| 27 | Ga0070668_100404752 | 3300005347 | Bacteria | 1166 |
| 28 | Ga0070668_100662561 | 3300005347 | Bacteria | 918 |
| 29 | Ga0070669_100367634 | 3300005353 | Bacteria | 1171 |
| 30 | Ga0070671_100451631 | 3300005355 | Bacteria | 1103 |
| 31 | Ga0070674_100315940 | 3300005356 | Bacteria | 1251 |
| 32 | Ga0070673_100478308 | 3300005364 | Bacteria | 1124 |
| 33 | Ga0070688_100283294 | 3300005365 | Unclassified | 1192 |
| 34 | Ga0070688_100396806 | 3300005365 | Bacteria | 1020 |
| 35 | Ga0070659_100042532 | 3300005366 | Bacteria | 3552 |
| 36 | Ga0070659_100145899 | 3300005366 | Bacteria | 1928 |
| 37 | Ga0070659_100440456 | 3300005366 | Unclassified | 1104 |
| 38 | Ga0070714_100020134 | 3300005435 | Bacteria | 5445 |
| 39 | Ga0070714_100098418 | 3300005435 | Bacteria | 2573 |
| 40 | Ga0070714_100168048 | 3300005435 | Bacteria | 1989 |
| 41 | Ga0070713_100079436 | 3300005436 | Bacteria | 2794 |
| 42 | Ga0070710_10003636 | 3300005437 | Bacteria | 7298 |
| 43 | Ga0070710_10030562 | 3300005437 | Bacteria | 2899 |
| 44 | Ga0070711_100099829 | 3300005439 | Bacteria | 2110 |
| 45 | Ga0070705_100030507 | 3300005440 | Bacteria | 2977 |
| 46 | Ga0070700_100227345 | 3300005441 | Bacteria | 1326 |
| 47 | Ga0070678_100003977 | 3300005456 | Bacteria | 8312 |
| 48 | Ga0070678_100571544 | 3300005456 | Bacteria | 1006 |
| 49 | Ga0070681_10027877 | 3300005458 | Bacteria | 5678 |
| 50 | Ga0070681_10052265 | 3300005458 | Bacteria | 4075 |
| 51 | Ga0070681_10059704 | 3300005458 | Bacteria | 3793 |
| 52 | Ga0070681_10061412 | 3300005458 | Bacteria | 3732 |
| 53 | Ga0070681_10107228 | 3300005458 | Unclassified | 2734 |
| 54 | Ga0070681_10252219 | 3300005458 | Bacteria | 1677 |
| 55 | Ga0068867_100188937 | 3300005459 | Bacteria | 1642 |
| 56 | Ga0070707_100000564 | 3300005468 | Bacteria | 37210 |
| 57 | Ga0070707_100002679 | 3300005468 | Bacteria | 16930 |
| 58 | Ga0070707_100070572 | 3300005468 | Unclassified | 3365 |
| 59 | Ga0070707_100107049 | 3300005468 | Unclassified | 2712 |
| 60 | Ga0070707_100474983 | 3300005468 | Bacteria | 1212 |
| 61 | Ga0070698_100077255 | 3300005471 | Bacteria | 3330 |
| 62 | Ga0070698_100298506 | 3300005471 | Bacteria | 1542 |
| 63 | Ga0070698_100342691 | 3300005471 | Unclassified | 1426 |
| 64 | Ga0070699_100014051 | 3300005518 | Bacteria | 6888 |
| 65 | Ga0070699_100060390 | 3300005518 | Bacteria | 3285 |
| 66 | Ga0070679_100050939 | 3300005530 | Bacteria | 4124 |
| 67 | Ga0070679_100066780 | 3300005530 | Unclassified | 3586 |
| 68 | Ga0070679_100086395 | 3300005530 | Bacteria | 3123 |
| 69 | Ga0070679_100261540 | 3300005530 | Bacteria | 1686 |
| 70 | Ga0070684_100029809 | 3300005535 | Bacteria | 4628 |
| 71 | Ga0070684_100116170 | 3300005535 | Unclassified | 2403 |
| 72 | Ga0070684_100135651 | 3300005535 | Bacteria | 2223 |
| 73 | Ga0070684_100148894 | 3300005535 | Bacteria | 2120 |
| 74 | Ga0070697_100695291 | 3300005536 | Bacteria | 897 |
| 75 | Ga0070686_100018433 | 3300005544 | Bacteria | 4096 |
| 76 | Ga0070693_100052527 | 3300005547 | Bacteria | 2337 |
| 77 | Ga0068855_100039010 | 3300005563 | Bacteria | 5639 |
| 78 | Ga0068855_100098184 | 3300005563 | Bacteria | 3374 |
| 79 | Ga0068855_100133454 | 3300005563 | Bacteria | 2834 |
| 80 | Ga0068855_100477473 | 3300005563 | Unclassified | 1357 |
| 81 | Ga0070664_100133090 | 3300005564 | Bacteria | 2185 |
| 82 | Ga0070664_100224139 | 3300005564 | Bacteria | 1683 |
| 83 | Ga0068856_100035578 | 3300005614 | Bacteria | 4881 |
| 84 | Ga0068856_100157678 | 3300005614 | Bacteria | 2280 |
| 85 | Ga0070702_100001634 | 3300005615 | Bacteria | 9284 |
| 86 | Ga0070702_100269721 | 3300005615 | Bacteria | 1163 |
| 87 | Ga0068852_100161058 | 3300005616 | Bacteria | 2095 |
| 88 | Ga0068859_100357187 | 3300005617 | Bacteria | 1556 |
| 89 | Ga0068859_100628937 | 3300005617 | Unclassified | 1166 |
| 90 | Ga0068864_100344323 | 3300005618 | Bacteria | 1405 |
| 91 | Ga0068863_100559333 | 3300005841 | Bacteria | 1130 |
| 92 | Ga0068858_100145326 | 3300005842 | Bacteria | 2227 |
| 93 | Ga0068860_100066540 | 3300005843 | Bacteria | 3423 |
| 94 | Ga0068862_100389015 | 3300005844 | Unclassified | 1302 |
| 95 | Ga0081538_10012525 | 3300005981 | Bacteria | 6793 |
| 96 | Ga0081538_10032379 | 3300005981 | Bacteria | 3504 |
| 97 | Ga0081539_10007824 | 3300005985 | Bacteria | 9556 |
| 98 | Ga0070717_10028788 | 3300006028 | Bacteria | 4451 |
| 99 | Ga0070717_10052779 | 3300006028 | Archaea | 3350 |
| 100 | Ga0070717_10062457 | 3300006028 | Bacteria | 3088 |
| 101 | Ga0070717_10357924 | 3300006028 | Unclassified | 1306 |
| 102 | Ga0075364_10458396 | 3300006051 | Bacteria | 871 |
| 103 | Ga0070715_10001308 | 3300006163 | Bacteria | 7164 |
| 104 | Ga0070716_100076432 | 3300006173 | Bacteria | 1984 |
| 105 | Ga0070716_100321127 | 3300006173 | Bacteria | 1085 |
| 106 | Ga0070712_100016545 | 3300006175 | Bacteria | 4764 |
| 107 | Ga0070712_100160763 | 3300006175 | Bacteria | 1734 |
| 108 | Ga0075366_10013952 | 3300006195 | Bacteria | 4582 |
| 109 | Ga0097621_100012081 | 3300006237 | Bacteria | 6391 |
| 110 | Ga0097621_100804290 | 3300006237 | Bacteria | 871 |
| 111 | Ga0068871_100013798 | 3300006358 | Bacteria | 6006 |
| 112 | Ga0068871_100452888 | 3300006358 | Bacteria | 1151 |
| 113 | Ga0075428_100032148 | 3300006844 | Bacteria | 5796 |
| 114 | Ga0075428_100754063 | 3300006844 | Bacteria | 1036 |
| 115 | Ga0075431_100116771 | 3300006847 | Bacteria | 2754 |
| 116 | Ga0075433_10289865 | 3300006852 | Unclassified | 1450 |
| 117 | Ga0075433_10589192 | 3300006852 | Unclassified | 976 |
| 118 | Ga0075434_100045175 | 3300006871 | Bacteria | 4369 |
| 119 | Ga0075434_100348617 | 3300006871 | Bacteria | 1502 |
| 120 | Ga0068865_100033811 | 3300006881 | Bacteria | 3425 |
| 121 | Ga0097620_100357190 | 3300006931 | Bacteria | 1556 |
| 122 | Ga0097620_100628894 | 3300006931 | Unclassified | 1166 |
| 123 | Ga0105240_10022366 | 3300009093 | Bacteria | 8384 |
| 124 | Ga0105240_10171167 | 3300009093 | Bacteria | 2572 |
| 125 | Ga0105240_10308657 | 3300009093 | Bacteria | 1807 |
| 126 | Ga0105240_10309496 | 3300009093 | Unclassified | 1804 |
| 127 | Ga0111539_10385547 | 3300009094 | Bacteria | 1632 |
| 128 | Ga0105245_10233885 | 3300009098 | Unclassified | 1778 |
| 129 | Ga0105245_10291516 | 3300009098 | Bacteria | 1598 |
| 130 | Ga0105247_10034756 | 3300009101 | Bacteria | 3070 |
| 131 | Ga0114129_10023581 | 3300009147 | Bacteria | 8721 |
| 132 | Ga0114129_10117350 | 3300009147 | Bacteria | 3667 |
| 133 | Ga0114129_10326199 | 3300009147 | Bacteria | 2040 |
| 134 | Ga0114129_10742024 | 3300009147 | Bacteria | 1258 |
| 135 | Ga0114129_10841457 | 3300009147 | Bacteria | 1167 |
| 136 | Ga0105243_10417329 | 3300009148 | Bacteria | 1251 |
| 137 | Ga0105241_10056849 | 3300009174 | Bacteria | 3000 |
| 138 | Ga0105241_10325310 | 3300009174 | Bacteria | 1327 |
| 139 | Ga0105242_10017818 | 3300009176 | Bacteria | 5542 |
| 140 | Ga0105248_10038573 | 3300009177 | Bacteria | 5347 |
| 141 | Ga0105248_10328278 | 3300009177 | Bacteria | 1723 |
| 142 | Ga0105237_10106611 | 3300009545 | Unclassified | 2794 |
| 143 | Ga0105237_10772395 | 3300009545 | Bacteria | 968 |
| 144 | Ga0105239_10535184 | 3300010375 | Bacteria | 1334 |
| 145 | Ga0105239_10601533 | 3300010375 | Bacteria | 1254 |
| 146 | Ga0157373_10118462 | 3300013100 | Bacteria | 1861 |
| 147 | Ga0157371_10527720 | 3300013102 | Unclassified | 873 |
| 148 | Ga0157370_10031814 | 3300013104 | Bacteria | 5158 |
| 149 | Ga0157370_10037626 | 3300013104 | Bacteria | 4690 |
| 150 | Ga0157370_10138047 | 3300013104 | Bacteria | 2271 |
| 151 | Ga0157370_10491188 | 3300013104 | Unclassified | 1128 |
| 152 | Ga0157369_10011147 | 3300013105 | Bacteria | 10221 |
| 153 | Ga0157369_10128406 | 3300013105 | Bacteria | 2687 |
| 154 | Ga0157374_10349444 | 3300013296 | Unclassified | 1469 |
| 155 | Ga0157378_10015965 | 3300013297 | Bacteria | 6577 |
| 156 | Ga0157378_10564026 | 3300013297 | Bacteria | 1146 |
| 157 | Ga0163162_10097972 | 3300013306 | Unclassified | 3021 |
| 158 | Ga0163162_10113003 | 3300013306 | Bacteria | 2814 |
| 159 | Ga0163162_10153990 | 3300013306 | Bacteria | 2418 |
| 160 | Ga0157375_10011961 | 3300013308 | Bacteria | 7683 |
| 161 | Ga0163163_10362654 | 3300014325 | Bacteria | 1506 |
| 162 | Ga0157380_10190851 | 3300014326 | Bacteria | 1809 |
| 163 | Ga0182008_10004439 | 3300014497 | Bacteria | 8200 |
| 164 | Ga0157379_10011774 | 3300014968 | Bacteria | 7640 |
| 165 | Ga0157376_10003286 | 3300014969 | Bacteria | 11129 |
| 166 | Ga0157376_10061894 | 3300014969 | Bacteria | 3148 |
| 167 | Ga0182005_1079036 | 3300015265 | Bacteria | 907 |
| 168 | Ga0206356_11755113 | 3300020070 | Bacteria | 6781 |
| 169 | Ga0206356_11796933 | 3300020070 | Unclassified | 1957 |
| 170 | Ga0206354_10349833 | 3300020081 | Bacteria | 4251 |
| 171 | Ga0206354_10686985 | 3300020081 | Bacteria | 2086 |
| 172 | Ga0206353_10249266 | 3300020082 | Bacteria | 4521 |
| 173 | Ga0206353_10832986 | 3300020082 | Bacteria | 3642 |
| 174 | Ga0224712_10078784 | 3300022467 | Unclassified | 1355 |
| 175 | Ga0207692_10063150 | 3300025898 | Bacteria | 1924 |
| 176 | Ga0207642_10010306 | 3300025899 | Bacteria | 3290 |
| 177 | Ga0207685_10003356 | 3300025905 | Bacteria | 3883 |
| 178 | Ga0207685_10113254 | 3300025905 | Bacteria | 1179 |
| 179 | Ga0207699_10003512 | 3300025906 | Bacteria | 7483 |
| 180 | Ga0207699_10061930 | 3300025906 | Bacteria | 2253 |
| 181 | Ga0207705_10052409 | 3300025909 | Bacteria | 2937 |
| 182 | Ga0207705_10087639 | 3300025909 | Bacteria | 2276 |
| 183 | Ga0207705_10173174 | 3300025909 | Bacteria | 1626 |
| 184 | Ga0207705_10223807 | 3300025909 | Unclassified | 1430 |
| 185 | Ga0207705_10247077 | 3300025909 | Bacteria | 1360 |
| 186 | Ga0207684_10186259 | 3300025910 | Bacteria | 1790 |
| 187 | Ga0207654_10044404 | 3300025911 | Bacteria | 2524 |
| 188 | Ga0207707_10031560 | 3300025912 | Bacteria | 4636 |
| 189 | Ga0207707_10060192 | 3300025912 | Bacteria | 3304 |
| 190 | Ga0207707_10208524 | 3300025912 | Bacteria | 1703 |
| 191 | Ga0207707_10429256 | 3300025912 | Unclassified | 1132 |
| 192 | Ga0207695_10120043 | 3300025913 | Bacteria | 2598 |
| 193 | Ga0207695_10276980 | 3300025913 | Bacteria | 1572 |
| 194 | Ga0207695_10445533 | 3300025913 | Bacteria | 1178 |
| 195 | Ga0207695_10512087 | 3300025913 | Bacteria | 1082 |
| 196 | Ga0207693_10000818 | 3300025915 | Bacteria | 27776 |
| 197 | Ga0207693_10005938 | 3300025915 | Bacteria | 10132 |
| 198 | Ga0207693_10073224 | 3300025915 | Bacteria | 2682 |
| 199 | Ga0207660_10034649 | 3300025917 | Bacteria | 3500 |
| 200 | Ga0207660_10040722 | 3300025917 | Bacteria | 3253 |
| 201 | Ga0207660_10059546 | 3300025917 | Bacteria | 2742 |
| 202 | Ga0207660_10138327 | 3300025917 | Bacteria | 1860 |
| 203 | Ga0207657_10002391 | 3300025919 | Bacteria | 20291 |
| 204 | Ga0207657_10003035 | 3300025919 | Bacteria | 17975 |
| 205 | Ga0207657_10005937 | 3300025919 | Bacteria | 12708 |
| 206 | Ga0207657_10008522 | 3300025919 | Bacteria | 10397 |
| 207 | Ga0207657_10009267 | 3300025919 | Bacteria | 9917 |
| 208 | Ga0207657_10160303 | 3300025919 | Bacteria | 1827 |
| 209 | Ga0207649_10049597 | 3300025920 | Bacteria | 2593 |
| 210 | Ga0207649_10067779 | 3300025920 | Bacteria | 2267 |
| 211 | Ga0207652_10034039 | 3300025921 | Bacteria | 4292 |
| 212 | Ga0207652_10047859 | 3300025921 | Bacteria | 3653 |
| 213 | Ga0207652_10148766 | 3300025921 | Unclassified | 2096 |
| 214 | Ga0207652_10346927 | 3300025921 | Bacteria | 1340 |
| 215 | Ga0207646_10003389 | 3300025922 | Bacteria | 18004 |
| 216 | Ga0207646_10016098 | 3300025922 | Bacteria | 7027 |
| 217 | Ga0207646_10100926 | 3300025922 | Bacteria | 2587 |
| 218 | Ga0207646_10552323 | 3300025922 | Bacteria | 1035 |
| 219 | Ga0207646_10606091 | 3300025922 | Bacteria | 983 |
| 220 | Ga0207650_10540960 | 3300025925 | Bacteria | 976 |
| 221 | Ga0207659_10693638 | 3300025926 | Unclassified | 872 |
| 222 | Ga0207687_10044009 | 3300025927 | Bacteria | 3078 |
| 223 | Ga0207687_10107179 | 3300025927 | Bacteria | 2067 |
| 224 | Ga0207687_10382267 | 3300025927 | Bacteria | 1154 |
| 225 | Ga0207700_10000039 | 3300025928 | Bacteria | 102496 |
| 226 | Ga0207700_10014054 | 3300025928 | Bacteria | 5233 |
| 227 | Ga0207664_10009424 | 3300025929 | Bacteria | 6851 |
| 228 | Ga0207664_10012053 | 3300025929 | Bacteria | 6173 |
| 229 | Ga0207690_10077170 | 3300025932 | Bacteria | 2315 |
| 230 | Ga0207690_10172053 | 3300025932 | Unclassified | 1623 |
| 231 | Ga0207690_10199168 | 3300025932 | Bacteria | 1520 |
| 232 | Ga0207709_10122612 | 3300025935 | Bacteria | 1757 |
| 233 | Ga0207669_10079254 | 3300025937 | Bacteria | 2096 |
| 234 | Ga0207704_10231572 | 3300025938 | Bacteria | 1374 |
| 235 | Ga0207665_10002350 | 3300025939 | Bacteria | 12766 |
| 236 | Ga0207665_10016380 | 3300025939 | Bacteria | 4867 |
| 237 | Ga0207689_10116685 | 3300025942 | Bacteria | 2194 |
| 238 | Ga0207661_10024230 | 3300025944 | Bacteria | 4597 |
| 239 | Ga0207661_10031873 | 3300025944 | Bacteria | 4077 |
| 240 | Ga0207661_10111033 | 3300025944 | Bacteria | 2319 |
| 241 | Ga0207661_10151595 | 3300025944 | Unclassified | 2004 |
| 242 | Ga0207679_10175849 | 3300025945 | Bacteria | 1767 |
| 243 | Ga0207667_10248127 | 3300025949 | Bacteria | 1821 |
| 244 | Ga0207667_10386539 | 3300025949 | Unclassified | 1425 |
| 245 | Ga0207651_10100464 | 3300025960 | Unclassified | 2145 |
| 246 | Ga0207651_10148194 | 3300025960 | Bacteria | 1823 |
| 247 | Ga0207651_10611286 | 3300025960 | Unclassified | 954 |
| 248 | Ga0207712_10126173 | 3300025961 | Bacteria | 1943 |
| 249 | Ga0207703_10035591 | 3300026035 | Bacteria | 3956 |
| 250 | Ga0207639_10182759 | 3300026041 | Bacteria | 1785 |
| 251 | Ga0207639_10523223 | 3300026041 | Bacteria | 1086 |
| 252 | Ga0207678_10053357 | 3300026067 | Bacteria | 3483 |
| 253 | Ga0207708_10171275 | 3300026075 | Bacteria | 1719 |
| 254 | Ga0207702_10630616 | 3300026078 | Unclassified | 1053 |
| 255 | Ga0207641_10414430 | 3300026088 | Bacteria | 1296 |
| 256 | Ga0207675_100317315 | 3300026118 | Bacteria | 1521 |
| 257 | Ga0207683_10000244 | 3300026121 | Bacteria | 48306 |
| 258 | Ga0207683_10658497 | 3300026121 | Bacteria | 970 |
| 259 | Ga0207698_10503741 | 3300026142 | Bacteria | 1179 |
| 260 | Ga0268265_10885511 | 3300028380 | Bacteria | 876 |
| 261 | Ga0265319_1029278 | 3300028563 | Bacteria | 1934 |
| 262 | Ga0265318_10004002 | 3300028577 | Bacteria | 7243 |
| 263 | Ga0265318_10014015 | 3300028577 | Bacteria | 3370 |
| 264 | Ga0265322_10029714 | 3300028654 | Bacteria | 1561 |
| 265 | Ga0265330_10023818 | 3300031235 | Bacteria | 2779 |
| 266 | Ga0265320_10099911 | 3300031240 | Bacteria | 1337 |
| 267 | Ga0265329_10008096 | 3300031242 | Bacteria | 4016 |
| 268 | Ga0265340_10058722 | 3300031247 | Bacteria | 1847 |
| 269 | Ga0265327_10006570 | 3300031251 | Bacteria | 9246 |
| 270 | Ga0265327_10010040 | 3300031251 | Bacteria | 6724 |
| 271 | Ga0307408_100395621 | 3300031548 | Bacteria | 1185 |
| 272 | Ga0265314_10017125 | 3300031711 | Bacteria | 5697 |
| 273 | Ga0307409_100575043 | 3300031995 | Bacteria | 1110 |
| 274 | Ga0307416_100010707 | 3300032002 | Bacteria | 6077 |
| 275 | Ga0307416_100218606 | 3300032002 | Bacteria | 1825 |
| 276 | Ga0373926_0116084 | 3300035083 | Unclassified | 1007 |
| 277 | Ga0373934_0189240 | 3300035086 | Bacteria | 847 |
| 278 | Ga0373960_0038352 | 3300035121 | Bacteria | 1373 |
| 279 | Ga0373946_0025614 | 3300035171 | Bacteria | 2321 |
| 280 | Ga0373947_0096308 | 3300035725 | Bacteria | 1853 |
| 281 | Ga0373925_0231844 | 3300037068 | Bacteria | 1477 |
| 282 | Ga0373925_0310369 | 3300037068 | Bacteria | 1275 |
| 283 | Ga0373925_0609769 | 3300037068 | Bacteria | 899 |
| 284 | Ga0395899_0018252 | 3300037312 | Bacteria | 5336 |
| 285 | Ga0395899_0034937 | 3300037312 | Bacteria | 3774 |
| 286 | Ga0395899_0040228 | 3300037312 | Bacteria | 3497 |
| 287 | Ga0395899_0114785 | 3300037312 | Bacteria | 1934 |
| 288 | Ga0395899_0193100 | 3300037312 | Bacteria | 1424 |
| 289 | Ga0395899_0244667 | 3300037312 | Bacteria | 1233 |
| 290 | Ga0395900_0000528 | 3300037418 | Bacteria | 53945 |
| 291 | Ga0395900_0001894 | 3300037418 | Bacteria | 23794 |
| 292 | Ga0395900_0003881 | 3300037418 | Bacteria | 15977 |
| 293 | Ga0395900_0005059 | 3300037418 | Bacteria | 13833 |
| 294 | Ga0395900_0046097 | 3300037418 | Bacteria | 4489 |
| 295 | Ga0395900_0062611 | 3300037418 | Bacteria | 3824 |
| 296 | Ga0395900_0064367 | 3300037418 | Bacteria | 3768 |
| 297 | Ga0395900_0074470 | 3300037418 | Bacteria | 3490 |
| 298 | Ga0395900_0194234 | 3300037418 | Bacteria | 2057 |
| 299 | Ga0395900_0243910 | 3300037418 | Bacteria | 1801 |
| 300 | Ga0395900_0248295 | 3300037418 | Unclassified | 1782 |
| 301 | Ga0395900_0283704 | 3300037418 | Bacteria | 1647 |
| 302 | Ga0395900_0385815 | 3300037418 | Bacteria | 1368 |
| 303 | Ga0395898_0003441 | 3300037466 | Bacteria | 17697 |
| 304 | Ga0395898_0008250 | 3300037466 | Bacteria | 11015 |
| 305 | Ga0395898_0018085 | 3300037466 | Bacteria | 7191 |
| 306 | Ga0395898_0026566 | 3300037466 | Bacteria | 5822 |
| 307 | Ga0395898_0053098 | 3300037466 | Bacteria | 3958 |
| 308 | Ga0395898_0059067 | 3300037466 | Bacteria | 3732 |
| 309 | Ga0395898_0126222 | 3300037466 | Bacteria | 2451 |
| 310 | Ga0395898_0359725 | 3300037466 | Bacteria | 1388 |
| 311 | Ga0395898_0419399 | 3300037466 | Bacteria | 1275 |
| 312 | Ga0395898_0505407 | 3300037466 | Unclassified | 1149 |
| 313 | Ga0395898_0798967 | 3300037466 | Bacteria | 884 |
| 314 | Ga0395905_0000661 | 3300037471 | Bacteria | 45819 |
| 315 | Ga0395905_0004596 | 3300037471 | Bacteria | 14282 |
| 316 | Ga0395905_0008537 | 3300037471 | Bacteria | 10103 |
| 317 | Ga0395905_0018346 | 3300037471 | Bacteria | 6641 |
| 318 | Ga0395905_0022508 | 3300037471 | Bacteria | 5961 |
| 319 | Ga0395905_0052557 | 3300037471 | Unclassified | 3814 |
| 320 | Ga0395905_0085490 | 3300037471 | Bacteria | 2956 |
| 321 | Ga0395905_0094808 | 3300037471 | Bacteria | 2800 |
| 322 | Ga0395905_0386682 | 3300037471 | Bacteria | 1293 |
| 323 | Ga0395905_0512241 | 3300037471 | Unclassified | 1100 |
| 324 | Ga0395901_0001886 | 3300038443 | Bacteria | 21635 |
| 325 | Ga0395901_0004561 | 3300038443 | Bacteria | 13983 |
| 326 | Ga0395901_0008256 | 3300038443 | Bacteria | 10521 |
| 327 | Ga0395901_0012865 | 3300038443 | Bacteria | 8487 |
| 328 | Ga0395901_0042772 | 3300038443 | Bacteria | 4698 |
| 329 | Ga0395901_0050560 | 3300038443 | Bacteria | 4318 |
| 330 | Ga0395901_0080362 | 3300038443 | Bacteria | 3404 |
| 331 | Ga0395901_0082765 | 3300038443 | Bacteria | 3353 |
| 332 | Ga0395901_0143158 | 3300038443 | Unclassified | 2513 |
| 333 | Ga0395901_0194876 | 3300038443 | Bacteria | 2124 |
| 334 | Ga0395901_0254097 | 3300038443 | Bacteria | 1830 |
| 335 | Ga0395901_0712479 | 3300038443 | Unclassified | 1000 |
| 336 | Ga0395901_0955913 | 3300038443 | Unclassified | 835 |
| 337 | Ga0242420_022368 | 3300038996 | Bacteria | 1137 |
| 338 | Ga0439436_0054626 | 3300041404 | Bacteria | 1123 |
| 339 | Ga0439439_0002709 | 3300041406 | Bacteria | 3806 |
| 340 | Ga0451853_1011961 | 3300041512 | Bacteria | 1594 |
| 341 | Ga0451853_1203820 | 3300041512 | Unclassified | 1928 |
| 342 | Ga0451853_3483484 | 3300041512 | Bacteria | 1187 |
| 343 | Ga0439431_0034226 | 3300041997 | Bacteria | 1273 |
| 344 | Ga0439433_0005929 | 3300041999 | Bacteria | 2624 |
| 345 | Ga0439462_0026125 | 3300042015 | Bacteria | 1538 |
| 346 | Ga0439434_0025744 | 3300042435 | Bacteria | 1776 |
| 347 | Ga0466961_0007871 | 3300044693 | Bacteria | 6786 |
| 348 | Ga0466963_0000333 | 3300044694 | Bacteria | 21482 |
| 349 | Ga0466963_0002587 | 3300044694 | Bacteria | 10153 |
| 350 | Ga0466963_0008710 | 3300044694 | Bacteria | 6091 |
| 351 | Ga0466963_0057242 | 3300044694 | Bacteria | 2596 |
| 352 | Ga0466963_0064759 | 3300044694 | Bacteria | 2450 |
| 353 | Ga0466963_0103432 | 3300044694 | Bacteria | 1951 |
| 354 | Ga0466963_0155732 | 3300044694 | Bacteria | 1588 |
| 355 | Ga0466968_0012403 | 3300044735 | Bacteria | 3336 |
| 356 | Ga0466968_0021646 | 3300044735 | Bacteria | 2605 |
| 357 | Ga0466957_0028582 | 3300044842 | Bacteria | 3321 |
| 358 | Ga0466957_0096108 | 3300044842 | Unclassified | 1861 |
| 359 | Ga0466959_0002176 | 3300045049 | Bacteria | 12468 |
| 360 | Ga0466958_0003251 | 3300045836 | Bacteria | 8394 |
| 361 | Ga0466958_0036990 | 3300045836 | Bacteria | 2923 |
| 362 | Ga0466958_0209032 | 3300045836 | Bacteria | 1243 |
| 363 | Ga0466967_0000209 | 3300045976 | Bacteria | 24700 |
| 364 | Ga0466967_0002179 | 3300045976 | Bacteria | 12048 |
| 365 | Ga0466967_0020671 | 3300045976 | Bacteria | 5327 |
| 366 | Ga0466967_0035665 | 3300045976 | Bacteria | 4237 |
| 367 | Ga0466967_0061409 | 3300045976 | Bacteria | 3334 |
| 368 | Ga0466967_0077263 | 3300045976 | Bacteria | 2997 |
| 369 | Ga0466967_0080740 | 3300045976 | Bacteria | 2935 |
| 370 | Ga0466967_0139681 | 3300045976 | Bacteria | 2255 |
| 371 | Ga0466967_0252985 | 3300045976 | Archaea | 1683 |
| 372 | Ga0495592_0171637 | 3300046454 | Bacteria | 1485 |
| 373 | Ga0495603_0020627 | 3300046455 | Bacteria | 3993 |
| 374 | Ga0495603_0104418 | 3300046455 | Bacteria | 1654 |
| 375 | Ga0495629_0125227 | 3300046459 | Bacteria | 1790 |
| 376 | Ga0495651_0235837 | 3300046462 | Bacteria | 1257 |
| 377 | Ga0495651_0445049 | 3300046462 | Bacteria | 838 |
| 378 | Ga0495653_0087201 | 3300046463 | Bacteria | 2293 |
| 379 | Ga0495582_0068060 | 3300046473 | Bacteria | 1968 |
| 380 | Ga0495605_0018812 | 3300046474 | Bacteria | 3698 |
| 381 | Ga0495639_0306846 | 3300046475 | Bacteria | 792 |
| 382 | Ga0495662_0192159 | 3300046476 | Unclassified | 1006 |
| 383 | Ga0495585_0031145 | 3300046492 | Bacteria | 3031 |
| 384 | Ga0495596_0015174 | 3300046500 | Bacteria | 3233 |
| 385 | Ga0495596_0045663 | 3300046500 | Bacteria | 1722 |
| 386 | Ga0495596_0060863 | 3300046500 | Bacteria | 1471 |
| 387 | Ga0495608_0223809 | 3300046511 | Bacteria | 1179 |
| 388 | Ga0495630_0016469 | 3300046517 | Bacteria | 5403 |
| 389 | Ga0495663_0023754 | 3300046525 | Bacteria | 1778 |
| 390 | Ga0495652_0137166 | 3300046529 | Bacteria | 1929 |
| 391 | Ga0495640_0190851 | 3300046533 | Unclassified | 1302 |
| 392 | Ga0495609_0030436 | 3300046538 | Bacteria | 2457 |
| 393 | Ga0495609_0219508 | 3300046538 | Unclassified | 790 |
| 394 | Ga0495621_0178881 | 3300046539 | Bacteria | 846 |
| 395 | Ga0495645_0177638 | 3300046543 | Unclassified | 1461 |
| 396 | Ga0495667_0168655 | 3300046559 | Bacteria | 1407 |
| 397 | Ga0495656_0001601 | 3300046615 | Bacteria | 7407 |
| 398 | Ga0495634_0228376 | 3300046642 | Bacteria | 1146 |
| 399 | Ga0495634_0348923 | 3300046642 | Unclassified | 886 |
| 400 | Ga0495635_0043899 | 3300046663 | Bacteria | 3084 |
| 401 | Ga0495635_0064517 | 3300046663 | Bacteria | 2514 |
| 402 | Ga0495588_0240013 | 3300046674 | Bacteria | 956 |
| 403 | Ga0495588_0280075 | 3300046674 | Bacteria | 879 |
| 404 | Ga0495657_0181305 | 3300046675 | Bacteria | 1292 |
| 405 | Ga0495669_0047283 | 3300046684 | Bacteria | 1922 |
| 406 | Ga0495613_0012660 | 3300046689 | Bacteria | 6271 |
| 407 | Ga0495624_0055579 | 3300046690 | Bacteria | 2493 |
| 408 | Ga0495670_0091387 | 3300046691 | Bacteria | 1558 |
| 409 | Ga0495671_0124698 | 3300046692 | Bacteria | 1256 |
| 410 | Ga0495589_0042213 | 3300046794 | Bacteria | 2273 |
| 411 | Ga0495581_0000417 | 3300047315 | Bacteria | 21522 |
| 412 | Ga0495604_0211478 | 3300047317 | Bacteria | 1340 |
| 413 | Ga0495674_0076457 | 3300047319 | Bacteria | 2880 |
| 414 | Ga0495674_0188440 | 3300047319 | Bacteria | 1715 |
| 415 | Ga0495676_0106615 | 3300047321 | Bacteria | 2064 |
| 416 | Ga0495676_0246061 | 3300047321 | Bacteria | 1222 |
| 417 | Ga0495680_0052372 | 3300047322 | Bacteria | 3182 |
| 418 | Ga0495684_0075353 | 3300047471 | Bacteria | 2564 |
| 419 | Ga0495602_0086834 | 3300048088 | Bacteria | 2610 |
| 420 | Ga0496100_0006416 | 3300048903 | Bacteria | 6409 |
| 421 | Ga0496100_0125211 | 3300048903 | Bacteria | 1803 |
| 422 | Ga0496100_0207789 | 3300048903 | Bacteria | 1430 |
| 423 | Ga0496100_0301429 | 3300048903 | Bacteria | 1199 |
| 424 | Ga0496100_0494460 | 3300048903 | Bacteria | 942 |
| 425 | Ga0496101_0006449 | 3300048904 | Bacteria | 7549 |
| 426 | Ga0496101_0026024 | 3300048904 | Bacteria | 4065 |
| 427 | Ga0496101_0066778 | 3300048904 | Bacteria | 2624 |
| 428 | Ga0496102_0012569 | 3300048905 | Bacteria | 7333 |
| 429 | Ga0496102_0014475 | 3300048905 | Bacteria | 6853 |
| 430 | Ga0496102_0098304 | 3300048905 | Bacteria | 2716 |
| 431 | Ga0496102_0355678 | 3300048905 | Bacteria | 1379 |
| 432 | Ga0496102_0483468 | 3300048905 | Unclassified | 1160 |
| 433 | Ga0496103_0092677 | 3300048906 | Bacteria | 1907 |
| 434 | Ga0496103_0095035 | 3300048906 | Bacteria | 1883 |
| 435 | Ga0496103_0128488 | 3300048906 | Bacteria | 1617 |
| 436 | Ga0496104_0013441 | 3300048907 | Bacteria | 7377 |
| 437 | Ga0496104_0063124 | 3300048907 | Bacteria | 3512 |
| 438 | Ga0496104_0160823 | 3300048907 | Bacteria | 2154 |
| 439 | Ga0496104_0302157 | 3300048907 | Bacteria | 1512 |
| 440 | Ga0496105_0001228 | 3300048908 | Bacteria | 17859 |
| 441 | Ga0496105_0020008 | 3300048908 | Bacteria | 5402 |
| 442 | Ga0496105_0021241 | 3300048908 | Bacteria | 5253 |
| 443 | Ga0496105_0037431 | 3300048908 | Bacteria | 3994 |
| 444 | Ga0496105_0133054 | 3300048908 | Bacteria | 2049 |
| 445 | Ga0496105_0264549 | 3300048908 | Bacteria | 1390 |
| 446 | Ga0496105_0401365 | 3300048908 | Unclassified | 1088 |
| 447 | Ga0496106_0053154 | 3300048909 | Bacteria | 3058 |
| 448 | Ga0496106_0057478 | 3300048909 | Bacteria | 2941 |
| 449 | Ga0496106_0277978 | 3300048909 | Bacteria | 1341 |
| 450 | Ga0496106_0561736 | 3300048909 | Unclassified | 915 |
| 451 | Ga0496107_0005213 | 3300048910 | Bacteria | 8874 |
| 452 | Ga0496107_0007526 | 3300048910 | Bacteria | 7514 |
| 453 | Ga0496107_0048091 | 3300048910 | Bacteria | 3072 |
| 454 | Ga0496108_0041373 | 3300048911 | Bacteria | 3847 |
| 455 | Ga0496108_0051867 | 3300048911 | Bacteria | 3436 |
| 456 | Ga0496108_0052866 | 3300048911 | Bacteria | 3405 |
| 457 | Ga0496108_0094885 | 3300048911 | Bacteria | 2539 |
| 458 | Ga0496108_0502727 | 3300048911 | Bacteria | 1059 |
| 459 | Ga0496109_0000534 | 3300048912 | Bacteria | 32226 |
| 460 | Ga0496109_0003943 | 3300048912 | Bacteria | 12398 |
| 461 | Ga0496109_0013496 | 3300048912 | Bacteria | 7087 |
| 462 | Ga0496109_0022004 | 3300048912 | Bacteria | 5644 |
| 463 | Ga0496109_0202736 | 3300048912 | Bacteria | 1865 |
| 464 | Ga0496110_0021631 | 3300048913 | Bacteria | 5450 |
| 465 | Ga0496110_0086793 | 3300048913 | Bacteria | 2794 |
| 466 | Ga0496110_0135212 | 3300048913 | Bacteria | 2227 |
| 467 | Ga0496110_0678910 | 3300048913 | Unclassified | 931 |
| 468 | Ga0496111_0020430 | 3300048914 | Bacteria | 4611 |
| 469 | Ga0496111_0055348 | 3300048914 | Bacteria | 2869 |
| 470 | Ga0496111_0137555 | 3300048914 | Bacteria | 1810 |
| 471 | Ga0496111_0201919 | 3300048914 | Bacteria | 1478 |
| 472 | Ga0496112_0004991 | 3300048915 | Bacteria | 11379 |
| 473 | Ga0496112_0006947 | 3300048915 | Bacteria | 9990 |
| 474 | Ga0496112_0011718 | 3300048915 | Bacteria | 8025 |
| 475 | Ga0496112_0166925 | 3300048915 | Bacteria | 2167 |
| 476 | Ga0496112_0182768 | 3300048915 | Bacteria | 2060 |
| 477 | Ga0496112_0349903 | 3300048915 | Bacteria | 1420 |
| 478 | Ga0496112_0391520 | 3300048915 | Bacteria | 1330 |
| 479 | Ga0496113_0017584 | 3300048916 | Bacteria | 4967 |
| 480 | Ga0496113_0025415 | 3300048916 | Bacteria | 4221 |
| 481 | Ga0496113_0091217 | 3300048916 | Bacteria | 2348 |
| 482 | Ga0496113_0191674 | 3300048916 | Bacteria | 1622 |
| 483 | Ga0496113_0327918 | 3300048916 | Unclassified | 1227 |
| 484 | Ga0496114_0027171 | 3300048917 | Bacteria | 4686 |
| 485 | Ga0496114_0028430 | 3300048917 | Bacteria | 4588 |
| 486 | Ga0496114_0081947 | 3300048917 | Bacteria | 2726 |
| 487 | Ga0496114_0242153 | 3300048917 | Bacteria | 1586 |
| 488 | Ga0496115_0013003 | 3300048918 | Bacteria | 6282 |
| 489 | Ga0496115_0028747 | 3300048918 | Bacteria | 4359 |
| 490 | Ga0496115_0056781 | 3300048918 | Bacteria | 3147 |
| 491 | Ga0496115_0333232 | 3300048918 | Bacteria | 1239 |
| 492 | Ga0501031_0006591 | 3300049568 | Bacteria | 7575 |
| 493 | Ga0501031_0128229 | 3300049568 | Bacteria | 1657 |
| 494 | Ga0501032_0073018 | 3300049569 | Bacteria | 2286 |
| 495 | Ga0501033_0313953 | 3300049570 | Viruses | 1102 |
| 496 | Ga0501034_0023982 | 3300049571 | Bacteria | 6209 |
| 497 | Ga0501034_0089923 | 3300049571 | Bacteria | 3068 |
| 498 | Ga0501034_0260983 | 3300049571 | Bacteria | 1675 |
| 499 | Ga0501036_0021898 | 3300049572 | Bacteria | 5374 |
| 500 | Ga0501036_0045244 | 3300049572 | Bacteria | 3729 |
| 501 | Ga0501037_0095869 | 3300049573 | Bacteria | 2144 |
| 502 | Ga0501038_0009896 | 3300049574 | Bacteria | 8729 |
| 503 | Ga0501038_0589590 | 3300049574 | Bacteria | 842 |
| 504 | Ga0501039_0016892 | 3300049575 | Bacteria | 5594 |
| 505 | Ga0501040_0046624 | 3300049576 | Unclassified | 2958 |
| 506 | Ga0501041_0002462 | 3300049577 | Bacteria | 10520 |
| 507 | Ga0501041_0151173 | 3300049577 | Bacteria | 1450 |
| 508 | Ga0501042_0055196 | 3300049578 | Bacteria | 2834 |
| 509 | Ga0501042_0092381 | 3300049578 | Bacteria | 2173 |
| 510 | Ga0501042_0114286 | 3300049578 | Bacteria | 1944 |
| 511 | Ga0501046_0042882 | 3300049580 | Bacteria | 3605 |
| 512 | Ga0501046_0248059 | 3300049580 | Unclassified | 1311 |
| 513 | Ga0501048_0031141 | 3300049582 | Bacteria | 3859 |
| 514 | Ga0501048_0037765 | 3300049582 | Bacteria | 3468 |
| 515 | Ga0501068_0087383 | 3300049584 | Bacteria | 1920 |
| 516 | Ga0501068_0395273 | 3300049584 | Bacteria | 891 |
| 517 | Ga0501071_0004711 | 3300049587 | Bacteria | 8671 |
| 518 | Ga0501071_0013014 | 3300049587 | Bacteria | 5660 |
| 519 | Ga0501071_0127536 | 3300049587 | Bacteria | 1889 |
| 520 | Ga0501072_0013904 | 3300049588 | Bacteria | 6168 |
| 521 | Ga0501072_0041617 | 3300049588 | Bacteria | 3609 |
| 522 | Ga0501072_0266360 | 3300049588 | Viruses | 1363 |
| 523 | Ga0501073_0042648 | 3300049589 | Archaea | 3201 |
| 524 | Ga0501074_0051737 | 3300049590 | Bacteria | 2964 |
| 525 | Ga0501074_0075866 | 3300049590 | Bacteria | 2414 |
| 526 | Ga0501074_0330554 | 3300049590 | Bacteria | 1082 |
| 527 | Ga0501074_0585778 | 3300049590 | Bacteria | 789 |
| 528 | Ga0501075_0028504 | 3300049591 | Bacteria | 4121 |
| 529 | Ga0501076_0000793 | 3300049592 | Bacteria | 20434 |
| 530 | Ga0501076_0026358 | 3300049592 | Bacteria | 4501 |
| 531 | Ga0501076_0037684 | 3300049592 | Bacteria | 3793 |
| 532 | Ga0501079_0044859 | 3300049741 | Bacteria | 3412 |
| 533 | Ga0501079_0278036 | 3300049741 | Bacteria | 1309 |
| 534 | Ga0501079_0305774 | 3300049741 | Bacteria | 1244 |
| 535 | Ga0501079_0402062 | 3300049741 | Bacteria | 1074 |
| 536 | Ga0501080_0001169 | 3300049742 | Bacteria | 21714 |
| 537 | Ga0501081_0013023 | 3300049743 | Bacteria | 5471 |
| 538 | Ga0501081_0224379 | 3300049743 | Bacteria | 1367 |
| 539 | Ga0501081_0496367 | 3300049743 | Bacteria | 909 |
| 540 | Ga0501083_0070010 | 3300049744 | Bacteria | 2334 |
| 541 | Ga0501035_0158939 | 3300049822 | Bacteria | 1957 |
| 542 | Ga0501035_0416547 | 3300049822 | Bacteria | 1116 |
| 543 | Ga0501045_0003580 | 3300049824 | Bacteria | 10667 |
| 544 | Ga0501045_0062972 | 3300049824 | Bacteria | 2722 |
| 545 | nmdc:mga05p37_10418_c1 | 3300050507 | Bacteria | 11033 |
| 546 | nmdc:mga05p37_119103_c1 | 3300050507 | Bacteria | 3244 |
| 547 | nmdc:mga05p37_476754_c1 | 3300050507 | Bacteria | 1438 |
| 548 | nmdc:mga09592_286904_c1 | 3300050508 | Bacteria | 1427 |
| 549 | nmdc:mga06r32_191220_c1 | 3300050510 | Bacteria | 2034 |
| 550 | nmdc:mga08y16_158686_c1 | 3300050511 | Bacteria | 2350 |
| 551 | nmdc:mga0a205_289376_c1 | 3300050515 | Unclassified | 1513 |
| 552 | nmdc:mga0a205_342200_c1 | 3300050515 | Bacteria | 1364 |
| 553 | Ga0495601_0473464 | 3300053077 | Bacteria | 809 |
| 554 | Ga0495612_0044617 | 3300053078 | Bacteria | 1814 |
| 555 | Ga0495655_0022791 | 3300053083 | Bacteria | 1436 |
| 556 | Ga0495595_0174439 | 3300053084 | Unclassified | 1065 |
| 557 | Ga0495595_0175245 | 3300053084 | Bacteria | 1063 |
| 558 | Ga0495619_0070196 | 3300053085 | Bacteria | 2342 |
| 559 | Ga0501084_0027162 | 3300054114 | Bacteria | 4783 |
| 560 | Ga0501084_0056772 | 3300054114 | Bacteria | 3275 |
| 561 | Ga0501084_0100223 | 3300054114 | Bacteria | 2432 |
| 562 | Ga0501084_0431420 | 3300054114 | Bacteria | 1114 |
| 563 | Ga0590075_001865 | 3300059424 | Bacteria | 5123 |
| 564 | Ga0501082_0012157 | 3300060353 | Bacteria | 7396 |
| 565 | Ga0501082_0740557 | 3300060353 | Bacteria | 860 |
| 566 | Ga0530510_0025275 | 3300061734 | Bacteria | 4245 |
| 567 | Ga0530510_0114957 | 3300061734 | Bacteria | 1972 |
| 568 | Ga0530510_0198736 | 3300061734 | Bacteria | 1489 |
| 569 | Ga0530510_0227817 | 3300061734 | Bacteria | 1386 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041404 | Ga0439436_0054626 | Ga0439436_0054626_17_616 | 197 |
| 2 | 3300046538 | Ga0495609_0219508 | Ga0495609_0219508_27_626 | 198 |
| 3 | 3300031548 | Ga0307408_100395621 | Ga0307408_1003956212 | 204 |
| 4 | 3300032002 | Ga0307416_100010707 | Ga0307416_1000107072 | 204 |
| 5 | 3300038443 | Ga0395901_0955913 | Ga0395901_0955913_157_816 | 208 |
| 6 | 3300037418 | Ga0395900_0001894 | Ga0395900_0001894_8578_9312 | 209 |
| 7 | 3300037466 | Ga0395898_0003441 | Ga0395898_0003441_12974_13708 | 209 |
| 8 | 3300037471 | Ga0395905_0094808 | Ga0395905_0094808_1344_2078 | 209 |
| 9 | 3300006847 | Ga0075431_100116771 | Ga0075431_1001167713 | 216 |
| 10 | 3300050510 | nmdc:mga06r32_191220_c1 | nmdc:mga06r32_191220_c1_482_1198 | 216 |
| 11 | 3300005435 | Ga0070714_100168048 | Ga0070714_1001680482 | 220 |
| 12 | 3300006028 | Ga0070717_10028788 | Ga0070717_100287883 | 220 |
| 13 | 3300025929 | Ga0207664_10012053 | Ga0207664_100120533 | 220 |
| 14 | 3300006237 | Ga0097621_100804290 | Ga0097621_1008042901 | 223 |
| 15 | 3300009177 | Ga0105248_10038573 | Ga0105248_100385733 | 223 |
| 16 | iso_pu_bacteria | 2870782633 | 2870787652 | 227 |
| 17 | 3300005330 | Ga0070690_100085767 | Ga0070690_1000857672 | 228 |
| 18 | 3300005844 | Ga0068862_100389015 | Ga0068862_1003890151 | 228 |
| 19 | 3300013306 | Ga0163162_10097972 | Ga0163162_100979725 | 228 |
| 20 | 3300047471 | Ga0495684_0075353 | Ga0495684_0075353_1331_2023 | 228 |
| 21 | 3300049571 | Ga0501034_0089923 | Ga0501034_0089923_323_1021 | 228 |
| 22 | 3300005331 | Ga0070670_100025990 | Ga0070670_1000259902 | 229 |
| 23 | 3300005365 | Ga0070688_100283294 | Ga0070688_1002832942 | 229 |
| 24 | 3300005518 | Ga0070699_100060390 | Ga0070699_1000603903 | 229 |
| 25 | 3300005617 | Ga0068859_100357187 | Ga0068859_1003571872 | 229 |
| 26 | 3300005617 | Ga0068859_100628937 | Ga0068859_1006289372 | 229 |
| 27 | 3300005618 | Ga0068864_100344323 | Ga0068864_1003443232 | 229 |
| 28 | 3300005981 | Ga0081538_10032379 | Ga0081538_100323794 | 229 |
| 29 | 3300006931 | Ga0097620_100357190 | Ga0097620_1003571902 | 229 |
| 30 | 3300006931 | Ga0097620_100628894 | Ga0097620_1006288941 | 229 |
| 31 | 3300013306 | Ga0163162_10153990 | Ga0163162_101539903 | 229 |
| 32 | 3300025925 | Ga0207650_10540960 | Ga0207650_105409601 | 229 |
| 33 | 3300025926 | Ga0207659_10693638 | Ga0207659_106936382 | 229 |
| 34 | 3300025960 | Ga0207651_10611286 | Ga0207651_106112862 | 229 |
| 35 | 3300025961 | Ga0207712_10126173 | Ga0207712_101261733 | 229 |
| 36 | 3300026118 | Ga0207675_100317315 | Ga0207675_1003173152 | 229 |
| 37 | 3300028380 | Ga0268265_10885511 | Ga0268265_108855111 | 229 |
| 38 | 3300031995 | Ga0307409_100575043 | Ga0307409_1005750432 | 229 |
| 39 | 3300035083 | Ga0373926_0116084 | Ga0373926_0116084_233_958 | 229 |
| 40 | 3300037068 | Ga0373925_0310369 | Ga0373925_0310369_288_1010 | 229 |
| 41 | 3300046462 | Ga0495651_0445049 | Ga0495651_0445049_38_760 | 229 |
| 42 | 3300049578 | Ga0501042_0092381 | Ga0501042_0092381_383_1075 | 229 |
| 43 | 3300049588 | Ga0501072_0013904 | Ga0501072_0013904_99_791 | 229 |
| 44 | 3300049590 | Ga0501074_0330554 | Ga0501074_0330554_132_824 | 229 |
| 45 | 3300049592 | Ga0501076_0037684 | Ga0501076_0037684_643_1335 | 229 |
| 46 | 3300049741 | Ga0501079_0305774 | Ga0501079_0305774_477_1169 | 229 |
| 47 | 3300050511 | nmdc:mga08y16_158686_c1 | nmdc:mga08y16_158686_c1_1334_2032 | 229 |
| 48 | 3300060353 | Ga0501082_0740557 | Ga0501082_0740557_122_814 | 229 |
| 49 | 3300003373 | JGI25407J50210_10014442 | JGI25407J50210_100144422 | 230 |
| 50 | 3300005327 | Ga0070658_10092206 | Ga0070658_100922063 | 230 |
| 51 | 3300005329 | Ga0070683_100110188 | Ga0070683_1001101882 | 230 |
| 52 | 3300005336 | Ga0070680_100010216 | Ga0070680_1000102166 | 230 |
| 53 | 3300005339 | Ga0070660_100001274 | Ga0070660_10000127411 | 230 |
| 54 | 3300005355 | Ga0070671_100451631 | Ga0070671_1004516312 | 230 |
| 55 | 3300005366 | Ga0070659_100440456 | Ga0070659_1004404562 | 230 |
| 56 | 3300005458 | Ga0070681_10027877 | Ga0070681_100278775 | 230 |
| 57 | 3300005458 | Ga0070681_10059704 | Ga0070681_100597042 | 230 |
| 58 | 3300005530 | Ga0070679_100086395 | Ga0070679_1000863952 | 230 |
| 59 | 3300005535 | Ga0070684_100029809 | Ga0070684_1000298095 | 230 |
| 60 | 3300005563 | Ga0068855_100098184 | Ga0068855_1000981844 | 230 |
| 61 | 3300005564 | Ga0070664_100224139 | Ga0070664_1002241392 | 230 |
| 62 | 3300005981 | Ga0081538_10012525 | Ga0081538_100125252 | 230 |
| 63 | 3300009093 | Ga0105240_10171167 | Ga0105240_101711672 | 230 |
| 64 | 3300009174 | Ga0105241_10325310 | Ga0105241_103253102 | 230 |
| 65 | 3300013104 | Ga0157370_10031814 | Ga0157370_100318143 | 230 |
| 66 | 3300013104 | Ga0157370_10491188 | Ga0157370_104911882 | 230 |
| 67 | 3300020070 | Ga0206356_11796933 | Ga0206356_117969332 | 230 |
| 68 | 3300020082 | Ga0206353_10832986 | Ga0206353_108329863 | 230 |
| 69 | 3300025909 | Ga0207705_10087639 | Ga0207705_100876392 | 230 |
| 70 | 3300025909 | Ga0207705_10223807 | Ga0207705_102238072 | 230 |
| 71 | 3300025913 | Ga0207695_10120043 | Ga0207695_101200432 | 230 |
| 72 | 3300025917 | Ga0207660_10059546 | Ga0207660_100595462 | 230 |
| 73 | 3300025917 | Ga0207660_10138327 | Ga0207660_101383272 | 230 |
| 74 | 3300025919 | Ga0207657_10005937 | Ga0207657_1000593711 | 230 |
| 75 | 3300025919 | Ga0207657_10009267 | Ga0207657_100092677 | 230 |
| 76 | 3300025919 | Ga0207657_10160303 | Ga0207657_101603033 | 230 |
| 77 | 3300025920 | Ga0207649_10067779 | Ga0207649_100677792 | 230 |
| 78 | 3300025921 | Ga0207652_10148766 | Ga0207652_101487662 | 230 |
| 79 | 3300025932 | Ga0207690_10077170 | Ga0207690_100771703 | 230 |
| 80 | 3300025935 | Ga0207709_10122612 | Ga0207709_101226122 | 230 |
| 81 | 3300025944 | Ga0207661_10111033 | Ga0207661_101110332 | 230 |
| 82 | 3300025945 | Ga0207679_10175849 | Ga0207679_101758492 | 230 |
| 83 | 3300041512 | Ga0451853_1203820 | Ga0451853_1203820_560_1258 | 230 |
| 84 | 3300046455 | Ga0495603_0104418 | Ga0495603_0104418_544_1242 | 230 |
| 85 | 3300048903 | Ga0496100_0301429 | Ga0496100_0301429_170_868 | 230 |
| 86 | 3300048906 | Ga0496103_0092677 | Ga0496103_0092677_109_807 | 230 |
| 87 | 3300048908 | Ga0496105_0264549 | Ga0496105_0264549_550_1248 | 230 |
| 88 | 3300048914 | Ga0496111_0137555 | Ga0496111_0137555_258_956 | 230 |
| 89 | 3300048915 | Ga0496112_0004991 | Ga0496112_0004991_7822_8520 | 230 |
| 90 | 3300048915 | Ga0496112_0391520 | Ga0496112_0391520_156_854 | 230 |
| 91 | 3300048916 | Ga0496113_0091217 | Ga0496113_0091217_64_762 | 230 |
| 92 | 3300048917 | Ga0496114_0242153 | Ga0496114_0242153_559_1257 | 230 |
| 93 | 3300049571 | Ga0501034_0260983 | Ga0501034_0260983_886_1605 | 230 |
| 94 | 3300006195 | Ga0075366_10013952 | Ga0075366_100139523 | 231 |
| 95 | 3300037471 | Ga0395905_0052557 | Ga0395905_0052557_1425_2126 | 231 |
| 96 | 3300038443 | Ga0395901_0004561 | Ga0395901_0004561_13249_13956 | 231 |
| 97 | 3300049568 | Ga0501031_0128229 | Ga0501031_0128229_68_802 | 231 |
| 98 | 3300049570 | Ga0501033_0313953 | Ga0501033_0313953_136_870 | 231 |
| 99 | 3300049572 | Ga0501036_0045244 | Ga0501036_0045244_736_1470 | 231 |
| 100 | 3300049576 | Ga0501040_0046624 | Ga0501040_0046624_1610_2344 | 231 |
| 101 | 3300049580 | Ga0501046_0248059 | Ga0501046_0248059_31_765 | 231 |
| 102 | 3300049582 | Ga0501048_0037765 | Ga0501048_0037765_2648_3382 | 231 |
| 103 | 3300049587 | Ga0501071_0013014 | Ga0501071_0013014_2624_3358 | 231 |
| 104 | 3300049588 | Ga0501072_0266360 | Ga0501072_0266360_281_1015 | 231 |
| 105 | 3300049591 | Ga0501075_0028504 | Ga0501075_0028504_1420_2154 | 231 |
| 106 | 3300049592 | Ga0501076_0026358 | Ga0501076_0026358_1704_2438 | 231 |
| 107 | 3300049741 | Ga0501079_0044859 | Ga0501079_0044859_941_1675 | 231 |
| 108 | 3300049824 | Ga0501045_0003580 | Ga0501045_0003580_8146_8880 | 231 |
| 109 | 3300060353 | Ga0501082_0012157 | Ga0501082_0012157_62_796 | 231 |
| 110 | 3300061734 | Ga0530510_0114957 | Ga0530510_0114957_1166_1900 | 231 |
| 111 | 3300005327 | Ga0070658_10040928 | Ga0070658_100409283 | 232 |
| 112 | 3300005339 | Ga0070660_100008306 | Ga0070660_1000083063 | 232 |
| 113 | 3300005344 | Ga0070661_100471004 | Ga0070661_1004710041 | 232 |
| 114 | 3300005458 | Ga0070681_10052265 | Ga0070681_100522653 | 232 |
| 115 | 3300005563 | Ga0068855_100133454 | Ga0068855_1001334543 | 232 |
| 116 | 3300005616 | Ga0068852_100161058 | Ga0068852_1001610582 | 232 |
| 117 | 3300009093 | Ga0105240_10022366 | Ga0105240_1002236610 | 232 |
| 118 | 3300009147 | Ga0114129_10841457 | Ga0114129_108414572 | 232 |
| 119 | 3300013104 | Ga0157370_10037626 | Ga0157370_100376262 | 232 |
| 120 | 3300013104 | Ga0157370_10138047 | Ga0157370_101380472 | 232 |
| 121 | 3300020070 | Ga0206356_11755113 | Ga0206356_117551136 | 232 |
| 122 | 3300020081 | Ga0206354_10349833 | Ga0206354_103498333 | 232 |
| 123 | 3300025912 | Ga0207707_10060192 | Ga0207707_100601923 | 232 |
| 124 | 3300025913 | Ga0207695_10276980 | Ga0207695_102769801 | 232 |
| 125 | 3300025919 | Ga0207657_10002391 | Ga0207657_100023912 | 232 |
| 126 | 3300025949 | Ga0207667_10248127 | Ga0207667_102481272 | 232 |
| 127 | 3300049578 | Ga0501042_0114286 | Ga0501042_0114286_887_1594 | 232 |
| 128 | 3300049587 | Ga0501071_0127536 | Ga0501071_0127536_492_1199 | 232 |
| 129 | 3300049743 | Ga0501081_0496367 | Ga0501081_0496367_34_741 | 232 |
| 130 | 3300049822 | Ga0501035_0416547 | Ga0501035_0416547_14_721 | 232 |
| 131 | 3300054114 | Ga0501084_0100223 | Ga0501084_0100223_1148_1855 | 232 |
| 132 | 3300061734 | Ga0530510_0198736 | Ga0530510_0198736_171_878 | 232 |
| 133 | 3300005335 | Ga0070666_10177948 | Ga0070666_101779482 | 233 |
| 134 | 3300005356 | Ga0070674_100315940 | Ga0070674_1003159402 | 233 |
| 135 | 3300005364 | Ga0070673_100478308 | Ga0070673_1004783081 | 233 |
| 136 | 3300005440 | Ga0070705_100030507 | Ga0070705_1000305072 | 233 |
| 137 | 3300005456 | Ga0070678_100003977 | Ga0070678_1000039778 | 233 |
| 138 | 3300005459 | Ga0068867_100188937 | Ga0068867_1001889372 | 233 |
| 139 | 3300005471 | Ga0070698_100298506 | Ga0070698_1002985062 | 233 |
| 140 | 3300005544 | Ga0070686_100018433 | Ga0070686_1000184333 | 233 |
| 141 | 3300005547 | Ga0070693_100052527 | Ga0070693_1000525272 | 233 |
| 142 | 3300005615 | Ga0070702_100001634 | Ga0070702_1000016343 | 233 |
| 143 | 3300005842 | Ga0068858_100145326 | Ga0068858_1001453262 | 233 |
| 144 | 3300005843 | Ga0068860_100066540 | Ga0068860_1000665402 | 233 |
| 145 | 3300006173 | Ga0070716_100321127 | Ga0070716_1003211272 | 233 |
| 146 | 3300006237 | Ga0097621_100012081 | Ga0097621_1000120815 | 233 |
| 147 | 3300006358 | Ga0068871_100013798 | Ga0068871_1000137983 | 233 |
| 148 | 3300006881 | Ga0068865_100033811 | Ga0068865_1000338114 | 233 |
| 149 | 3300009093 | Ga0105240_10308657 | Ga0105240_103086572 | 233 |
| 150 | 3300009101 | Ga0105247_10034756 | Ga0105247_100347563 | 233 |
| 151 | 3300009176 | Ga0105242_10017818 | Ga0105242_100178182 | 233 |
| 152 | 3300009177 | Ga0105248_10328278 | Ga0105248_103282782 | 233 |
| 153 | 3300013102 | Ga0157371_10527720 | Ga0157371_105277201 | 233 |
| 154 | 3300013297 | Ga0157378_10015965 | Ga0157378_100159653 | 233 |
| 155 | 3300014968 | Ga0157379_10011774 | Ga0157379_100117747 | 233 |
| 156 | 3300014969 | Ga0157376_10003286 | Ga0157376_100032869 | 233 |
| 157 | 3300025899 | Ga0207642_10010306 | Ga0207642_100103064 | 233 |
| 158 | 3300025911 | Ga0207654_10044404 | Ga0207654_100444042 | 233 |
| 159 | 3300025913 | Ga0207695_10512087 | Ga0207695_105120872 | 233 |
| 160 | 3300025927 | Ga0207687_10382267 | Ga0207687_103822672 | 233 |
| 161 | 3300025928 | Ga0207700_10014054 | Ga0207700_100140545 | 233 |
| 162 | 3300025929 | Ga0207664_10009424 | Ga0207664_100094245 | 233 |
| 163 | 3300025937 | Ga0207669_10079254 | Ga0207669_100792543 | 233 |
| 164 | 3300025938 | Ga0207704_10231572 | Ga0207704_102315722 | 233 |
| 165 | 3300025960 | Ga0207651_10148194 | Ga0207651_101481942 | 233 |
| 166 | 3300026035 | Ga0207703_10035591 | Ga0207703_100355912 | 233 |
| 167 | 3300026067 | Ga0207678_10053357 | Ga0207678_100533572 | 233 |
| 168 | 3300026121 | Ga0207683_10000244 | Ga0207683_1000024437 | 233 |
| 169 | 3300046543 | Ga0495645_0177638 | Ga0495645_0177638_392_1099 | 233 |
| 170 | 3300046663 | Ga0495635_0064517 | Ga0495635_0064517_255_962 | 233 |
| 171 | 3300047319 | Ga0495674_0188440 | Ga0495674_0188440_849_1556 | 233 |
| 172 | 3300048088 | Ga0495602_0086834 | Ga0495602_0086834_1585_2292 | 233 |
| 173 | 3300048903 | Ga0496100_0006416 | Ga0496100_0006416_4861_5613 | 233 |
| 174 | 3300048904 | Ga0496101_0006449 | Ga0496101_0006449_5026_5778 | 233 |
| 175 | 3300048905 | Ga0496102_0012569 | Ga0496102_0012569_2245_2997 | 233 |
| 176 | 3300048906 | Ga0496103_0095035 | Ga0496103_0095035_997_1749 | 233 |
| 177 | 3300048907 | Ga0496104_0013441 | Ga0496104_0013441_1672_2424 | 233 |
| 178 | 3300048908 | Ga0496105_0020008 | Ga0496105_0020008_432_1184 | 233 |
| 179 | 3300048909 | Ga0496106_0057478 | Ga0496106_0057478_1886_2638 | 233 |
| 180 | 3300048910 | Ga0496107_0007526 | Ga0496107_0007526_2210_2962 | 233 |
| 181 | 3300048910 | Ga0496107_0048091 | Ga0496107_0048091_551_1264 | 233 |
| 182 | 3300048917 | Ga0496114_0027171 | Ga0496114_0027171_2878_3630 | 233 |
| 183 | 3300048918 | Ga0496115_0056781 | Ga0496115_0056781_2279_3031 | 233 |
| 184 | 3300049571 | Ga0501034_0023982 | Ga0501034_0023982_5064_5765 | 233 |
| 185 | 3300049589 | Ga0501073_0042648 | Ga0501073_0042648_514_1215 | 233 |
| 186 | 3300049590 | Ga0501074_0075866 | Ga0501074_0075866_561_1262 | 233 |
| 187 | 3300049741 | Ga0501079_0278036 | Ga0501079_0278036_441_1142 | 233 |
| 188 | 3300049742 | Ga0501080_0001169 | Ga0501080_0001169_15278_15979 | 233 |
| 189 | 3300053078 | Ga0495612_0044617 | Ga0495612_0044617_160_867 | 233 |
| 190 | 3300053084 | Ga0495595_0174439 | Ga0495595_0174439_10_717 | 233 |
| 191 | 3300009174 | Ga0105241_10056849 | Ga0105241_100568492 | 234 |
| 192 | 3300031251 | Ga0265327_10010040 | Ga0265327_100100406 | 234 |
| 193 | 3300046455 | Ga0495603_0020627 | Ga0495603_0020627_3115_3882 | 234 |
| 194 | 3300046674 | Ga0495588_0280075 | Ga0495588_0280075_46_825 | 234 |
| 195 | 3300005347 | Ga0070668_100662561 | Ga0070668_1006625611 | 235 |
| 196 | 3300005536 | Ga0070697_100695291 | Ga0070697_1006952911 | 235 |
| 197 | 3300006844 | Ga0075428_100754063 | Ga0075428_1007540632 | 235 |
| 198 | 3300013105 | Ga0157369_10011147 | Ga0157369_100111476 | 235 |
| 199 | 3300014326 | Ga0157380_10190851 | Ga0157380_101908512 | 235 |
| 200 | 3300020081 | Ga0206354_10686985 | Ga0206354_106869853 | 235 |
| 201 | 3300037068 | Ga0373925_0609769 | Ga0373925_0609769_31_744 | 235 |
| 202 | 3300037312 | Ga0395899_0114785 | Ga0395899_0114785_910_1617 | 235 |
| 203 | 3300041406 | Ga0439439_0002709 | Ga0439439_0002709_2400_3116 | 235 |
| 204 | 3300041997 | Ga0439431_0034226 | Ga0439431_0034226_438_1154 | 235 |
| 205 | 3300041999 | Ga0439433_0005929 | Ga0439433_0005929_141_857 | 235 |
| 206 | 3300042015 | Ga0439462_0026125 | Ga0439462_0026125_662_1378 | 235 |
| 207 | 3300042435 | Ga0439434_0025744 | Ga0439434_0025744_961_1677 | 235 |
| 208 | 3300049741 | Ga0501079_0402062 | Ga0501079_0402062_26_739 | 235 |
| 209 | 3300054114 | Ga0501084_0431420 | Ga0501084_0431420_311_1024 | 235 |
| 210 | 3300059424 | Ga0590075_001865 | Ga0590075_001865_2904_3611 | 235 |
| 211 | 3300061734 | Ga0530510_0227817 | Ga0530510_0227817_546_1259 | 235 |
| 212 | 3300005327 | Ga0070658_10016451 | Ga0070658_100164512 | 236 |
| 213 | 3300005327 | Ga0070658_10049017 | Ga0070658_100490173 | 236 |
| 214 | 3300005327 | Ga0070658_10387276 | Ga0070658_103872761 | 236 |
| 215 | 3300005329 | Ga0070683_100061095 | Ga0070683_1000610953 | 236 |
| 216 | 3300005329 | Ga0070683_100066728 | Ga0070683_1000667281 | 236 |
| 217 | 3300005336 | Ga0070680_100003049 | Ga0070680_10000304912 | 236 |
| 218 | 3300005336 | Ga0070680_100033936 | Ga0070680_1000339362 | 236 |
| 219 | 3300005339 | Ga0070660_100006046 | Ga0070660_1000060466 | 236 |
| 220 | 3300005339 | Ga0070660_100080032 | Ga0070660_1000800322 | 236 |
| 221 | 3300005339 | Ga0070660_100271023 | Ga0070660_1002710231 | 236 |
| 222 | 3300005339 | Ga0070660_100288991 | Ga0070660_1002889912 | 236 |
| 223 | 3300005343 | Ga0070687_100059109 | Ga0070687_1000591092 | 236 |
| 224 | 3300005347 | Ga0070668_100404752 | Ga0070668_1004047522 | 236 |
| 225 | 3300005366 | Ga0070659_100042532 | Ga0070659_1000425322 | 236 |
| 226 | 3300005366 | Ga0070659_100145899 | Ga0070659_1001458992 | 236 |
| 227 | 3300005435 | Ga0070714_100020134 | Ga0070714_1000201346 | 236 |
| 228 | 3300005435 | Ga0070714_100098418 | Ga0070714_1000984183 | 236 |
| 229 | 3300005436 | Ga0070713_100079436 | Ga0070713_1000794363 | 236 |
| 230 | 3300005437 | Ga0070710_10003636 | Ga0070710_100036363 | 236 |
| 231 | 3300005437 | Ga0070710_10030562 | Ga0070710_100305623 | 236 |
| 232 | 3300005441 | Ga0070700_100227345 | Ga0070700_1002273452 | 236 |
| 233 | 3300005456 | Ga0070678_100571544 | Ga0070678_1005715441 | 236 |
| 234 | 3300005458 | Ga0070681_10061412 | Ga0070681_100614122 | 236 |
| 235 | 3300005458 | Ga0070681_10107228 | Ga0070681_101072282 | 236 |
| 236 | 3300005458 | Ga0070681_10252219 | Ga0070681_102522192 | 236 |
| 237 | 3300005468 | Ga0070707_100000564 | Ga0070707_10000056434 | 236 |
| 238 | 3300005468 | Ga0070707_100107049 | Ga0070707_1001070492 | 236 |
| 239 | 3300005530 | Ga0070679_100050939 | Ga0070679_1000509393 | 236 |
| 240 | 3300005530 | Ga0070679_100066780 | Ga0070679_1000667802 | 236 |
| 241 | 3300005530 | Ga0070679_100261540 | Ga0070679_1002615402 | 236 |
| 242 | 3300005535 | Ga0070684_100116170 | Ga0070684_1001161702 | 236 |
| 243 | 3300005535 | Ga0070684_100135651 | Ga0070684_1001356512 | 236 |
| 244 | 3300005535 | Ga0070684_100148894 | Ga0070684_1001488943 | 236 |
| 245 | 3300005563 | Ga0068855_100039010 | Ga0068855_1000390105 | 236 |
| 246 | 3300005563 | Ga0068855_100477473 | Ga0068855_1004774732 | 236 |
| 247 | 3300005564 | Ga0070664_100133090 | Ga0070664_1001330901 | 236 |
| 248 | 3300005614 | Ga0068856_100035578 | Ga0068856_1000355784 | 236 |
| 249 | 3300005614 | Ga0068856_100157678 | Ga0068856_1001576782 | 236 |
| 250 | 3300005841 | Ga0068863_100559333 | Ga0068863_1005593331 | 236 |
| 251 | 3300006028 | Ga0070717_10052779 | Ga0070717_100527793 | 236 |
| 252 | 3300006028 | Ga0070717_10357924 | Ga0070717_103579242 | 236 |
| 253 | 3300006163 | Ga0070715_10001308 | Ga0070715_100013086 | 236 |
| 254 | 3300006173 | Ga0070716_100076432 | Ga0070716_1000764322 | 236 |
| 255 | 3300006175 | Ga0070712_100160763 | Ga0070712_1001607632 | 236 |
| 256 | 3300006844 | Ga0075428_100032148 | Ga0075428_1000321482 | 236 |
| 257 | 3300006852 | Ga0075433_10289865 | Ga0075433_102898652 | 236 |
| 258 | 3300006871 | Ga0075434_100045175 | Ga0075434_1000451755 | 236 |
| 259 | 3300009093 | Ga0105240_10309496 | Ga0105240_103094962 | 236 |
| 260 | 3300009094 | Ga0111539_10385547 | Ga0111539_103855472 | 236 |
| 261 | 3300009098 | Ga0105245_10233885 | Ga0105245_102338852 | 236 |
| 262 | 3300009098 | Ga0105245_10291516 | Ga0105245_102915161 | 236 |
| 263 | 3300009147 | Ga0114129_10023581 | Ga0114129_100235815 | 236 |
| 264 | 3300009148 | Ga0105243_10417329 | Ga0105243_104173292 | 236 |
| 265 | 3300009545 | Ga0105237_10106611 | Ga0105237_101066112 | 236 |
| 266 | 3300009545 | Ga0105237_10772395 | Ga0105237_107723951 | 236 |
| 267 | 3300010375 | Ga0105239_10601533 | Ga0105239_106015332 | 236 |
| 268 | 3300013100 | Ga0157373_10118462 | Ga0157373_101184622 | 236 |
| 269 | 3300013105 | Ga0157369_10128406 | Ga0157369_101284062 | 236 |
| 270 | 3300013306 | Ga0163162_10113003 | Ga0163162_101130032 | 236 |
| 271 | 3300014325 | Ga0163163_10362654 | Ga0163163_103626542 | 236 |
| 272 | 3300014497 | Ga0182008_10004439 | Ga0182008_100044396 | 236 |
| 273 | 3300014969 | Ga0157376_10061894 | Ga0157376_100618943 | 236 |
| 274 | 3300015265 | Ga0182005_1079036 | Ga0182005_10790361 | 236 |
| 275 | 3300020082 | Ga0206353_10249266 | Ga0206353_102492662 | 236 |
| 276 | 3300022467 | Ga0224712_10078784 | Ga0224712_100787842 | 236 |
| 277 | 3300025898 | Ga0207692_10063150 | Ga0207692_100631502 | 236 |
| 278 | 3300025905 | Ga0207685_10003356 | Ga0207685_100033564 | 236 |
| 279 | 3300025906 | Ga0207699_10003512 | Ga0207699_100035123 | 236 |
| 280 | 3300025909 | Ga0207705_10052409 | Ga0207705_100524093 | 236 |
| 281 | 3300025909 | Ga0207705_10173174 | Ga0207705_101731742 | 236 |
| 282 | 3300025909 | Ga0207705_10247077 | Ga0207705_102470772 | 236 |
| 283 | 3300025910 | Ga0207684_10186259 | Ga0207684_101862592 | 236 |
| 284 | 3300025912 | Ga0207707_10031560 | Ga0207707_100315603 | 236 |
| 285 | 3300025912 | Ga0207707_10208524 | Ga0207707_102085242 | 236 |
| 286 | 3300025912 | Ga0207707_10429256 | Ga0207707_104292562 | 236 |
| 287 | 3300025913 | Ga0207695_10445533 | Ga0207695_104455331 | 236 |
| 288 | 3300025915 | Ga0207693_10000818 | Ga0207693_1000081811 | 236 |
| 289 | 3300025915 | Ga0207693_10005938 | Ga0207693_100059384 | 236 |
| 290 | 3300025917 | Ga0207660_10034649 | Ga0207660_100346493 | 236 |
| 291 | 3300025917 | Ga0207660_10040722 | Ga0207660_100407221 | 236 |
| 292 | 3300025919 | Ga0207657_10003035 | Ga0207657_100030354 | 236 |
| 293 | 3300025919 | Ga0207657_10008522 | Ga0207657_100085224 | 236 |
| 294 | 3300025920 | Ga0207649_10049597 | Ga0207649_100495972 | 236 |
| 295 | 3300025921 | Ga0207652_10034039 | Ga0207652_100340393 | 236 |
| 296 | 3300025921 | Ga0207652_10047859 | Ga0207652_100478594 | 236 |
| 297 | 3300025921 | Ga0207652_10346927 | Ga0207652_103469272 | 236 |
| 298 | 3300025922 | Ga0207646_10003389 | Ga0207646_100033895 | 236 |
| 299 | 3300025922 | Ga0207646_10100926 | Ga0207646_101009262 | 236 |
| 300 | 3300025922 | Ga0207646_10606091 | Ga0207646_106060911 | 236 |
| 301 | 3300025927 | Ga0207687_10107179 | Ga0207687_101071793 | 236 |
| 302 | 3300025932 | Ga0207690_10172053 | Ga0207690_101720531 | 236 |
| 303 | 3300025932 | Ga0207690_10199168 | Ga0207690_101991682 | 236 |
| 304 | 3300025939 | Ga0207665_10002350 | Ga0207665_100023509 | 236 |
| 305 | 3300025942 | Ga0207689_10116685 | Ga0207689_101166852 | 236 |
| 306 | 3300025944 | Ga0207661_10024230 | Ga0207661_100242305 | 236 |
| 307 | 3300025944 | Ga0207661_10031873 | Ga0207661_100318734 | 236 |
| 308 | 3300025944 | Ga0207661_10151595 | Ga0207661_101515953 | 236 |
| 309 | 3300025949 | Ga0207667_10386539 | Ga0207667_103865392 | 236 |
| 310 | 3300026041 | Ga0207639_10182759 | Ga0207639_101827592 | 236 |
| 311 | 3300026041 | Ga0207639_10523223 | Ga0207639_105232232 | 236 |
| 312 | 3300026075 | Ga0207708_10171275 | Ga0207708_101712752 | 236 |
| 313 | 3300026078 | Ga0207702_10630616 | Ga0207702_106306161 | 236 |
| 314 | 3300026088 | Ga0207641_10414430 | Ga0207641_104144302 | 236 |
| 315 | 3300026121 | Ga0207683_10658497 | Ga0207683_106584972 | 236 |
| 316 | 3300026142 | Ga0207698_10503741 | Ga0207698_105037411 | 236 |
| 317 | 3300028563 | Ga0265319_1029278 | Ga0265319_10292781 | 236 |
| 318 | 3300028577 | Ga0265318_10004002 | Ga0265318_100040027 | 236 |
| 319 | 3300028577 | Ga0265318_10014015 | Ga0265318_100140153 | 236 |
| 320 | 3300028654 | Ga0265322_10029714 | Ga0265322_100297142 | 236 |
| 321 | 3300031235 | Ga0265330_10023818 | Ga0265330_100238181 | 236 |
| 322 | 3300031240 | Ga0265320_10099911 | Ga0265320_100999112 | 236 |
| 323 | 3300031242 | Ga0265329_10008096 | Ga0265329_100080964 | 236 |
| 324 | 3300031247 | Ga0265340_10058722 | Ga0265340_100587222 | 236 |
| 325 | 3300031251 | Ga0265327_10006570 | Ga0265327_100065706 | 236 |
| 326 | 3300031711 | Ga0265314_10017125 | Ga0265314_100171254 | 236 |
| 327 | 3300035086 | Ga0373934_0189240 | Ga0373934_0189240_94_807 | 236 |
| 328 | 3300035121 | Ga0373960_0038352 | Ga0373960_0038352_107_826 | 236 |
| 329 | 3300035171 | Ga0373946_0025614 | Ga0373946_0025614_1121_1840 | 236 |
| 330 | 3300037312 | Ga0395899_0193100 | Ga0395899_0193100_547_1260 | 236 |
| 331 | 3300037312 | Ga0395899_0244667 | Ga0395899_0244667_25_738 | 236 |
| 332 | 3300037418 | Ga0395900_0074470 | Ga0395900_0074470_2313_3026 | 236 |
| 333 | 3300037418 | Ga0395900_0248295 | Ga0395900_0248295_538_1275 | 236 |
| 334 | 3300037418 | Ga0395900_0283704 | Ga0395900_0283704_152_865 | 236 |
| 335 | 3300037466 | Ga0395898_0026566 | Ga0395898_0026566_3428_4141 | 236 |
| 336 | 3300037466 | Ga0395898_0419399 | Ga0395898_0419399_230_943 | 236 |
| 337 | 3300037466 | Ga0395898_0798967 | Ga0395898_0798967_107_820 | 236 |
| 338 | 3300037471 | Ga0395905_0018346 | Ga0395905_0018346_1312_2025 | 236 |
| 339 | 3300037471 | Ga0395905_0085490 | Ga0395905_0085490_175_888 | 236 |
| 340 | 3300038443 | Ga0395901_0194876 | Ga0395901_0194876_505_1218 | 236 |
| 341 | 3300041512 | Ga0451853_3483484 | Ga0451853_3483484_401_1114 | 236 |
| 342 | 3300044693 | Ga0466961_0007871 | Ga0466961_0007871_3903_4616 | 236 |
| 343 | 3300044694 | Ga0466963_0000333 | Ga0466963_0000333_6205_6918 | 236 |
| 344 | 3300044694 | Ga0466963_0002587 | Ga0466963_0002587_8817_9536 | 236 |
| 345 | 3300044694 | Ga0466963_0008710 | Ga0466963_0008710_1638_2348 | 236 |
| 346 | 3300044694 | Ga0466963_0057242 | Ga0466963_0057242_1092_1805 | 236 |
| 347 | 3300044694 | Ga0466963_0064759 | Ga0466963_0064759_731_1444 | 236 |
| 348 | 3300044694 | Ga0466963_0103432 | Ga0466963_0103432_778_1488 | 236 |
| 349 | 3300044694 | Ga0466963_0155732 | Ga0466963_0155732_858_1571 | 236 |
| 350 | 3300044735 | Ga0466968_0012403 | Ga0466968_0012403_1965_2678 | 236 |
| 351 | 3300044735 | Ga0466968_0021646 | Ga0466968_0021646_138_851 | 236 |
| 352 | 3300044842 | Ga0466957_0028582 | Ga0466957_0028582_784_1503 | 236 |
| 353 | 3300044842 | Ga0466957_0096108 | Ga0466957_0096108_895_1608 | 236 |
| 354 | 3300045049 | Ga0466959_0002176 | Ga0466959_0002176_6553_7266 | 236 |
| 355 | 3300045836 | Ga0466958_0003251 | Ga0466958_0003251_778_1491 | 236 |
| 356 | 3300045836 | Ga0466958_0036990 | Ga0466958_0036990_261_971 | 236 |
| 357 | 3300045836 | Ga0466958_0209032 | Ga0466958_0209032_208_921 | 236 |
| 358 | 3300045976 | Ga0466967_0000209 | Ga0466967_0000209_15492_16205 | 236 |
| 359 | 3300045976 | Ga0466967_0002179 | Ga0466967_0002179_3647_4357 | 236 |
| 360 | 3300045976 | Ga0466967_0020671 | Ga0466967_0020671_575_1288 | 236 |
| 361 | 3300045976 | Ga0466967_0061409 | Ga0466967_0061409_197_910 | 236 |
| 362 | 3300045976 | Ga0466967_0080740 | Ga0466967_0080740_1709_2428 | 236 |
| 363 | 3300045976 | Ga0466967_0139681 | Ga0466967_0139681_811_1524 | 236 |
| 364 | 3300045976 | Ga0466967_0252985 | Ga0466967_0252985_475_1188 | 236 |
| 365 | 3300046459 | Ga0495629_0125227 | Ga0495629_0125227_240_953 | 236 |
| 366 | 3300046462 | Ga0495651_0235837 | Ga0495651_0235837_73_786 | 236 |
| 367 | 3300046474 | Ga0495605_0018812 | Ga0495605_0018812_648_1367 | 236 |
| 368 | 3300046476 | Ga0495662_0192159 | Ga0495662_0192159_40_753 | 236 |
| 369 | 3300046492 | Ga0495585_0031145 | Ga0495585_0031145_1810_2529 | 236 |
| 370 | 3300046500 | Ga0495596_0015174 | Ga0495596_0015174_518_1228 | 236 |
| 371 | 3300046511 | Ga0495608_0223809 | Ga0495608_0223809_251_964 | 236 |
| 372 | 3300046517 | Ga0495630_0016469 | Ga0495630_0016469_259_972 | 236 |
| 373 | 3300046525 | Ga0495663_0023754 | Ga0495663_0023754_423_1142 | 236 |
| 374 | 3300046533 | Ga0495640_0190851 | Ga0495640_0190851_92_805 | 236 |
| 375 | 3300046539 | Ga0495621_0178881 | Ga0495621_0178881_103_822 | 236 |
| 376 | 3300046559 | Ga0495667_0168655 | Ga0495667_0168655_642_1352 | 236 |
| 377 | 3300046615 | Ga0495656_0001601 | Ga0495656_0001601_1928_2647 | 236 |
| 378 | 3300046642 | Ga0495634_0228376 | Ga0495634_0228376_229_939 | 236 |
| 379 | 3300046642 | Ga0495634_0348923 | Ga0495634_0348923_99_812 | 236 |
| 380 | 3300046663 | Ga0495635_0043899 | Ga0495635_0043899_1141_1851 | 236 |
| 381 | 3300046674 | Ga0495588_0240013 | Ga0495588_0240013_175_888 | 236 |
| 382 | 3300046675 | Ga0495657_0181305 | Ga0495657_0181305_428_1138 | 236 |
| 383 | 3300046684 | Ga0495669_0047283 | Ga0495669_0047283_1057_1776 | 236 |
| 384 | 3300046689 | Ga0495613_0012660 | Ga0495613_0012660_1106_1819 | 236 |
| 385 | 3300046690 | Ga0495624_0055579 | Ga0495624_0055579_1101_1814 | 236 |
| 386 | 3300046691 | Ga0495670_0091387 | Ga0495670_0091387_210_929 | 236 |
| 387 | 3300046794 | Ga0495589_0042213 | Ga0495589_0042213_219_938 | 236 |
| 388 | 3300047317 | Ga0495604_0211478 | Ga0495604_0211478_252_965 | 236 |
| 389 | 3300047319 | Ga0495674_0076457 | Ga0495674_0076457_1424_2137 | 236 |
| 390 | 3300047321 | Ga0495676_0246061 | Ga0495676_0246061_40_753 | 236 |
| 391 | 3300047322 | Ga0495680_0052372 | Ga0495680_0052372_812_1522 | 236 |
| 392 | 3300048903 | Ga0496100_0207789 | Ga0496100_0207789_122_841 | 236 |
| 393 | 3300048904 | Ga0496101_0066778 | Ga0496101_0066778_1762_2481 | 236 |
| 394 | 3300048905 | Ga0496102_0014475 | Ga0496102_0014475_911_1630 | 236 |
| 395 | 3300048905 | Ga0496102_0483468 | Ga0496102_0483468_37_756 | 236 |
| 396 | 3300048906 | Ga0496103_0128488 | Ga0496103_0128488_151_870 | 236 |
| 397 | 3300048907 | Ga0496104_0063124 | Ga0496104_0063124_2549_3268 | 236 |
| 398 | 3300048907 | Ga0496104_0302157 | Ga0496104_0302157_150_869 | 236 |
| 399 | 3300048908 | Ga0496105_0001228 | Ga0496105_0001228_574_1287 | 236 |
| 400 | 3300048908 | Ga0496105_0037431 | Ga0496105_0037431_1159_1878 | 236 |
| 401 | 3300048908 | Ga0496105_0401365 | Ga0496105_0401365_268_987 | 236 |
| 402 | 3300048909 | Ga0496106_0053154 | Ga0496106_0053154_844_1563 | 236 |
| 403 | 3300048909 | Ga0496106_0277978 | Ga0496106_0277978_295_1014 | 236 |
| 404 | 3300048909 | Ga0496106_0561736 | Ga0496106_0561736_106_819 | 236 |
| 405 | 3300048910 | Ga0496107_0005213 | Ga0496107_0005213_6614_7333 | 236 |
| 406 | 3300048911 | Ga0496108_0041373 | Ga0496108_0041373_148_867 | 236 |
| 407 | 3300048911 | Ga0496108_0051867 | Ga0496108_0051867_1835_2548 | 236 |
| 408 | 3300048911 | Ga0496108_0094885 | Ga0496108_0094885_201_914 | 236 |
| 409 | 3300048912 | Ga0496109_0003943 | Ga0496109_0003943_157_870 | 236 |
| 410 | 3300048912 | Ga0496109_0013496 | Ga0496109_0013496_1306_2025 | 236 |
| 411 | 3300048912 | Ga0496109_0022004 | Ga0496109_0022004_1928_2647 | 236 |
| 412 | 3300048912 | Ga0496109_0202736 | Ga0496109_0202736_202_915 | 236 |
| 413 | 3300048913 | Ga0496110_0086793 | Ga0496110_0086793_393_1106 | 236 |
| 414 | 3300048913 | Ga0496110_0678910 | Ga0496110_0678910_29_742 | 236 |
| 415 | 3300048914 | Ga0496111_0020430 | Ga0496111_0020430_2332_3045 | 236 |
| 416 | 3300048914 | Ga0496111_0055348 | Ga0496111_0055348_686_1411 | 236 |
| 417 | 3300048915 | Ga0496112_0006947 | Ga0496112_0006947_1258_1974 | 236 |
| 418 | 3300048915 | Ga0496112_0011718 | Ga0496112_0011718_4750_5469 | 236 |
| 419 | 3300048915 | Ga0496112_0182768 | Ga0496112_0182768_976_1695 | 236 |
| 420 | 3300048915 | Ga0496112_0349903 | Ga0496112_0349903_92_868 | 236 |
| 421 | 3300048916 | Ga0496113_0191674 | Ga0496113_0191674_754_1473 | 236 |
| 422 | 3300048916 | Ga0496113_0327918 | Ga0496113_0327918_407_1120 | 236 |
| 423 | 3300048917 | Ga0496114_0081947 | Ga0496114_0081947_1249_1974 | 236 |
| 424 | 3300048918 | Ga0496115_0028747 | Ga0496115_0028747_566_1285 | 236 |
| 425 | 3300048918 | Ga0496115_0333232 | Ga0496115_0333232_73_792 | 236 |
| 426 | 3300049568 | Ga0501031_0006591 | Ga0501031_0006591_5147_5860 | 236 |
| 427 | 3300049569 | Ga0501032_0073018 | Ga0501032_0073018_913_1626 | 236 |
| 428 | 3300049572 | Ga0501036_0021898 | Ga0501036_0021898_1135_1848 | 236 |
| 429 | 3300049573 | Ga0501037_0095869 | Ga0501037_0095869_112_825 | 236 |
| 430 | 3300049574 | Ga0501038_0009896 | Ga0501038_0009896_7582_8295 | 236 |
| 431 | 3300049574 | Ga0501038_0589590 | Ga0501038_0589590_41_751 | 236 |
| 432 | 3300049575 | Ga0501039_0016892 | Ga0501039_0016892_1689_2402 | 236 |
| 433 | 3300049577 | Ga0501041_0002462 | Ga0501041_0002462_1654_2367 | 236 |
| 434 | 3300049577 | Ga0501041_0151173 | Ga0501041_0151173_22_732 | 236 |
| 435 | 3300049578 | Ga0501042_0055196 | Ga0501042_0055196_435_1148 | 236 |
| 436 | 3300049580 | Ga0501046_0042882 | Ga0501046_0042882_33_746 | 236 |
| 437 | 3300049582 | Ga0501048_0031141 | Ga0501048_0031141_594_1307 | 236 |
| 438 | 3300049584 | Ga0501068_0087383 | Ga0501068_0087383_269_982 | 236 |
| 439 | 3300049584 | Ga0501068_0395273 | Ga0501068_0395273_127_843 | 236 |
| 440 | 3300049587 | Ga0501071_0004711 | Ga0501071_0004711_3611_4324 | 236 |
| 441 | 3300049588 | Ga0501072_0041617 | Ga0501072_0041617_2191_2904 | 236 |
| 442 | 3300049590 | Ga0501074_0051737 | Ga0501074_0051737_1229_1942 | 236 |
| 443 | 3300049590 | Ga0501074_0585778 | Ga0501074_0585778_47_778 | 236 |
| 444 | 3300049592 | Ga0501076_0000793 | Ga0501076_0000793_17476_18189 | 236 |
| 445 | 3300049743 | Ga0501081_0013023 | Ga0501081_0013023_4005_4718 | 236 |
| 446 | 3300049743 | Ga0501081_0224379 | Ga0501081_0224379_596_1327 | 236 |
| 447 | 3300049744 | Ga0501083_0070010 | Ga0501083_0070010_1208_1921 | 236 |
| 448 | 3300049822 | Ga0501035_0158939 | Ga0501035_0158939_1155_1868 | 236 |
| 449 | 3300049824 | Ga0501045_0062972 | Ga0501045_0062972_1588_2319 | 236 |
| 450 | 3300050507 | nmdc:mga05p37_10418_c1 | nmdc:mga05p37_10418_c1_4224_4937 | 236 |
| 451 | 3300050508 | nmdc:mga09592_286904_c1 | nmdc:mga09592_286904_c1_268_981 | 236 |
| 452 | 3300050515 | nmdc:mga0a205_289376_c1 | nmdc:mga0a205_289376_c1_270_989 | 236 |
| 453 | 3300053083 | Ga0495655_0022791 | Ga0495655_0022791_703_1416 | 236 |
| 454 | 3300053085 | Ga0495619_0070196 | Ga0495619_0070196_522_1232 | 236 |
| 455 | 3300054114 | Ga0501084_0027162 | Ga0501084_0027162_2702_3433 | 236 |
| 456 | 3300054114 | Ga0501084_0056772 | Ga0501084_0056772_334_1047 | 236 |
| 457 | 3300061734 | Ga0530510_0025275 | Ga0530510_0025275_3461_4174 | 236 |
| 458 | 3300003203 | JGI25406J46586_10080291 | JGI25406J46586_100802911 | 237 |
| 459 | 3300005329 | Ga0070683_100770465 | Ga0070683_1007704651 | 237 |
| 460 | 3300005343 | Ga0070687_100143275 | Ga0070687_1001432752 | 237 |
| 461 | 3300005353 | Ga0070669_100367634 | Ga0070669_1003676341 | 237 |
| 462 | 3300005365 | Ga0070688_100396806 | Ga0070688_1003968062 | 237 |
| 463 | 3300005439 | Ga0070711_100099829 | Ga0070711_1000998292 | 237 |
| 464 | 3300005468 | Ga0070707_100002679 | Ga0070707_1000026793 | 237 |
| 465 | 3300005468 | Ga0070707_100070572 | Ga0070707_1000705722 | 237 |
| 466 | 3300005468 | Ga0070707_100474983 | Ga0070707_1004749831 | 237 |
| 467 | 3300005471 | Ga0070698_100077255 | Ga0070698_1000772554 | 237 |
| 468 | 3300005471 | Ga0070698_100342691 | Ga0070698_1003426912 | 237 |
| 469 | 3300005518 | Ga0070699_100014051 | Ga0070699_1000140515 | 237 |
| 470 | 3300005615 | Ga0070702_100269721 | Ga0070702_1002697211 | 237 |
| 471 | 3300005985 | Ga0081539_10007824 | Ga0081539_1000782412 | 237 |
| 472 | 3300006028 | Ga0070717_10062457 | Ga0070717_100624572 | 237 |
| 473 | 3300006051 | Ga0075364_10458396 | Ga0075364_104583961 | 237 |
| 474 | 3300006175 | Ga0070712_100016545 | Ga0070712_1000165454 | 237 |
| 475 | 3300006358 | Ga0068871_100452888 | Ga0068871_1004528882 | 237 |
| 476 | 3300006852 | Ga0075433_10589192 | Ga0075433_105891922 | 237 |
| 477 | 3300006871 | Ga0075434_100348617 | Ga0075434_1003486172 | 237 |
| 478 | 3300009147 | Ga0114129_10117350 | Ga0114129_101173502 | 237 |
| 479 | 3300009147 | Ga0114129_10326199 | Ga0114129_103261992 | 237 |
| 480 | 3300009147 | Ga0114129_10742024 | Ga0114129_107420242 | 237 |
| 481 | 3300010375 | Ga0105239_10535184 | Ga0105239_105351842 | 237 |
| 482 | 3300013296 | Ga0157374_10349444 | Ga0157374_103494442 | 237 |
| 483 | 3300013297 | Ga0157378_10564026 | Ga0157378_105640262 | 237 |
| 484 | 3300013308 | Ga0157375_10011961 | Ga0157375_100119612 | 237 |
| 485 | 3300025905 | Ga0207685_10113254 | Ga0207685_101132542 | 237 |
| 486 | 3300025906 | Ga0207699_10061930 | Ga0207699_100619303 | 237 |
| 487 | 3300025915 | Ga0207693_10073224 | Ga0207693_100732242 | 237 |
| 488 | 3300025922 | Ga0207646_10016098 | Ga0207646_100160986 | 237 |
| 489 | 3300025922 | Ga0207646_10552323 | Ga0207646_105523231 | 237 |
| 490 | 3300025927 | Ga0207687_10044009 | Ga0207687_100440092 | 237 |
| 491 | 3300025928 | Ga0207700_10000039 | Ga0207700_1000003973 | 237 |
| 492 | 3300025939 | Ga0207665_10016380 | Ga0207665_100163802 | 237 |
| 493 | 3300025960 | Ga0207651_10100464 | Ga0207651_101004642 | 237 |
| 494 | 3300032002 | Ga0307416_100218606 | Ga0307416_1002186062 | 237 |
| 495 | 3300035725 | Ga0373947_0096308 | Ga0373947_0096308_825_1562 | 237 |
| 496 | 3300037068 | Ga0373925_0231844 | Ga0373925_0231844_528_1265 | 237 |
| 497 | 3300037312 | Ga0395899_0018252 | Ga0395899_0018252_651_1400 | 237 |
| 498 | 3300037312 | Ga0395899_0034937 | Ga0395899_0034937_1913_2662 | 237 |
| 499 | 3300037312 | Ga0395899_0040228 | Ga0395899_0040228_1926_2675 | 237 |
| 500 | 3300037418 | Ga0395900_0000528 | Ga0395900_0000528_47106_47855 | 237 |
| 501 | 3300037418 | Ga0395900_0003881 | Ga0395900_0003881_2865_3614 | 237 |
| 502 | 3300037418 | Ga0395900_0005059 | Ga0395900_0005059_12875_13594 | 237 |
| 503 | 3300037418 | Ga0395900_0046097 | Ga0395900_0046097_492_1226 | 237 |
| 504 | 3300037418 | Ga0395900_0062611 | Ga0395900_0062611_2115_2834 | 237 |
| 505 | 3300037418 | Ga0395900_0064367 | Ga0395900_0064367_444_1193 | 237 |
| 506 | 3300037418 | Ga0395900_0194234 | Ga0395900_0194234_1224_1943 | 237 |
| 507 | 3300037418 | Ga0395900_0243910 | Ga0395900_0243910_136_849 | 237 |
| 508 | 3300037418 | Ga0395900_0385815 | Ga0395900_0385815_77_793 | 237 |
| 509 | 3300037466 | Ga0395898_0008250 | Ga0395898_0008250_2205_2954 | 237 |
| 510 | 3300037466 | Ga0395898_0018085 | Ga0395898_0018085_148_867 | 237 |
| 511 | 3300037466 | Ga0395898_0053098 | Ga0395898_0053098_2562_3311 | 237 |
| 512 | 3300037466 | Ga0395898_0059067 | Ga0395898_0059067_2742_3476 | 237 |
| 513 | 3300037466 | Ga0395898_0126222 | Ga0395898_0126222_1455_2204 | 237 |
| 514 | 3300037466 | Ga0395898_0359725 | Ga0395898_0359725_475_1191 | 237 |
| 515 | 3300037466 | Ga0395898_0505407 | Ga0395898_0505407_17_730 | 237 |
| 516 | 3300037471 | Ga0395905_0000661 | Ga0395905_0000661_44613_45362 | 237 |
| 517 | 3300037471 | Ga0395905_0004596 | Ga0395905_0004596_1422_2141 | 237 |
| 518 | 3300037471 | Ga0395905_0008537 | Ga0395905_0008537_7278_8027 | 237 |
| 519 | 3300037471 | Ga0395905_0022508 | Ga0395905_0022508_1877_2626 | 237 |
| 520 | 3300037471 | Ga0395905_0386682 | Ga0395905_0386682_510_1244 | 237 |
| 521 | 3300037471 | Ga0395905_0512241 | Ga0395905_0512241_33_746 | 237 |
| 522 | 3300038443 | Ga0395901_0001886 | Ga0395901_0001886_17377_18126 | 237 |
| 523 | 3300038443 | Ga0395901_0008256 | Ga0395901_0008256_2803_3522 | 237 |
| 524 | 3300038443 | Ga0395901_0012865 | Ga0395901_0012865_7718_8437 | 237 |
| 525 | 3300038443 | Ga0395901_0042772 | Ga0395901_0042772_351_1100 | 237 |
| 526 | 3300038443 | Ga0395901_0050560 | Ga0395901_0050560_836_1552 | 237 |
| 527 | 3300038443 | Ga0395901_0080362 | Ga0395901_0080362_1889_2602 | 237 |
| 528 | 3300038443 | Ga0395901_0082765 | Ga0395901_0082765_1628_2362 | 237 |
| 529 | 3300038443 | Ga0395901_0143158 | Ga0395901_0143158_1744_2463 | 237 |
| 530 | 3300038443 | Ga0395901_0254097 | Ga0395901_0254097_562_1311 | 237 |
| 531 | 3300038443 | Ga0395901_0712479 | Ga0395901_0712479_211_930 | 237 |
| 532 | 3300038996 | Ga0242420_022368 | Ga0242420_022368_391_1107 | 237 |
| 533 | 3300041512 | Ga0451853_1011961 | Ga0451853_1011961_379_1128 | 237 |
| 534 | 3300045976 | Ga0466967_0035665 | Ga0466967_0035665_774_1493 | 237 |
| 535 | 3300045976 | Ga0466967_0077263 | Ga0466967_0077263_489_1208 | 237 |
| 536 | 3300046454 | Ga0495592_0171637 | Ga0495592_0171637_344_1063 | 237 |
| 537 | 3300046463 | Ga0495653_0087201 | Ga0495653_0087201_784_1503 | 237 |
| 538 | 3300046473 | Ga0495582_0068060 | Ga0495582_0068060_920_1657 | 237 |
| 539 | 3300046475 | Ga0495639_0306846 | Ga0495639_0306846_30_749 | 237 |
| 540 | 3300046500 | Ga0495596_0045663 | Ga0495596_0045663_752_1486 | 237 |
| 541 | 3300046500 | Ga0495596_0060863 | Ga0495596_0060863_435_1169 | 237 |
| 542 | 3300046529 | Ga0495652_0137166 | Ga0495652_0137166_615_1334 | 237 |
| 543 | 3300046538 | Ga0495609_0030436 | Ga0495609_0030436_1176_1925 | 237 |
| 544 | 3300046692 | Ga0495671_0124698 | Ga0495671_0124698_14_733 | 237 |
| 545 | 3300047315 | Ga0495581_0000417 | Ga0495581_0000417_4893_5630 | 237 |
| 546 | 3300047321 | Ga0495676_0106615 | Ga0495676_0106615_1166_1903 | 237 |
| 547 | 3300048903 | Ga0496100_0125211 | Ga0496100_0125211_564_1283 | 237 |
| 548 | 3300048903 | Ga0496100_0494460 | Ga0496100_0494460_35_769 | 237 |
| 549 | 3300048904 | Ga0496101_0026024 | Ga0496101_0026024_2648_3367 | 237 |
| 550 | 3300048905 | Ga0496102_0098304 | Ga0496102_0098304_1853_2572 | 237 |
| 551 | 3300048905 | Ga0496102_0355678 | Ga0496102_0355678_197_916 | 237 |
| 552 | 3300048907 | Ga0496104_0160823 | Ga0496104_0160823_1035_1754 | 237 |
| 553 | 3300048908 | Ga0496105_0021241 | Ga0496105_0021241_3738_4457 | 237 |
| 554 | 3300048908 | Ga0496105_0133054 | Ga0496105_0133054_72_803 | 237 |
| 555 | 3300048911 | Ga0496108_0052866 | Ga0496108_0052866_686_1420 | 237 |
| 556 | 3300048911 | Ga0496108_0502727 | Ga0496108_0502727_120_851 | 237 |
| 557 | 3300048912 | Ga0496109_0000534 | Ga0496109_0000534_25993_26727 | 237 |
| 558 | 3300048913 | Ga0496110_0021631 | Ga0496110_0021631_2179_2913 | 237 |
| 559 | 3300048913 | Ga0496110_0135212 | Ga0496110_0135212_1051_1782 | 237 |
| 560 | 3300048914 | Ga0496111_0201919 | Ga0496111_0201919_353_1072 | 237 |
| 561 | 3300048915 | Ga0496112_0166925 | Ga0496112_0166925_225_944 | 237 |
| 562 | 3300048916 | Ga0496113_0017584 | Ga0496113_0017584_1418_2152 | 237 |
| 563 | 3300048916 | Ga0496113_0025415 | Ga0496113_0025415_692_1411 | 237 |
| 564 | 3300048917 | Ga0496114_0028430 | Ga0496114_0028430_3523_4242 | 237 |
| 565 | 3300048918 | Ga0496115_0013003 | Ga0496115_0013003_140_859 | 237 |
| 566 | 3300050507 | nmdc:mga05p37_119103_c1 | nmdc:mga05p37_119103_c1_224_937 | 237 |
| 567 | 3300050507 | nmdc:mga05p37_476754_c1 | nmdc:mga05p37_476754_c1_442_1176 | 237 |
| 568 | 3300050515 | nmdc:mga0a205_342200_c1 | nmdc:mga0a205_342200_c1_55_789 | 237 |
| 569 | 3300053077 | Ga0495601_0473464 | Ga0495601_0473464_17_736 | 237 |
| 570 | 3300053084 | Ga0495595_0175245 | Ga0495595_0175245_239_958 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nox-assembly3.cif.gz_I | crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans | 0.8733 | 21 | 229 |
| 3bk9-assembly2.cif.gz_F | h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris | 0.8694 | 21 | 227 |
| 2nw8-assembly1.cif.gz_A | crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13. | 0.8576 | 16 | 229 |
| 3bk9-assembly2.cif.gz_H | h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris | 0.8483 | 24 | 229 |
| 2nox-assembly2.cif.gz_G | crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans | 0.8482 | 24 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2noxJ00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8473 | 21 | 229 | 1.20.58.480 |
| 2nw9B00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.826 | 24 | 227 | 1.20.58.480 |
| 3bk9C00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8178 | 12 | 227 | 1.20.58.480 |
| 4hkaA01 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7835 | 15 | 227 | 1.20.58.480 |
| 2noxJ00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7491 | 21 | 229 | 1.20.58.480 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535C5V8-F1-model_v4 | Tryptophan 2,3-dioxygenase | 0.9631 | 49 | 236 |
GO:0004833
GO:0019441 GO:0019442 GO:0020037 GO:0046872 |
| AF-A0A535CT12-F1-model_v4 | Tryptophan 2,3-dioxygenase | 0.9613 | 70 | 236 |
GO:0004833
GO:0019441 GO:0019442 GO:0020037 GO:0046872 |
| AF-A0A6V8LBX3-F1-model_v4 | Tryptophan 2,3-dioxygenase | 0.9586 | 25 | 230 |
GO:0004833
GO:0019441 GO:0019442 GO:0020037 GO:0046872 |
| AF-A0A7X0KDH8-F1-model_v4 | deleted | 0.9517 | 25 | 234 |
|
| AF-A0A2N9NBD5-F1-model_v4 | Tryptophan 23-dioxygenase | 0.9508 | 96 | 236 |
GO:0019441
GO:0020037 GO:0046872 GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar