F464876

General Info

Members Datasets Scaffolds Average Seq Length
570 348 1140 244

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0000041|Ga0496107_0000041_65324_66199
Length 291
Sequence MPCRVLVLRQAQDEDDCAGGSFETLILSLSKDEGFTHYPPNGELKMFDLTGKTALVTGATGGIGGAIAKALHEQGAHVVLSGTRESALSELAAQFGERVSFVAANLSDAAAVDGLVAKAEEAAGAPLDIVIANAGITRDGLIVRMKDEDWDTVIKVNLEGYFRLSRAAAKGMMKRRSGRIIGITSIVGVTGNPGQTNYAASKAGMIGFSKALAQELASRNVTVNCVAPGFIASPMTDALNEQQKAGILSTIPAGRLGEGSDIAAACVYLASDQGGYVTGQTLHVNGGMAMI

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
237 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
281 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
282 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
283 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
284 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
300 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
301 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
302 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
303 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
304 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
305 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
306 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
307 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
308 2643221583 Caulobacter sp. Root655 Isolate Unclassified
309 2643221584 Caulobacter sp. Root656 Isolate Unclassified
310 2643221640 Caulobacter sp. Root342 Isolate Unclassified
311 2643221642 Caulobacter sp. Root343 Isolate Unclassified
312 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
313 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
314 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
315 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
316 2738541295 Bacillus sp. OK085 Isolate Unclassified
317 2738543010 Bacillus sp. YR335 Isolate Unclassified
318 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
319 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
320 2818991435 Caulobacter henricii 536 Isolate Unclassified
321 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
322 2842682962 Bacillus sp. R-72492 Isolate Unclassified
323 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
324 2849139964 Bacillus sp. R-71875 Isolate Unclassified
325 2849560528 Caulobacter zeae 410 Isolate Unclassified
326 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
327 2851153111 Caulobacter radicis 736 Isolate Unclassified
328 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
329 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
330 2857581216 Bacillus sp. R-71922 Isolate Unclassified
331 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
332 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
333 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
334 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
335 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
336 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
337 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
338 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
339 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
340 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
341 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
342 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
343 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
344 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
345 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
346 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
347 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
348 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.79
Metatranscriptomes 5.26
Isolates 8.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.84
Nodule 0.18
Rhizoplane 5.09
Rhizosphere 67.37
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0000041 3300048910 Bacteria 75059
2 Ga0006562J51391_1006021 3300003578 Bacteria 3710
3 Ga0055526_1036160 3300003771 Bacteria 1316
4 Ga0055537_1002952 3300003773 Bacteria 5398
5 Ga0055524_1033508 3300003775 Bacteria 1436
6 Ga0055536_1000478 3300003781 Bacteria 27802
7 Ga0055536_1005309 3300003781 Bacteria 6337
8 Ga0055536_1006045 3300003781 Bacteria 5740
9 Ga0055528_1008440 3300003790 Bacteria 4415
10 Ga0055528_1021094 3300003790 Bacteria 2082
11 Ga0055530_10014825 3300003791 Bacteria 2575
12 Ga0055530_10017903 3300003791 Bacteria 2203
13 Ga0055531_10001093 3300003794 Bacteria 21245
14 Ga0055531_10003069 3300003794 Bacteria 10803
15 Ga0055531_10003487 3300003794 Bacteria 10004
16 Ga0065165_1001045 3300005262 Bacteria 33371
17 Ga0065715_10185097 3300005293 Bacteria 1444
18 Ga0070658_10000001 3300005327 Bacteria 856789
19 Ga0070658_10004249 3300005327 Bacteria 11711
20 Ga0070670_100216330 3300005331 Bacteria 1667
21 Ga0070680_100000264 3300005336 Bacteria 34683
22 Ga0070660_100001280 3300005339 Bacteria 17152
23 Ga0070660_100639238 3300005339 Bacteria 891
24 Ga0070689_100691165 3300005340 Bacteria 890
25 Ga0070668_100003297 3300005347 Bacteria 11910
26 Ga0070668_100021693 3300005347 Bacteria 4852
27 Ga0070668_100093507 3300005347 Bacteria 2373
28 Ga0070668_100371606 3300005347 Bacteria 1215
29 Ga0070668_100426046 3300005347 Bacteria 1137
30 Ga0070669_100018715 3300005353 Bacteria 4950
31 Ga0070671_100000479 3300005355 Bacteria 27800
32 Ga0070671_100019977 3300005355 Bacteria 5457
33 Ga0070688_100018458 3300005365 Bacteria 4025
34 Ga0070659_100015232 3300005366 Bacteria 5755
35 Ga0070667_100002158 3300005367 Bacteria 17328
36 Ga0070667_100021993 3300005367 Bacteria 5292
37 Ga0070667_100076986 3300005367 Bacteria 2848
38 Ga0070713_100085475 3300005436 Bacteria 2702
39 Ga0070710_10115372 3300005437 Bacteria 1619
40 Ga0070711_100369595 3300005439 Bacteria 1157
41 Ga0070663_100468703 3300005455 Bacteria 1041
42 Ga0070678_100237023 3300005456 Bacteria 1523
43 Ga0070662_100489754 3300005457 Bacteria 1024
44 Ga0070681_10000213 3300005458 Bacteria 45271
45 Ga0070679_100242218 3300005530 Bacteria 1761
46 Ga0068853_100178507 3300005539 Bacteria 1925
47 Ga0070693_100291452 3300005547 Bacteria 1097
48 Ga0070665_100000940 3300005548 Bacteria 37209
49 Ga0070665_100001410 3300005548 Bacteria 28253
50 Ga0070665_100010051 3300005548 Bacteria 9574
51 Ga0068855_100001693 3300005563 Bacteria 27587
52 Ga0068855_100214207 3300005563 Bacteria 2163
53 Ga0070664_100449815 3300005564 Bacteria 1182
54 Ga0068856_100056115 3300005614 Bacteria 3886
55 Ga0068856_100201468 3300005614 Bacteria 2005
56 Ga0068856_100990431 3300005614 Bacteria 859
57 Ga0068859_100000999 3300005617 Bacteria 28968
58 Ga0068859_100469516 3300005617 Bacteria 1354
59 Ga0068864_100003837 3300005618 Bacteria 12390
60 Ga0068864_100016985 3300005618 Bacteria 6064
61 Ga0068864_100168894 3300005618 Bacteria 1993
62 Ga0068864_100620802 3300005618 Bacteria 1050
63 Ga0068864_100797002 3300005618 Bacteria 928
64 Ga0068861_100318426 3300005719 Bacteria 1354
65 Ga0068863_100006162 3300005841 Bacteria 11760
66 Ga0068863_100007149 3300005841 Bacteria 10951
67 Ga0068858_100014500 3300005842 Bacteria 7426
68 Ga0068858_100054499 3300005842 Bacteria 3697
69 Ga0068858_100064743 3300005842 Bacteria 3384
70 Ga0068860_100001370 3300005843 Bacteria 26465
71 Ga0068860_100012979 3300005843 Bacteria 8183
72 Ga0068860_100111046 3300005843 Bacteria 2621
73 Ga0068862_100004692 3300005844 Bacteria 11510
74 Ga0068862_100146975 3300005844 Bacteria 2095
75 Ga0068862_100420817 3300005844 Bacteria 1254
76 Ga0081455_10094409 3300005937 Bacteria 2416
77 Ga0081455_10184193 3300005937 Bacteria 1578
78 Ga0075365_10002352 3300006038 Bacteria 9218
79 Ga0075368_10000471 3300006042 Bacteria 11930
80 Ga0075363_100008842 3300006048 Bacteria 4712
81 Ga0075363_100072890 3300006048 Bacteria 1868
82 Ga0070712_100099696 3300006175 Bacteria 2144
83 Ga0075362_10035447 3300006177 Bacteria 2178
84 Ga0075367_10020160 3300006178 Bacteria 3709
85 Ga0075369_10010780 3300006186 Bacteria 3581
86 Ga0075366_10037719 3300006195 Bacteria 2854
87 Ga0075370_10075248 3300006353 Bacteria 1936
88 Ga0075428_100032742 3300006844 Bacteria 5741
89 Ga0075431_100021443 3300006847 Bacteria 6607
90 Ga0097620_100000999 3300006931 Bacteria 28968
91 Ga0097620_100469435 3300006931 Bacteria 1354
92 Ga0099795_10000521 3300007788 Bacteria 7219
93 Ga0105244_10066915 3300009036 Bacteria 1798
94 Ga0105240_10003426 3300009093 Bacteria 24643
95 Ga0105240_10099371 3300009093 Bacteria 3542
96 Ga0105240_10399768 3300009093 Bacteria 1548
97 Ga0105245_10039365 3300009098 Bacteria 4207
98 Ga0105245_10131745 3300009098 Bacteria 2346
99 Ga0114129_10063020 3300009147 Bacteria 5179
100 Ga0105242_10120391 3300009176 Bacteria 2251
101 Ga0105248_10000001 3300009177 Bacteria 1881304
102 Ga0105248_10000685 3300009177 Bacteria 38290
103 Ga0105248_10012881 3300009177 Bacteria 9223
104 Ga0105248_10044544 3300009177 Bacteria 4976
105 Ga0105248_10070680 3300009177 Bacteria 3920
106 Ga0105248_10201991 3300009177 Bacteria 2239
107 Ga0105248_10604118 3300009177 Bacteria 1238
108 Ga0105238_10020646 3300009551 Bacteria 6709
109 Ga0105238_10331880 3300009551 Bacteria 1508
110 Ga0105249_10000818 3300009553 Bacteria 28052
111 Ga0105249_10384626 3300009553 Bacteria 1430
112 Ga0099796_10000086 3300010159 Bacteria 15528
113 Ga0099796_10107096 3300010159 Bacteria 1060
114 Ga0157371_10107495 3300013102 Bacteria 1980
115 Ga0157369_10023976 3300013105 Bacteria 6789
116 Ga0163162_10018748 3300013306 Bacteria 6782
117 Ga0163162_10202233 3300013306 Bacteria 2115
118 Ga0163162_10436117 3300013306 Bacteria 1442
119 Ga0163163_10014204 3300014325 Bacteria 7315
120 Ga0163163_10070984 3300014325 Bacteria 3469
121 Ga0163163_10562593 3300014325 Bacteria 1203
122 Ga0157380_10035915 3300014326 Bacteria 3831
123 Ga0157380_10129517 3300014326 Bacteria 2150
124 Ga0157380_10275785 3300014326 Bacteria 1536
125 Ga0157379_10064313 3300014968 Bacteria 3278
126 Ga0157379_10305330 3300014968 Bacteria 1451
127 Ga0213874_10027254 3300021377 Bacteria 1624
128 Ga0224572_1003965 3300024225 Bacteria 2539
129 Ga0224572_1021452 3300024225 Bacteria 1239
130 Ga0228598_1046721 3300024227 Bacteria 857
131 Ga0209233_1024480 3300025261 Bacteria 1509
132 Ga0209565_1000127 3300025263 Bacteria 109900
133 Ga0209675_1010000 3300025291 Bacteria 3285
134 Ga0209676_1000046 3300025292 Bacteria 409173
135 Ga0209676_1000336 3300025292 Bacteria 89848
136 Ga0209676_1000476 3300025292 Bacteria 66212
137 Ga0209676_1001278 3300025292 Bacteria 26066
138 Ga0209025_1028141 3300025294 Bacteria 2764
139 Ga0209564_1005120 3300025295 Bacteria 7627
140 Ga0209564_1023284 3300025295 Bacteria 2158
141 Ga0209758_1000450 3300025297 Bacteria 68773
142 Ga0209758_1008106 3300025297 Bacteria 6916
143 Ga0209050_1000506 3300025298 Bacteria 66220
144 Ga0209050_1007979 3300025298 Bacteria 5780
145 Ga0209050_1018460 3300025298 Bacteria 2709
146 Ga0209050_1019830 3300025298 Bacteria 2534
147 Ga0209256_1016565 3300025299 Bacteria 2503
148 Ga0209256_1019956 3300025299 Bacteria 2112
149 Ga0209051_1057178 3300025303 Bacteria 1251
150 Ga0209257_1000159 3300025304 Bacteria 178767
151 Ga0209257_1000481 3300025304 Bacteria 72432
152 Ga0209257_1008528 3300025304 Bacteria 5792
153 Ga0209257_1028172 3300025304 Bacteria 1854
154 Ga0207680_10035160 3300025903 Bacteria 2874
155 Ga0207705_10000002 3300025909 Bacteria 2046852
156 Ga0207705_10024662 3300025909 Bacteria 4292
157 Ga0207705_10253309 3300025909 Bacteria 1343
158 Ga0207695_10003143 3300025913 Bacteria 23591
159 Ga0207695_10070156 3300025913 Bacteria 3584
160 Ga0207695_10453733 3300025913 Bacteria 1165
161 Ga0207671_10168372 3300025914 Bacteria 1700
162 Ga0207693_10063121 3300025915 Bacteria 2902
163 Ga0207663_10054697 3300025916 Bacteria 2501
164 Ga0207660_10003027 3300025917 Bacteria 11000
165 Ga0207657_10003354 3300025919 Bacteria 17131
166 Ga0207657_10528620 3300025919 Bacteria 923
167 Ga0207652_10006822 3300025921 Bacteria 9200
168 Ga0207652_10115724 3300025921 Bacteria 2382
169 Ga0207681_10009686 3300025923 Bacteria 5896
170 Ga0207694_10032403 3300025924 Bacteria 4000
171 Ga0207694_10410747 3300025924 Bacteria 1127
172 Ga0207650_10000201 3300025925 Bacteria 69058
173 Ga0207650_10122435 3300025925 Bacteria 2027
174 Ga0207687_10079794 3300025927 Bacteria 2360
175 Ga0207700_10063843 3300025928 Bacteria 2802
176 Ga0207644_10004836 3300025931 Bacteria 8766
177 Ga0207644_10089321 3300025931 Bacteria 2293
178 Ga0207644_10105354 3300025931 Bacteria 2124
179 Ga0207690_10003860 3300025932 Bacteria 8859
180 Ga0207706_10062708 3300025933 Bacteria 3273
181 Ga0207706_10494750 3300025933 Bacteria 1056
182 Ga0207711_10000002 3300025941 Bacteria 1228676
183 Ga0207711_10001954 3300025941 Bacteria 18716
184 Ga0207711_10006432 3300025941 Bacteria 9891
185 Ga0207711_10013682 3300025941 Bacteria 6737
186 Ga0207711_10025045 3300025941 Bacteria 5006
187 Ga0207711_10203374 3300025941 Bacteria 1808
188 Ga0207711_10325958 3300025941 Bacteria 1420
189 Ga0207679_10008351 3300025945 Bacteria 6591
190 Ga0207679_10070393 3300025945 Bacteria 2636
191 Ga0207667_10029154 3300025949 Bacteria 5986
192 Ga0207667_10357388 3300025949 Unclassified 1489
193 Ga0207651_10043707 3300025960 Bacteria 2993
194 Ga0207651_10229855 3300025960 Bacteria 1505
195 Ga0207712_10118548 3300025961 Bacteria 1998
196 Ga0207712_10386918 3300025961 Bacteria 1172
197 Ga0207668_10000007 3300025972 Bacteria 190613
198 Ga0207668_10000247 3300025972 Bacteria 36155
199 Ga0207668_10025099 3300025972 Bacteria 3853
200 Ga0207668_10356001 3300025972 Bacteria 1225
201 Ga0207658_10000052 3300025986 Bacteria 128748
202 Ga0207658_10000985 3300025986 Bacteria 23486
203 Ga0207658_10001933 3300025986 Bacteria 15458
204 Ga0207658_10013527 3300025986 Bacteria 5578
205 Ga0207658_10036009 3300025986 Bacteria 3548
206 Ga0207658_10640297 3300025986 Bacteria 958
207 Ga0207703_10002468 3300026035 Bacteria 16038
208 Ga0207703_10049425 3300026035 Bacteria 3400
209 Ga0207678_10324071 3300026067 Bacteria 1326
210 Ga0207702_10023453 3300026078 Bacteria 5118
211 Ga0207702_10098159 3300026078 Bacteria 2580
212 Ga0207641_10087617 3300026088 Bacteria 2716
213 Ga0207641_10267706 3300026088 Bacteria 1602
214 Ga0207676_10001242 3300026095 Bacteria 18975
215 Ga0207676_10012779 3300026095 Bacteria 6024
216 Ga0207676_10094198 3300026095 Bacteria 2467
217 Ga0207676_10186538 3300026095 Bacteria 1821
218 Ga0207676_10334476 3300026095 Bacteria 1395
219 Ga0207675_100139166 3300026118 Bacteria 2305
220 Ga0207675_100154745 3300026118 Bacteria 2184
221 Ga0207675_100923487 3300026118 Bacteria 889
222 Ga0207683_10099258 3300026121 Bacteria 2598
223 Ga0207698_10023739 3300026142 Bacteria 4290
224 Ga0209813_10000616 3300027866 Bacteria 8299
225 Ga0209974_10034907 3300027876 Bacteria 1670
226 Ga0209974_10039696 3300027876 Bacteria 1566
227 Ga0268266_10001205 3300028379 Bacteria 31898
228 Ga0268266_10010417 3300028379 Bacteria 8124
229 Ga0268266_10011789 3300028379 Bacteria 7579
230 Ga0268266_10581886 3300028379 Bacteria 1074
231 Ga0268265_10002350 3300028380 Bacteria 14338
232 Ga0268265_10091103 3300028380 Bacteria 2437
233 Ga0268265_10134907 3300028380 Bacteria 2057
234 Ga0268264_10000684 3300028381 Bacteria 39491
235 Ga0268264_10018738 3300028381 Bacteria 5659
236 Ga0268264_10210953 3300028381 Bacteria 1783
237 Ga0268264_10236140 3300028381 Bacteria 1691
238 Ga0268264_10638747 3300028381 Bacteria 1052
239 Ga0307517_10001029 3300028786 Bacteria 47353
240 Ga0307517_10115170 3300028786 Bacteria 2019
241 Ga0307515_10066696 3300028794 Bacteria 4980
242 Ga0307515_10067676 3300028794 Bacteria 4921
243 Ga0307515_10315002 3300028794 Bacteria 1236
244 Ga0265773_1000596 3300031018 Bacteria 1559
245 Ga0265327_10000220 3300031251 Bacteria 115886
246 Ga0265327_10152209 3300031251 Bacteria 1073
247 Ga0307513_10000082 3300031456 Bacteria 131779
248 Ga0307513_10001006 3300031456 Bacteria 40812
249 Ga0307513_10002226 3300031456 Bacteria 27088
250 Ga0307408_100282071 3300031548 Bacteria 1384
251 Ga0265313_10008177 3300031595 Bacteria 6992
252 Ga0307405_10030398 3300031731 Bacteria 3167
253 Ga0307413_10021312 3300031824 Bacteria 3467
254 Ga0307413_10060092 3300031824 Bacteria 2338
255 Ga0307413_10405389 3300031824 Bacteria 1069
256 Ga0307410_10070753 3300031852 Bacteria 2417
257 Ga0307410_10213633 3300031852 Bacteria 1479
258 Ga0307406_10006321 3300031901 Bacteria 6534
259 Ga0307407_10097113 3300031903 Bacteria 1820
260 Ga0307407_10248898 3300031903 Bacteria 1216
261 Ga0307412_10079699 3300031911 Bacteria 2260
262 Ga0307409_100071151 3300031995 Bacteria 2764
263 Ga0307409_100103587 3300031995 Bacteria 2367
264 Ga0307409_100105165 3300031995 Bacteria 2353
265 Ga0307409_100155825 3300031995 Bacteria 1990
266 Ga0307416_100208507 3300032002 Bacteria 1862
267 Ga0307416_100355940 3300032002 Bacteria 1484
268 Ga0307416_100689512 3300032002 Bacteria 1110
269 Ga0307414_10047374 3300032004 Bacteria 2957
270 Ga0307414_10061855 3300032004 Bacteria 2653
271 Ga0307414_10162131 3300032004 Bacteria 1777
272 Ga0307414_10205516 3300032004 Bacteria 1605
273 Ga0307411_10046571 3300032005 Bacteria 2797
274 Ga0307411_10160596 3300032005 Bacteria 1682
275 Ga0307415_100078895 3300032126 Bacteria 2343
276 Ga0373924_0031367 3300035410 Bacteria 2137
277 Ga0373931_0022704 3300035691 Bacteria 3160
278 Ga0373933_0090001 3300035724 Bacteria 1892
279 Ga0373947_0195926 3300035725 Bacteria 1320
280 Ga0373937_0147549 3300036401 Bacteria 2202
281 Ga0373925_0053200 3300037068 Bacteria 3026
282 Ga0395899_0006527 3300037312 Bacteria 9039
283 Ga0395899_0042865 3300037312 Bacteria 3376
284 Ga0395900_0002429 3300037418 Bacteria 20525
285 Ga0395900_0459504 3300037418 Bacteria 1228
286 Ga0395900_0568185 3300037418 Bacteria 1077
287 Ga0395898_0008060 3300037466 Bacteria 11165
288 Ga0395898_0227526 3300037466 Unclassified 1779
289 Ga0395905_0007649 3300037471 Bacteria 10724
290 Ga0395905_0016314 3300037471 Bacteria 7058
291 Ga0395905_0214420 3300037471 Bacteria 1803
292 Ga0395905_0317642 3300037471 Bacteria 1447
293 Ga0395905_0514689 3300037471 Bacteria 1097
294 Ga0395901_0000007 3300038443 Bacteria 497408
295 Ga0395901_0013125 3300038443 Bacteria 8409
296 Ga0395901_0084333 3300038443 Bacteria 3321
297 Ga0395901_0086637 3300038443 Bacteria 3275
298 Ga0400483_231819 3300039062 Bacteria 3760
299 Ga0436365_1145221 3300039437 Bacteria 3665
300 Ga0436365_1645730 3300039437 Bacteria 1319
301 Ga0436363_1269293 3300039450 Bacteria 1993
302 Ga0436363_1621007 3300039450 Bacteria 1629
303 Ga0436362_0176928 3300039453 Bacteria 3764
304 Ga0436362_1255974 3300039453 Bacteria 1125
305 Ga0439453_0015104 3300041408 Bacteria 1332
306 Ga0439435_0014277 3300042436 Bacteria 1961
307 Ga0451577_0480131 3300042876 Bacteria 1128
308 Ga0466969_0000677 3300044656 Bacteria 18515
309 Ga0466966_0055079 3300044684 Bacteria 2518
310 Ga0466961_0006897 3300044693 Bacteria 7226
311 Ga0453684_0027798 3300044712 Bacteria 8096
312 Ga0466971_0002075 3300044719 Bacteria 8493
313 Ga0466957_0006824 3300044842 Bacteria 6450
314 Ga0466957_0381957 3300044842 Bacteria 961
315 Ga0466959_0001525 3300045049 Bacteria 14225
316 Ga0466958_0077815 3300045836 Bacteria 2037
317 Ga0495627_000269 3300046453 Bacteria 52989
318 Ga0495590_0000439 3300046457 Bacteria 20685
319 Ga0495629_0216516 3300046459 Bacteria 1322
320 Ga0495638_0000347 3300046460 Bacteria 58280
321 Ga0495638_0000492 3300046460 Bacteria 47203
322 Ga0495651_0216004 3300046462 Bacteria 1331
323 Ga0495650_0000007 3300046471 Bacteria 718072
324 Ga0495585_0018627 3300046492 Bacteria 4004
325 Ga0495585_0167170 3300046492 Bacteria 1138
326 Ga0495607_0090228 3300046501 Bacteria 1662
327 Ga0495583_0000037 3300046506 Bacteria 244437
328 Ga0495583_0024449 3300046506 Bacteria 3035
329 Ga0495606_0005657 3300046507 Bacteria 11846
330 Ga0495610_0001339 3300046512 Bacteria 21852
331 Ga0495610_0002423 3300046512 Bacteria 15702
332 Ga0495610_0010802 3300046512 Bacteria 5642
333 Ga0495616_0000112 3300046513 Bacteria 71263
334 Ga0495631_0003776 3300046518 Bacteria 8240
335 Ga0495632_0023018 3300046519 Bacteria 3332
336 Ga0495637_0008992 3300046520 Bacteria 4884
337 Ga0495637_0021760 3300046520 Bacteria 2934
338 Ga0495648_0000105 3300046524 Bacteria 105677
339 Ga0495663_0000375 3300046525 Bacteria 16564
340 Ga0495642_0013236 3300046528 Bacteria 3188
341 Ga0495654_0000054 3300046530 Bacteria 144303
342 Ga0495654_0022462 3300046530 Bacteria 3276
343 Ga0495621_0146330 3300046539 Bacteria 927
344 Ga0495597_0043187 3300046542 Bacteria 2008
345 Ga0495597_0146615 3300046542 Bacteria 970
346 Ga0495633_0004403 3300046558 Bacteria 8971
347 Ga0495668_0000252 3300046616 Bacteria 76175
348 Ga0495668_0037195 3300046616 Bacteria 2724
349 Ga0495668_0063745 3300046616 Bacteria 2029
350 Ga0495668_0157644 3300046616 Bacteria 1243
351 Ga0495668_0185403 3300046616 Bacteria 1140
352 Ga0495611_0145282 3300046648 Bacteria 1107
353 Ga0495625_0000415 3300046660 Bacteria 64352
354 Ga0495625_0030568 3300046660 Bacteria 4016
355 Ga0495625_0070115 3300046660 Bacteria 2461
356 Ga0495625_0120956 3300046660 Bacteria 1781
357 Ga0495635_0091482 3300046663 Bacteria 2081
358 Ga0495661_0111076 3300046665 Bacteria 1528
359 Ga0495669_0050164 3300046684 Bacteria 1871
360 Ga0495613_0000964 3300046689 Bacteria 22013
361 Ga0495670_0075951 3300046691 Bacteria 1706
362 Ga0495589_0152905 3300046794 Bacteria 1101
363 Ga0495660_0046650 3300046810 Bacteria 2375
364 Ga0495660_0049606 3300046810 Bacteria 2290
365 Ga0495672_0007870 3300047320 Bacteria 7957
366 Ga0495672_0024032 3300047320 Bacteria 3933
367 Ga0495677_0047193 3300047445 Bacteria 1581
368 Ga0495679_026121 3300047446 Bacteria 1943
369 Ga0495673_0000402 3300047469 Bacteria 50662
370 Ga0495673_0001079 3300047469 Bacteria 23944
371 Ga0495681_0066352 3300047470 Bacteria 1647
372 Ga0495686_0000572 3300047472 Bacteria 52381
373 Ga0495686_0004508 3300047472 Bacteria 11427
374 Ga0495686_0029609 3300047472 Bacteria 3561
375 Ga0495602_0141478 3300048088 Bacteria 1904
376 Ga0496100_0168768 3300048903 Bacteria 1574
377 Ga0496102_0108686 3300048905 Bacteria 2583
378 Ga0496102_0146564 3300048905 Bacteria 2216
379 Ga0496103_0000643 3300048906 Bacteria 26435
380 Ga0496103_0234389 3300048906 Bacteria 1181
381 Ga0496103_0262147 3300048906 Bacteria 1112
382 Ga0496104_0000088 3300048907 Bacteria 88904
383 Ga0496105_0018470 3300048908 Bacteria 5605
384 Ga0496106_0221842 3300048909 Bacteria 1508
385 Ga0496106_0449602 3300048909 Bacteria 1035
386 Ga0496108_0353042 3300048911 Bacteria 1283
387 Ga0496109_0020688 3300048912 Bacteria 5812
388 Ga0496110_0001538 3300048913 Bacteria 16773
389 Ga0496110_0001919 3300048913 Bacteria 15380
390 Ga0496110_0063478 3300048913 Bacteria 3264
391 Ga0496110_0679637 3300048913 Bacteria 930
392 Ga0496111_0010025 3300048914 Bacteria 6339
393 Ga0496111_0013661 3300048914 Bacteria 5532
394 Ga0496112_0031566 3300048915 Bacteria 5140
395 Ga0496113_0002054 3300048916 Bacteria 11566
396 Ga0496113_0074106 3300048916 Bacteria 2595
397 Ga0496113_0639734 3300048916 Bacteria 851
398 Ga0496114_0750784 3300048917 Bacteria 853
399 Ga0496115_0004136 3300048918 Bacteria 10475
400 Ga0496115_0005514 3300048918 Bacteria 9210
401 Ga0496115_0088679 3300048918 Bacteria 2526
402 Ga0496115_0154511 3300048918 Bacteria 1895
403 Ga0496115_0184285 3300048918 Bacteria 1725
404 Ga0496116_0003801 3300048919 Bacteria 14758
405 Ga0496116_0011628 3300048919 Bacteria 7263
406 Ga0496117_0005240 3300048920 Bacteria 13757
407 Ga0496117_0043782 3300048920 Bacteria 3250
408 Ga0496118_0013510 3300048921 Bacteria 7715
409 Ga0496118_0020836 3300048921 Bacteria 5800
410 Ga0496119_0013609 3300048922 Bacteria 6459
411 Ga0496121_0000009 3300048924 Bacteria 836971
412 Ga0496121_0000802 3300048924 Bacteria 57240
413 Ga0496122_0001009 3300048925 Bacteria 49846
414 Ga0496123_0000529 3300048926 Bacteria 65639
415 Ga0496123_0120554 3300048926 Bacteria 1477
416 Ga0496124_0010701 3300048927 Bacteria 9254
417 Ga0496125_0004025 3300048928 Bacteria 17251
418 Ga0496126_0000898 3300048929 Bacteria 51758
419 Ga0501306_010800 3300049127 Bacteria 1155
420 Ga0501343_000260 3300049132 Bacteria 2864
421 Ga0501343_002377 3300049132 Bacteria 1337
422 Ga0501345_01131 3300049134 Bacteria 994
423 Ga0501305_000807 3300049161 Bacteria 2772
424 Ga0501305_005425 3300049161 Bacteria 1544
425 Ga0495678_009288 3300049459 Bacteria 4879
426 Ga0501300_006030 3300049523 Bacteria 1787
427 Ga0501312_000649 3300049528 Bacteria 2955
428 Ga0501312_007154 3300049528 Bacteria 1414
429 Ga0501313_025817 3300049529 Bacteria 745
430 Ga0501315_000169 3300049531 Bacteria 3753
431 Ga0501315_006190 3300049531 Bacteria 1324
432 Ga0501315_012383 3300049531 Bacteria 1054
433 Ga0501316_000492 3300049532 Bacteria 2747
434 Ga0501316_003134 3300049532 Bacteria 1585
435 Ga0501316_003754 3300049532 Bacteria 1493
436 Ga0501317_001797 3300049533 Bacteria 1922
437 Ga0501317_005610 3300049533 Bacteria 1351
438 Ga0501321_005095 3300049537 Bacteria 1286
439 Ga0501323_002103 3300049539 Bacteria 1890
440 Ga0501323_003065 3300049539 Bacteria 1678
441 Ga0501332_04546 3300049548 Bacteria 829
442 Ga0501334_05980 3300049550 Bacteria 812
443 Ga0501335_000078 3300049551 Bacteria 4264
444 Ga0501335_002159 3300049551 Bacteria 1580
445 Ga0501336_000175 3300049552 Bacteria 2707
446 Ga0501336_001783 3300049552 Bacteria 1326
447 Ga0501337_001125 3300049553 Bacteria 1480
448 Ga0501340_001753 3300049556 Bacteria 1202
449 Ga0501034_0003612 3300049571 Bacteria 17554
450 Ga0501034_0105274 3300049571 Bacteria 2814
451 Ga0501037_0004262 3300049573 Bacteria 10367
452 Ga0501037_0125228 3300049573 Bacteria 1845
453 Ga0501043_0067793 3300049579 Bacteria 2802
454 Ga0501047_0022683 3300049581 Bacteria 6026
455 Ga0501077_0078320 3300049593 Bacteria 2095
456 Ga0501224_005887 3300049664 Bacteria 1769
457 Ga0501235_029139 3300049669 Bacteria 1242
458 Ga0501235_044340 3300049669 Bacteria 1021
459 Ga0501238_003244 3300049671 Bacteria 1992
460 Ga0501249_051635 3300049679 Bacteria 944
461 Ga0501035_0012956 3300049822 Bacteria 7696
462 Ga0501044_0276978 3300049823 Bacteria 1612
463 Ga0501044_0287161 3300049823 Bacteria 1577
464 Ga0501212_014440 3300049851 Bacteria 1169
465 nmdc:mga03683_196481_c1 3300050489 Bacteria 924
466 nmdc:mga03n38_262152_c1 3300050490 Bacteria 916
467 nmdc:mga00v17_23834_c1 3300050491 Bacteria 3544
468 nmdc:mga0k408_11232_c1 3300050493 Bacteria 4869
469 nmdc:mga06z11_11792_c1 3300050494 Bacteria 3780
470 nmdc:mga06z11_19246_c1 3300050494 Bacteria 3135
471 nmdc:mga06z11_307_c1 3300050494 Bacteria 18616
472 nmdc:mga04h51_425_c1 3300050495 Bacteria 8670
473 nmdc:mga07m45_169047_c1 3300050496 Bacteria 1270
474 nmdc:mga05p37_48785_c1 3300050507 Bacteria 5206
475 nmdc:mga09592_298761_c1 3300050508 Bacteria 1396
476 nmdc:mga06r32_474880_c1 3300050510 Bacteria 1229
477 Ga0495595_0090252 3300053084 Bacteria 1469
478 Ga0500578_0000665 3300053086 Bacteria 41170
479 Ga0500643_008397 3300053087 Bacteria 4061
480 Ga0500643_021059 3300053087 Bacteria 2119
481 Ga0500643_035455 3300053087 Bacteria 1495
482 Ga0500644_0000004 3300053088 Bacteria 173652
483 Ga0500644_0000692 3300053088 Bacteria 12174
484 Ga0500644_0050571 3300053088 Bacteria 1423
485 Ga0500647_0024726 3300053091 Bacteria 2826
486 Ga0500641_0022665 3300053096 Bacteria 2408
487 Ga0500556_0017078 3300053104 Bacteria 2268
488 Ga0500556_0020396 3300053104 Bacteria 2120
489 Ga0500556_0039757 3300053104 Bacteria 1650
490 Ga0500562_000610 3300053108 Bacteria 8621
491 Ga0500562_003889 3300053108 Bacteria 3765
492 Ga0500572_000606 3300053111 Bacteria 12073
493 Ga0500592_000198 3300053116 Bacteria 11379
494 Ga0500594_0000160 3300053118 Bacteria 17428
495 Ga0500595_015303 3300053119 Bacteria 2883
496 Ga0500608_000026 3300053122 Bacteria 68633
497 Ga0500618_000043 3300053125 Bacteria 110342
498 Ga0500642_0186117 3300053130 Bacteria 970
499 Ga0500658_0012169 3300053134 Bacteria 3168
500 Ga0500559_0000008 3300053136 Bacteria 182182
501 Ga0500559_0000227 3300053136 Bacteria 44722
502 Ga0500559_0005346 3300053136 Bacteria 5914
503 Ga0500564_000017 3300053138 Bacteria 52534
504 Ga0500577_0014091 3300053142 Bacteria 2462
505 Ga0500616_0012088 3300053153 Bacteria 5065
506 Ga0500616_0039570 3300053153 Bacteria 2541
507 Ga0500619_002977 3300053154 Bacteria 3378
508 Ga0500622_0000047 3300053156 Bacteria 149427
509 Ga0500622_0003357 3300053156 Bacteria 10782
510 Ga0500622_0003947 3300053156 Bacteria 9581
511 Ga0500622_0019739 3300053156 Bacteria 3578
512 Ga0500627_0030053 3300053158 Bacteria 2271
513 Ga0500636_0044897 3300053177 Bacteria 2607
514 Ga0500645_008084 3300053730 Bacteria 3621
515 Ga0500645_009720 3300053730 Bacteria 3219
516 Ga0500645_080426 3300053730 Bacteria 930
517 Ga0500609_000721 3300053731 Bacteria 4970
518 Ga0501082_0420817 3300060353 Bacteria 1167
519 Ga0501082_0507006 3300060353 Bacteria 1055
520 2511124126 2510917020 Bacteria 5657507
521 2513590212 2513237087 Bacteria 5817514
522 2585149518 2582581279 Bacteria 4980720
523 2585154087 2582581280 Bacteria 5994497
524 2585197483 2582581293 Bacteria 5907401
525 2587916248 2585428106 Bacteria 5179711
526 2643747562 2643221545 Bacteria 5083237
527 2643778599 2643221552 Bacteria 5708754
528 2643883603 2643221574 Bacteria 2789653
529 2643925006 2643221583 Bacteria 5218014
530 2643931246 2643221584 Bacteria 5511711
531 2644226246 2643221640 Bacteria 5258820
532 2644235734 2643221642 Bacteria 5357871
533 2644354258 2643221663 Bacteria 3425771
534 2644509442 2643221691 Bacteria 5093099
535 2644551860 2643221699 Bacteria 5731501
536 2644553107 2643221699 Bacteria 5731501
537 2672335070 2671180330 Bacteria 5521719
538 2738812885 2738541295 Bacteria 5730091
539 2739231289 2738543010 Bacteria 5583595
540 2792460558 2791355048 Bacteria 5832535
541 2816863947 2816332186 Bacteria 5331395
542 2819538763 2818991435 Bacteria 5433759
543 2819648608 2818991454 Bacteria 5563326
544 2842685157 2842682962 Bacteria 5589973
545 2843747841 2843744320 Bacteria 5659202
546 2849140861 2849139964 Bacteria 5613304
547 2849560530 2849560528 Bacteria 5393480
548 2849577104 2849573788 Bacteria 5421256
549 2851153740 2851153111 Bacteria 5542585
550 2852674968 2852673933 Bacteria 3347676
551 2857506451 2857504554 Bacteria 5369913
552 2857584295 2857581216 Bacteria 5522813
553 2884964367 2884960567 Bacteria 5437054
554 2898329586 2898329390 Bacteria 5168154
555 2919414608 2919414237 Bacteria 5429133
556 2928511682 2928510474 Bacteria 4815308
557 2928533609 2928531327 Bacteria 5101314
558 2928975215 2928972540 Bacteria 3058286
559 2929210394 2929206907 Bacteria 5918291
560 2936365240 2936361878 Bacteria 5632809
561 2941487286 2941485952 Bacteria 3591484
562 2956901343 2956897341 Bacteria 5447711
563 2977241791 2977240413 Bacteria 3191065
564 2977258342 2977254563 Bacteria 4828420
565 2990279373 2990275345 Bacteria 4887158
566 3001893522 3001892409 Bacteria 6328293
567 3006831067 3006826541 Bacteria 4678913
568 3006970673 3006969106 Bacteria 4739423
569 3006974797 3006973921 Bacteria 4423788
570 8057634158 8057632132 Bacteria 4726859
571 Ga0496107_0000041
572 Ga0006562J51391_1006021
573 Ga0055526_1036160
574 Ga0055537_1002952
575 Ga0055524_1033508
576 Ga0055536_1000478
577 Ga0055536_1005309
578 Ga0055536_1006045
579 Ga0055528_1008440
580 Ga0055528_1021094
581 Ga0055530_10014825
582 Ga0055530_10017903
583 Ga0055531_10001093
584 Ga0055531_10003069
585 Ga0055531_10003487
586 Ga0065165_1001045
587 Ga0065715_10185097
588 Ga0070658_10000001
589 Ga0070658_10004249
590 Ga0070670_100216330
591 Ga0070680_100000264
592 Ga0070660_100001280
593 Ga0070660_100639238
594 Ga0070689_100691165
595 Ga0070668_100003297
596 Ga0070668_100021693
597 Ga0070668_100093507
598 Ga0070668_100371606
599 Ga0070668_100426046
600 Ga0070669_100018715
601 Ga0070671_100000479
602 Ga0070671_100019977
603 Ga0070688_100018458
604 Ga0070659_100015232
605 Ga0070667_100002158
606 Ga0070667_100021993
607 Ga0070667_100076986
608 Ga0070713_100085475
609 Ga0070710_10115372
610 Ga0070711_100369595
611 Ga0070663_100468703
612 Ga0070678_100237023
613 Ga0070662_100489754
614 Ga0070681_10000213
615 Ga0070679_100242218
616 Ga0068853_100178507
617 Ga0070693_100291452
618 Ga0070665_100000940
619 Ga0070665_100001410
620 Ga0070665_100010051
621 Ga0068855_100001693
622 Ga0068855_100214207
623 Ga0070664_100449815
624 Ga0068856_100056115
625 Ga0068856_100201468
626 Ga0068856_100990431
627 Ga0068859_100000999
628 Ga0068859_100469516
629 Ga0068864_100003837
630 Ga0068864_100016985
631 Ga0068864_100168894
632 Ga0068864_100620802
633 Ga0068864_100797002
634 Ga0068861_100318426
635 Ga0068863_100006162
636 Ga0068863_100007149
637 Ga0068858_100014500
638 Ga0068858_100054499
639 Ga0068858_100064743
640 Ga0068860_100001370
641 Ga0068860_100012979
642 Ga0068860_100111046
643 Ga0068862_100004692
644 Ga0068862_100146975
645 Ga0068862_100420817
646 Ga0081455_10094409
647 Ga0081455_10184193
648 Ga0075365_10002352
649 Ga0075368_10000471
650 Ga0075363_100008842
651 Ga0075363_100072890
652 Ga0070712_100099696
653 Ga0075362_10035447
654 Ga0075367_10020160
655 Ga0075369_10010780
656 Ga0075366_10037719
657 Ga0075370_10075248
658 Ga0075428_100032742
659 Ga0075431_100021443
660 Ga0097620_100000999
661 Ga0097620_100469435
662 Ga0099795_10000521
663 Ga0105244_10066915
664 Ga0105240_10003426
665 Ga0105240_10099371
666 Ga0105240_10399768
667 Ga0105245_10039365
668 Ga0105245_10131745
669 Ga0114129_10063020
670 Ga0105242_10120391
671 Ga0105248_10000001
672 Ga0105248_10000685
673 Ga0105248_10012881
674 Ga0105248_10044544
675 Ga0105248_10070680
676 Ga0105248_10201991
677 Ga0105248_10604118
678 Ga0105238_10020646
679 Ga0105238_10331880
680 Ga0105249_10000818
681 Ga0105249_10384626
682 Ga0099796_10000086
683 Ga0099796_10107096
684 Ga0157371_10107495
685 Ga0157369_10023976
686 Ga0163162_10018748
687 Ga0163162_10202233
688 Ga0163162_10436117
689 Ga0163163_10014204
690 Ga0163163_10070984
691 Ga0163163_10562593
692 Ga0157380_10035915
693 Ga0157380_10129517
694 Ga0157380_10275785
695 Ga0157379_10064313
696 Ga0157379_10305330
697 Ga0213874_10027254
698 Ga0224572_1003965
699 Ga0224572_1021452
700 Ga0228598_1046721
701 Ga0209233_1024480
702 Ga0209565_1000127
703 Ga0209675_1010000
704 Ga0209676_1000046
705 Ga0209676_1000336
706 Ga0209676_1000476
707 Ga0209676_1001278
708 Ga0209025_1028141
709 Ga0209564_1005120
710 Ga0209564_1023284
711 Ga0209758_1000450
712 Ga0209758_1008106
713 Ga0209050_1000506
714 Ga0209050_1007979
715 Ga0209050_1018460
716 Ga0209050_1019830
717 Ga0209256_1016565
718 Ga0209256_1019956
719 Ga0209051_1057178
720 Ga0209257_1000159
721 Ga0209257_1000481
722 Ga0209257_1008528
723 Ga0209257_1028172
724 Ga0207680_10035160
725 Ga0207705_10000002
726 Ga0207705_10024662
727 Ga0207705_10253309
728 Ga0207695_10003143
729 Ga0207695_10070156
730 Ga0207695_10453733
731 Ga0207671_10168372
732 Ga0207693_10063121
733 Ga0207663_10054697
734 Ga0207660_10003027
735 Ga0207657_10003354
736 Ga0207657_10528620
737 Ga0207652_10006822
738 Ga0207652_10115724
739 Ga0207681_10009686
740 Ga0207694_10032403
741 Ga0207694_10410747
742 Ga0207650_10000201
743 Ga0207650_10122435
744 Ga0207687_10079794
745 Ga0207700_10063843
746 Ga0207644_10004836
747 Ga0207644_10089321
748 Ga0207644_10105354
749 Ga0207690_10003860
750 Ga0207706_10062708
751 Ga0207706_10494750
752 Ga0207711_10000002
753 Ga0207711_10001954
754 Ga0207711_10006432
755 Ga0207711_10013682
756 Ga0207711_10025045
757 Ga0207711_10203374
758 Ga0207711_10325958
759 Ga0207679_10008351
760 Ga0207679_10070393
761 Ga0207667_10029154
762 Ga0207667_10357388
763 Ga0207651_10043707
764 Ga0207651_10229855
765 Ga0207712_10118548
766 Ga0207712_10386918
767 Ga0207668_10000007
768 Ga0207668_10000247
769 Ga0207668_10025099
770 Ga0207668_10356001
771 Ga0207658_10000052
772 Ga0207658_10000985
773 Ga0207658_10001933
774 Ga0207658_10013527
775 Ga0207658_10036009
776 Ga0207658_10640297
777 Ga0207703_10002468
778 Ga0207703_10049425
779 Ga0207678_10324071
780 Ga0207702_10023453
781 Ga0207702_10098159
782 Ga0207641_10087617
783 Ga0207641_10267706
784 Ga0207676_10001242
785 Ga0207676_10012779
786 Ga0207676_10094198
787 Ga0207676_10186538
788 Ga0207676_10334476
789 Ga0207675_100139166
790 Ga0207675_100154745
791 Ga0207675_100923487
792 Ga0207683_10099258
793 Ga0207698_10023739
794 Ga0209813_10000616
795 Ga0209974_10034907
796 Ga0209974_10039696
797 Ga0268266_10001205
798 Ga0268266_10010417
799 Ga0268266_10011789
800 Ga0268266_10581886
801 Ga0268265_10002350
802 Ga0268265_10091103
803 Ga0268265_10134907
804 Ga0268264_10000684
805 Ga0268264_10018738
806 Ga0268264_10210953
807 Ga0268264_10236140
808 Ga0268264_10638747
809 Ga0307517_10001029
810 Ga0307517_10115170
811 Ga0307515_10066696
812 Ga0307515_10067676
813 Ga0307515_10315002
814 Ga0265773_1000596
815 Ga0265327_10000220
816 Ga0265327_10152209
817 Ga0307513_10000082
818 Ga0307513_10001006
819 Ga0307513_10002226
820 Ga0307408_100282071
821 Ga0265313_10008177
822 Ga0307405_10030398
823 Ga0307413_10021312
824 Ga0307413_10060092
825 Ga0307413_10405389
826 Ga0307410_10070753
827 Ga0307410_10213633
828 Ga0307406_10006321
829 Ga0307407_10097113
830 Ga0307407_10248898
831 Ga0307412_10079699
832 Ga0307409_100071151
833 Ga0307409_100103587
834 Ga0307409_100105165
835 Ga0307409_100155825
836 Ga0307416_100208507
837 Ga0307416_100355940
838 Ga0307416_100689512
839 Ga0307414_10047374
840 Ga0307414_10061855
841 Ga0307414_10162131
842 Ga0307414_10205516
843 Ga0307411_10046571
844 Ga0307411_10160596
845 Ga0307415_100078895
846 Ga0373924_0031367
847 Ga0373931_0022704
848 Ga0373933_0090001
849 Ga0373947_0195926
850 Ga0373937_0147549
851 Ga0373925_0053200
852 Ga0395899_0006527
853 Ga0395899_0042865
854 Ga0395900_0002429
855 Ga0395900_0459504
856 Ga0395900_0568185
857 Ga0395898_0008060
858 Ga0395898_0227526
859 Ga0395905_0007649
860 Ga0395905_0016314
861 Ga0395905_0214420
862 Ga0395905_0317642
863 Ga0395905_0514689
864 Ga0395901_0000007
865 Ga0395901_0013125
866 Ga0395901_0084333
867 Ga0395901_0086637
868 Ga0400483_231819
869 Ga0436365_1145221
870 Ga0436365_1645730
871 Ga0436363_1269293
872 Ga0436363_1621007
873 Ga0436362_0176928
874 Ga0436362_1255974
875 Ga0439453_0015104
876 Ga0439435_0014277
877 Ga0451577_0480131
878 Ga0466969_0000677
879 Ga0466966_0055079
880 Ga0466961_0006897
881 Ga0453684_0027798
882 Ga0466971_0002075
883 Ga0466957_0006824
884 Ga0466957_0381957
885 Ga0466959_0001525
886 Ga0466958_0077815
887 Ga0495627_000269
888 Ga0495590_0000439
889 Ga0495629_0216516
890 Ga0495638_0000347
891 Ga0495638_0000492
892 Ga0495651_0216004
893 Ga0495650_0000007
894 Ga0495585_0018627
895 Ga0495585_0167170
896 Ga0495607_0090228
897 Ga0495583_0000037
898 Ga0495583_0024449
899 Ga0495606_0005657
900 Ga0495610_0001339
901 Ga0495610_0002423
902 Ga0495610_0010802
903 Ga0495616_0000112
904 Ga0495631_0003776
905 Ga0495632_0023018
906 Ga0495637_0008992
907 Ga0495637_0021760
908 Ga0495648_0000105
909 Ga0495663_0000375
910 Ga0495642_0013236
911 Ga0495654_0000054
912 Ga0495654_0022462
913 Ga0495621_0146330
914 Ga0495597_0043187
915 Ga0495597_0146615
916 Ga0495633_0004403
917 Ga0495668_0000252
918 Ga0495668_0037195
919 Ga0495668_0063745
920 Ga0495668_0157644
921 Ga0495668_0185403
922 Ga0495611_0145282
923 Ga0495625_0000415
924 Ga0495625_0030568
925 Ga0495625_0070115
926 Ga0495625_0120956
927 Ga0495635_0091482
928 Ga0495661_0111076
929 Ga0495669_0050164
930 Ga0495613_0000964
931 Ga0495670_0075951
932 Ga0495589_0152905
933 Ga0495660_0046650
934 Ga0495660_0049606
935 Ga0495672_0007870
936 Ga0495672_0024032
937 Ga0495677_0047193
938 Ga0495679_026121
939 Ga0495673_0000402
940 Ga0495673_0001079
941 Ga0495681_0066352
942 Ga0495686_0000572
943 Ga0495686_0004508
944 Ga0495686_0029609
945 Ga0495602_0141478
946 Ga0496100_0168768
947 Ga0496102_0108686
948 Ga0496102_0146564
949 Ga0496103_0000643
950 Ga0496103_0234389
951 Ga0496103_0262147
952 Ga0496104_0000088
953 Ga0496105_0018470
954 Ga0496106_0221842
955 Ga0496106_0449602
956 Ga0496108_0353042
957 Ga0496109_0020688
958 Ga0496110_0001538
959 Ga0496110_0001919
960 Ga0496110_0063478
961 Ga0496110_0679637
962 Ga0496111_0010025
963 Ga0496111_0013661
964 Ga0496112_0031566
965 Ga0496113_0002054
966 Ga0496113_0074106
967 Ga0496113_0639734
968 Ga0496114_0750784
969 Ga0496115_0004136
970 Ga0496115_0005514
971 Ga0496115_0088679
972 Ga0496115_0154511
973 Ga0496115_0184285
974 Ga0496116_0003801
975 Ga0496116_0011628
976 Ga0496117_0005240
977 Ga0496117_0043782
978 Ga0496118_0013510
979 Ga0496118_0020836
980 Ga0496119_0013609
981 Ga0496121_0000009
982 Ga0496121_0000802
983 Ga0496122_0001009
984 Ga0496123_0000529
985 Ga0496123_0120554
986 Ga0496124_0010701
987 Ga0496125_0004025
988 Ga0496126_0000898
989 Ga0501306_010800
990 Ga0501343_000260
991 Ga0501343_002377
992 Ga0501345_01131
993 Ga0501305_000807
994 Ga0501305_005425
995 Ga0495678_009288
996 Ga0501300_006030
997 Ga0501312_000649
998 Ga0501312_007154
999 Ga0501313_025817
1000 Ga0501315_000169
1001 Ga0501315_006190
1002 Ga0501315_012383
1003 Ga0501316_000492
1004 Ga0501316_003134
1005 Ga0501316_003754
1006 Ga0501317_001797
1007 Ga0501317_005610
1008 Ga0501321_005095
1009 Ga0501323_002103
1010 Ga0501323_003065
1011 Ga0501332_04546
1012 Ga0501334_05980
1013 Ga0501335_000078
1014 Ga0501335_002159
1015 Ga0501336_000175
1016 Ga0501336_001783
1017 Ga0501337_001125
1018 Ga0501340_001753
1019 Ga0501034_0003612
1020 Ga0501034_0105274
1021 Ga0501037_0004262
1022 Ga0501037_0125228
1023 Ga0501043_0067793
1024 Ga0501047_0022683
1025 Ga0501077_0078320
1026 Ga0501224_005887
1027 Ga0501235_029139
1028 Ga0501235_044340
1029 Ga0501238_003244
1030 Ga0501249_051635
1031 Ga0501035_0012956
1032 Ga0501044_0276978
1033 Ga0501044_0287161
1034 Ga0501212_014440
1035 nmdc:mga03683_196481_c1
1036 nmdc:mga03n38_262152_c1
1037 nmdc:mga00v17_23834_c1
1038 nmdc:mga0k408_11232_c1
1039 nmdc:mga06z11_11792_c1
1040 nmdc:mga06z11_19246_c1
1041 nmdc:mga06z11_307_c1
1042 nmdc:mga04h51_425_c1
1043 nmdc:mga07m45_169047_c1
1044 nmdc:mga05p37_48785_c1
1045 nmdc:mga09592_298761_c1
1046 nmdc:mga06r32_474880_c1
1047 Ga0495595_0090252
1048 Ga0500578_0000665
1049 Ga0500643_008397
1050 Ga0500643_021059
1051 Ga0500643_035455
1052 Ga0500644_0000004
1053 Ga0500644_0000692
1054 Ga0500644_0050571
1055 Ga0500647_0024726
1056 Ga0500641_0022665
1057 Ga0500556_0017078
1058 Ga0500556_0020396
1059 Ga0500556_0039757
1060 Ga0500562_000610
1061 Ga0500562_003889
1062 Ga0500572_000606
1063 Ga0500592_000198
1064 Ga0500594_0000160
1065 Ga0500595_015303
1066 Ga0500608_000026
1067 Ga0500618_000043
1068 Ga0500642_0186117
1069 Ga0500658_0012169
1070 Ga0500559_0000008
1071 Ga0500559_0000227
1072 Ga0500559_0005346
1073 Ga0500564_000017
1074 Ga0500577_0014091
1075 Ga0500616_0012088
1076 Ga0500616_0039570
1077 Ga0500619_002977
1078 Ga0500622_0000047
1079 Ga0500622_0003357
1080 Ga0500622_0003947
1081 Ga0500622_0019739
1082 Ga0500627_0030053
1083 Ga0500636_0044897
1084 Ga0500645_008084
1085 Ga0500645_009720
1086 Ga0500645_080426
1087 Ga0500609_000721
1088 Ga0501082_0420817
1089 Ga0501082_0507006
1090 2511124126
1091 2513590212
1092 2585149518
1093 2585154087
1094 2585197483
1095 2587916248
1096 2643747562
1097 2643778599
1098 2643883603
1099 2643925006
1100 2643931246
1101 2644226246
1102 2644235734
1103 2644354258
1104 2644509442
1105 2644551860
1106 2644553107
1107 2672335070
1108 2738812885
1109 2739231289
1110 2792460558
1111 2816863947
1112 2819538763
1113 2819648608
1114 2842685157
1115 2843747841
1116 2849140861
1117 2849560530
1118 2849577104
1119 2851153740
1120 2852674968
1121 2857506451
1122 2857584295
1123 2884964367
1124 2898329586
1125 2919414608
1126 2928511682
1127 2928533609
1128 2928975215
1129 2929210394
1130 2936365240
1131 2941487286
1132 2956901343
1133 2977241791
1134 2977258342
1135 2990279373
1136 3001893522
1137 3006831067
1138 3006970673
1139 3006974797
1140 8057634158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

52

244

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

289

0.97

PF08659

KR

KR domain

52

233

0.88

PF23441

46

291

0.82

PF13460

NAD_binding_10

NAD(P)H-binding

58

273

0.75

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

54

226

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9955 6 247
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9943 1 247
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9935 1 247
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.991 1 247
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.991 4 247
ID Description Score Start End Superfamily
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9941 6 247 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9939 82 247 3.40.50.720
af_A0A1D6J5I0_53_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9886 3 247 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9827 3 247 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.982 6 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A850V1U6-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 1 166 247
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9986 85 247 GO:0016491
AF-A0A3M1YKC1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9924 1 247 GO:0004316
GO:0006633
GO:0051287
AF-A0A3S8V3A3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9912 99 246 GO:0016491
AF-A0A371GW42-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9898 3 247 GO:0004316
GO:0006633
GO:0009507
GO:0051287

Map