F464902

General Info

Members Datasets Scaffolds Average Seq Length
571 311 1142 85

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1116801|Ga0006562J51391_11168012
Length 102
Sequence MTTHYMRKDATLTKAAFMPPITIYTTSWCPYCAAAKSLLTRKGAAFEEIDVESGPGLRQQMTARAGGRTSVPQIFIGERHVGGSDDLHALDARGELDPLLAA

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
278 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
310 2818991467 Bosea vestrisii 3192 Isolate Unclassified
311 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.7
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.78
Nodule 0
Rhizoplane 4.73
Rhizosphere 77.93
Stem 0
Stem Tuber 0
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1116801 3300003578 Bacteria 1053
2 RicEn_FSXC46108_g7 2010549000 Bacteria 741
3 JGI24740J21852_10071045 3300001979 Bacteria 933
4 JGI24737J22298_10111037 3300001990 Bacteria 811
5 JGI24735J21928_10031045 3300002067 Bacteria 1584
6 JGI25164J39214_1023140 3300002772 Bacteria 538
7 JGI25159J45721_1010820 3300002987 Bacteria 2288
8 JGI25151J46595_10000036 3300003187 Bacteria 188770
9 JGI25151J46595_10000209 3300003187 Bacteria 71715
10 JGI25151J46595_10000244 3300003187 Bacteria 63724
11 rootH2_10049313 3300003320 Bacteria 1763
12 rootH1_10068225 3300003323 Bacteria 2001
13 rootH1_10186067 3300003323 Bacteria 1893
14 Ga0006562J51391_1116802 3300003578 Bacteria 980
15 Ga0055526_1000391 3300003771 Bacteria 35449
16 Ga0055524_1000014 3300003775 Bacteria 259417
17 Ga0055524_1046451 3300003775 Bacteria 1032
18 Ga0055543_1012411 3300004625 Bacteria 1714
19 Ga0065165_1000048 3300005262 Bacteria 196539
20 Ga0070658_10002972 3300005327 Bacteria 14045
21 Ga0070658_10012683 3300005327 Bacteria 6760
22 Ga0070658_10054268 3300005327 Bacteria 3254
23 Ga0070683_100091808 3300005329 Bacteria 2852
24 Ga0070690_100839352 3300005330 Bacteria 715
25 Ga0070670_100042450 3300005331 Bacteria 3909
26 Ga0070670_101200591 3300005331 Bacteria 693
27 Ga0068869_100024349 3300005334 Bacteria 4193
28 Ga0068869_100317725 3300005334 Bacteria 1262
29 Ga0068869_100338409 3300005334 Bacteria 1224
30 Ga0070680_100004506 3300005336 Bacteria 10493
31 Ga0070680_100035168 3300005336 Bacteria 4043
32 Ga0070680_100706645 3300005336 Bacteria 867
33 Ga0070682_100234068 3300005337 Bacteria 1315
34 Ga0068868_100111377 3300005338 Bacteria 2225
35 Ga0068868_101181200 3300005338 Bacteria 707
36 Ga0070660_100014765 3300005339 Bacteria 5635
37 Ga0070660_100038237 3300005339 Bacteria 3642
38 Ga0070660_100077302 3300005339 Bacteria 2608
39 Ga0070689_100003662 3300005340 Bacteria 10249
40 Ga0070689_100082434 3300005340 Bacteria 2526
41 Ga0070689_100830747 3300005340 Bacteria 814
42 Ga0070691_10126737 3300005341 Bacteria 1290
43 Ga0070691_10237256 3300005341 Bacteria 973
44 Ga0070687_100094799 3300005343 Bacteria 1658
45 Ga0070661_100001446 3300005344 Bacteria 16504
46 Ga0070661_100003809 3300005344 Bacteria 10393
47 Ga0070661_100726596 3300005344 Bacteria 810
48 Ga0070692_10043927 3300005345 Bacteria 2300
49 Ga0070668_100239682 3300005347 Bacteria 1502
50 Ga0070671_100626679 3300005355 Bacteria 930
51 Ga0070673_102020586 3300005364 Bacteria 547
52 Ga0070688_100095192 3300005365 Bacteria 1954
53 Ga0070688_100306638 3300005365 Bacteria 1149
54 Ga0070659_100007639 3300005366 Bacteria 7860
55 Ga0070659_100009861 3300005366 Bacteria 7024
56 Ga0070659_100719674 3300005366 Bacteria 864
57 Ga0070703_10000544 3300005406 Bacteria 13973
58 Ga0070709_10312267 3300005434 Bacteria 1151
59 Ga0070714_101248437 3300005435 Bacteria 725
60 Ga0070714_101284733 3300005435 Unclassified 714
61 Ga0070710_10150659 3300005437 Bacteria 1434
62 Ga0070710_11398756 3300005437 Bacteria 523
63 Ga0070701_10009637 3300005438 Bacteria 4237
64 Ga0070701_10021510 3300005438 Bacteria 3080
65 Ga0070701_10593582 3300005438 Bacteria 732
66 Ga0070705_100000469 3300005440 Bacteria 23189
67 Ga0070705_100010171 3300005440 Bacteria 4700
68 Ga0070705_100372448 3300005440 Unclassified 1048
69 Ga0070700_100001016 3300005441 Bacteria 13876
70 Ga0070700_100449529 3300005441 Bacteria 980
71 Ga0070694_100009240 3300005444 Bacteria 6048
72 Ga0070694_100017048 3300005444 Bacteria 4585
73 Ga0070694_100566180 3300005444 Unclassified 911
74 Ga0070708_100017602 3300005445 Bacteria 5966
75 Ga0070663_100002136 3300005455 Bacteria 11066
76 Ga0070663_100077543 3300005455 Bacteria 2433
77 Ga0070663_100734154 3300005455 Bacteria 842
78 Ga0070678_100756634 3300005456 Bacteria 879
79 Ga0070678_101594405 3300005456 Bacteria 613
80 Ga0070662_100094839 3300005457 Bacteria 2247
81 Ga0070681_10087753 3300005458 Bacteria 3063
82 Ga0068867_101356962 3300005459 Bacteria 658
83 Ga0070707_100711881 3300005468 Bacteria 967
84 Ga0070698_100170281 3300005471 Bacteria 2119
85 Ga0070699_100001512 3300005518 Bacteria 21269
86 Ga0070679_100033302 3300005530 Bacteria 5102
87 Ga0070679_101720822 3300005530 Bacteria 575
88 Ga0070679_101808511 3300005530 Bacteria 559
89 Ga0070697_100007219 3300005536 Bacteria 8642
90 Ga0068853_100005627 3300005539 Bacteria 9843
91 Ga0068853_100056663 3300005539 Bacteria 3381
92 Ga0068853_100169938 3300005539 Bacteria 1972
93 Ga0068853_100286023 3300005539 Bacteria 1521
94 Ga0068853_101049708 3300005539 Bacteria 785
95 Ga0068853_101346431 3300005539 Bacteria 690
96 Ga0068853_101443337 3300005539 Bacteria 666
97 Ga0070672_100122633 3300005543 Bacteria 2129
98 Ga0070672_101747406 3300005543 Unclassified 559
99 Ga0070686_100010980 3300005544 Bacteria 5128
100 Ga0070695_100003955 3300005545 Bacteria 8651
101 Ga0070695_100114795 3300005545 Bacteria 1834
102 Ga0070695_101718818 3300005545 Bacteria 525
103 Ga0070696_100000758 3300005546 Bacteria 20714
104 Ga0070696_100035460 3300005546 Bacteria 3435
105 Ga0070693_100006856 3300005547 Bacteria 5536
106 Ga0070693_100874009 3300005547 Bacteria 672
107 Ga0070693_101152296 3300005547 Bacteria 593
108 Ga0070665_100000668 3300005548 Bacteria 46152
109 Ga0070665_100303019 3300005548 Bacteria 1601
110 Ga0070665_100691501 3300005548 Bacteria 1033
111 Ga0070665_101152205 3300005548 Bacteria 786
112 Ga0070704_100084359 3300005549 Bacteria 2348
113 Ga0070704_100191593 3300005549 Bacteria 1644
114 Ga0068855_100040013 3300005563 Bacteria 5564
115 Ga0068855_100139707 3300005563 Bacteria 2762
116 Ga0068855_101045323 3300005563 Bacteria 856
117 Ga0068855_101504453 3300005563 Bacteria 691
118 Ga0070664_100029550 3300005564 Bacteria 4569
119 Ga0070664_100091931 3300005564 Bacteria 2627
120 Ga0070664_100479923 3300005564 Bacteria 1144
121 Ga0070664_100738193 3300005564 Unclassified 919
122 Ga0070664_100980440 3300005564 Bacteria 794
123 Ga0068857_100046014 3300005577 Bacteria 3871
124 Ga0068857_100051801 3300005577 Bacteria 3643
125 Ga0068854_100002452 3300005578 Bacteria 11478
126 Ga0068854_100009277 3300005578 Bacteria 6348
127 Ga0068854_100351221 3300005578 Bacteria 1207
128 Ga0068854_100609323 3300005578 Bacteria 933
129 Ga0068854_101662108 3300005578 Bacteria 583
130 Ga0068856_100057421 3300005614 Bacteria 3842
131 Ga0068856_100146752 3300005614 Bacteria 2367
132 Ga0068856_100676225 3300005614 Bacteria 1053
133 Ga0070702_100033166 3300005615 Bacteria 2838
134 Ga0070702_100045198 3300005615 Bacteria 2490
135 Ga0070702_100049916 3300005615 Bacteria 2388
136 Ga0070702_100501587 3300005615 Bacteria 891
137 Ga0068852_100002904 3300005616 Bacteria 11896
138 Ga0068852_100057323 3300005616 Bacteria 3370
139 Ga0068852_100690160 3300005616 Bacteria 1030
140 Ga0068852_101653188 3300005616 Bacteria 663
141 Ga0068852_101717079 3300005616 Bacteria 650
142 Ga0068859_100004727 3300005617 Bacteria 13833
143 Ga0068859_100150573 3300005617 Bacteria 2402
144 Ga0068859_100660800 3300005617 Bacteria 1137
145 Ga0068864_100035916 3300005618 Bacteria 4221
146 Ga0068866_10873769 3300005718 Bacteria 630
147 Ga0068861_100032032 3300005719 Bacteria 3867
148 Ga0068861_100104002 3300005719 Bacteria 2265
149 Ga0068861_100625780 3300005719 Bacteria 991
150 Ga0068861_100878416 3300005719 Bacteria 847
151 Ga0068851_10209167 3300005834 Unclassified 1092
152 Ga0068870_10265125 3300005840 Bacteria 1071
153 Ga0068870_10313605 3300005840 Bacteria 994
154 Ga0068863_100159468 3300005841 Bacteria 2161
155 Ga0068863_100918796 3300005841 Bacteria 876
156 Ga0068858_100095627 3300005842 Bacteria 2768
157 Ga0068858_101669731 3300005842 Bacteria 629
158 Ga0068860_100002721 3300005843 Bacteria 18394
159 Ga0068860_100128743 3300005843 Bacteria 2427
160 Ga0068862_100005737 3300005844 Bacteria 10362
161 Ga0068862_100129258 3300005844 Bacteria 2233
162 Ga0075365_10121704 3300006038 Bacteria 1800
163 Ga0075365_10288378 3300006038 Bacteria 1155
164 Ga0075365_10449808 3300006038 Bacteria 910
165 Ga0075365_11019837 3300006038 Bacteria 583
166 Ga0075368_10122252 3300006042 Bacteria 1079
167 Ga0075368_10148228 3300006042 Bacteria 980
168 Ga0075363_100035222 3300006048 Bacteria 2618
169 Ga0075363_100060548 3300006048 Bacteria 2038
170 Ga0075363_100258766 3300006048 Bacteria 1003
171 Ga0075364_10018304 3300006051 Bacteria 4383
172 Ga0075364_11235645 3300006051 Bacteria 506
173 Ga0075362_10020090 3300006177 Bacteria 2787
174 Ga0075367_10015133 3300006178 Bacteria 4187
175 Ga0075367_10048455 3300006178 Bacteria 2503
176 Ga0075367_10053275 3300006178 Bacteria 2397
177 Ga0075367_10085311 3300006178 Bacteria 1916
178 Ga0075367_10732017 3300006178 Bacteria 629
179 Ga0075366_10152369 3300006195 Bacteria 1400
180 Ga0097621_100608233 3300006237 Bacteria 1000
181 Ga0075370_10032759 3300006353 Bacteria 2906
182 Ga0075370_10400689 3300006353 Bacteria 823
183 Ga0068871_100436607 3300006358 Bacteria 1171
184 Ga0075428_100355564 3300006844 Bacteria 1572
185 Ga0075430_100013000 3300006846 Bacteria 7095
186 Ga0075431_100000778 3300006847 Bacteria 27727
187 Ga0068865_100287560 3300006881 Bacteria 1311
188 Ga0097620_100004727 3300006931 Bacteria 13833
189 Ga0097620_100150574 3300006931 Bacteria 2402
190 Ga0097620_100660809 3300006931 Bacteria 1137
191 Ga0105240_10067644 3300009093 Bacteria 4428
192 Ga0105240_10342086 3300009093 Bacteria 1699
193 Ga0111539_10458451 3300009094 Bacteria 1485
194 Ga0111539_12038058 3300009094 Bacteria 666
195 Ga0105245_10861933 3300009098 Bacteria 946
196 Ga0114129_10158333 3300009147 Bacteria 3096
197 Ga0114129_11201796 3300009147 Bacteria 944
198 Ga0105243_10188062 3300009148 Bacteria 1801
199 Ga0105243_11135691 3300009148 Bacteria 791
200 Ga0105241_10480444 3300009174 Bacteria 1104
201 Ga0105241_11243835 3300009174 Bacteria 707
202 Ga0105242_11022957 3300009176 Bacteria 835
203 Ga0105237_10332670 3300009545 Bacteria 1523
204 Ga0105237_11405005 3300009545 Bacteria 704
205 Ga0105238_10018169 3300009551 Bacteria 7150
206 Ga0105238_10020597 3300009551 Bacteria 6717
207 Ga0105238_10095570 3300009551 Bacteria 2958
208 Ga0105238_10217774 3300009551 Bacteria 1885
209 Ga0105249_10007251 3300009553 Bacteria 9671
210 Ga0105249_11069727 3300009553 Bacteria 876
211 Ga0105239_10066045 3300010375 Bacteria 3975
212 Ga0105239_10126663 3300010375 Bacteria 2839
213 Ga0105239_10830797 3300010375 Bacteria 1059
214 Ga0105239_13167181 3300010375 Bacteria 536
215 Ga0105246_10043807 3300011119 Bacteria 3038
216 Ga0105246_10414033 3300011119 Bacteria 1123
217 Ga0157373_10782489 3300013100 Bacteria 703
218 Ga0157371_10234314 3300013102 Bacteria 1320
219 Ga0157371_10269420 3300013102 Bacteria 1229
220 Ga0157370_10018933 3300013104 Bacteria 6923
221 Ga0157370_10171579 3300013104 Bacteria 2016
222 Ga0157370_10607355 3300013104 Bacteria 1001
223 Ga0157369_10026540 3300013105 Bacteria 6424
224 Ga0157369_10304807 3300013105 Bacteria 1657
225 Ga0171462_1007 3300013250 Bacteria 417698
226 Ga0157374_10999309 3300013296 Bacteria 856
227 Ga0157378_10060959 3300013297 Bacteria 3366
228 Ga0157372_10012923 3300013307 Bacteria 8900
229 Ga0157372_11886984 3300013307 Bacteria 687
230 Ga0157375_10170795 3300013308 Bacteria 2322
231 Ga0157375_11120976 3300013308 Bacteria 921
232 Ga0163163_10021474 3300014325 Bacteria 6094
233 Ga0163163_10646615 3300014325 Bacteria 1121
234 Ga0163163_10683327 3300014325 Bacteria 1090
235 Ga0163163_11848613 3300014325 Bacteria 664
236 Ga0163163_12172553 3300014325 Bacteria 614
237 Ga0157380_10465612 3300014326 Bacteria 1218
238 Ga0157380_10636774 3300014326 Bacteria 1061
239 Ga0157380_11019108 3300014326 Bacteria 862
240 Ga0157380_11267783 3300014326 Bacteria 783
241 Ga0182008_10111879 3300014497 Bacteria 1353
242 Ga0157379_10434904 3300014968 Bacteria 1209
243 Ga0157376_10469269 3300014969 Bacteria 1231
244 Ga0206354_11195405 3300020081 Bacteria 841
245 Ga0207427_103217 3300025231 Bacteria 3586
246 Ga0209233_1000572 3300025261 Bacteria 19687
247 Ga0209130_1000071 3300025284 Bacteria 178273
248 Ga0209675_1000633 3300025291 Bacteria 25016
249 Ga0209025_1000017 3300025294 Bacteria 768983
250 Ga0209025_1042360 3300025294 Bacteria 1936
251 Ga0209025_1097529 3300025294 Bacteria 941
252 Ga0209564_1000082 3300025295 Bacteria 261494
253 Ga0209758_1120155 3300025297 Bacteria 711
254 Ga0209256_1000033 3300025299 Bacteria 393924
255 Ga0209256_1001059 3300025299 Bacteria 31924
256 Ga0207426_1008734 3300025302 Bacteria 4059
257 Ga0209257_1042604 3300025304 Bacteria 1338
258 Ga0207656_10141815 3300025321 Unclassified 1133
259 Ga0207653_10002711 3300025885 Bacteria 5631
260 Ga0207692_10108014 3300025898 Bacteria 1539
261 Ga0207699_10342338 3300025906 Bacteria 1054
262 Ga0207645_10129162 3300025907 Bacteria 1644
263 Ga0207643_10299692 3300025908 Bacteria 1000
264 Ga0207705_10028538 3300025909 Bacteria 3979
265 Ga0207705_10130132 3300025909 Bacteria 1872
266 Ga0207705_10173695 3300025909 Bacteria 1623
267 Ga0207705_10944470 3300025909 Bacteria 667
268 Ga0207707_10070774 3300025912 Bacteria 3039
269 Ga0207695_10044478 3300025913 Bacteria 4723
270 Ga0207695_10374405 3300025913 Bacteria 1310
271 Ga0207695_10747977 3300025913 Bacteria 858
272 Ga0207671_10161119 3300025914 Bacteria 1737
273 Ga0207660_10062408 3300025917 Bacteria 2684
274 Ga0207660_11321809 3300025917 Bacteria 585
275 Ga0207662_10057287 3300025918 Bacteria 2329
276 Ga0207657_10003807 3300025919 Bacteria 16038
277 Ga0207657_10019310 3300025919 Bacteria 6477
278 Ga0207657_10090488 3300025919 Bacteria 2554
279 Ga0207649_10002797 3300025920 Bacteria 9634
280 Ga0207649_10007229 3300025920 Bacteria 6037
281 Ga0207649_10710140 3300025920 Bacteria 780
282 Ga0207652_10315918 3300025921 Bacteria 1410
283 Ga0207652_10687163 3300025921 Bacteria 914
284 Ga0207694_10034911 3300025924 Bacteria 3857
285 Ga0207694_10064406 3300025924 Bacteria 2857
286 Ga0207694_10465231 3300025924 Bacteria 1057
287 Ga0207694_10865070 3300025924 Bacteria 764
288 Ga0207694_11604397 3300025924 Bacteria 548
289 Ga0207650_10217470 3300025925 Bacteria 1536
290 Ga0207650_11015083 3300025925 Bacteria 706
291 Ga0207687_11100267 3300025927 Bacteria 682
292 Ga0207664_11031170 3300025929 Bacteria 737
293 Ga0207644_10561755 3300025931 Bacteria 945
294 Ga0207690_10027817 3300025932 Bacteria 3577
295 Ga0207690_10062050 3300025932 Bacteria 2543
296 Ga0207690_10456525 3300025932 Bacteria 1028
297 Ga0207690_11803422 3300025932 Unclassified 511
298 Ga0207706_10077012 3300025933 Bacteria 2933
299 Ga0207706_10179354 3300025933 Bacteria 1860
300 Ga0207709_10105548 3300025935 Bacteria 1872
301 Ga0207709_10910722 3300025935 Bacteria 715
302 Ga0207670_10033087 3300025936 Bacteria 3329
303 Ga0207691_11417707 3300025940 Bacteria 570
304 Ga0207689_10014108 3300025942 Bacteria 6801
305 Ga0207689_10155825 3300025942 Bacteria 1883
306 Ga0207689_10754492 3300025942 Bacteria 821
307 Ga0207661_10113179 3300025944 Bacteria 2299
308 Ga0207661_10721372 3300025944 Bacteria 917
309 Ga0207679_10015875 3300025945 Bacteria 4991
310 Ga0207679_10139019 3300025945 Bacteria 1960
311 Ga0207679_11212993 3300025945 Bacteria 692
312 Ga0207679_11467888 3300025945 Bacteria 626
313 Ga0207667_10002392 3300025949 Bacteria 23492
314 Ga0207667_10048388 3300025949 Bacteria 4496
315 Ga0207667_10308163 3300025949 Bacteria 1617
316 Ga0207667_10879968 3300025949 Bacteria 889
317 Ga0207667_11653287 3300025949 Bacteria 608
318 Ga0207712_10000922 3300025961 Bacteria 21290
319 Ga0207668_10237051 3300025972 Bacteria 1474
320 Ga0207640_10037490 3300025981 Bacteria 3050
321 Ga0207640_10196285 3300025981 Bacteria 1525
322 Ga0207640_10333804 3300025981 Bacteria 1212
323 Ga0207658_10992577 3300025986 Bacteria 766
324 Ga0207677_10013800 3300026023 Bacteria 4693
325 Ga0207677_10562473 3300026023 Bacteria 996
326 Ga0207677_11591260 3300026023 Bacteria 605
327 Ga0207677_11887748 3300026023 Bacteria 555
328 Ga0207703_10977848 3300026035 Bacteria 812
329 Ga0207639_10001619 3300026041 Bacteria 15145
330 Ga0207639_10236792 3300026041 Bacteria 1585
331 Ga0207639_10496605 3300026041 Bacteria 1114
332 Ga0207639_11079649 3300026041 Bacteria 753
333 Ga0207678_10030183 3300026067 Bacteria 4733
334 Ga0207678_10060448 3300026067 Bacteria 3259
335 Ga0207678_10223873 3300026067 Bacteria 1610
336 Ga0207708_10003376 3300026075 Bacteria 11772
337 Ga0207702_10211519 3300026078 Bacteria 1803
338 Ga0207702_11419964 3300026078 Bacteria 688
339 Ga0207641_10174382 3300026088 Bacteria 1965
340 Ga0207641_11083924 3300026088 Bacteria 799
341 Ga0207648_10094331 3300026089 Bacteria 2617
342 Ga0207648_10207172 3300026089 Bacteria 1740
343 Ga0207676_10049749 3300026095 Bacteria 3263
344 Ga0207676_11935349 3300026095 Bacteria 588
345 Ga0207674_10010079 3300026116 Bacteria 10746
346 Ga0207674_10012034 3300026116 Bacteria 9692
347 Ga0207674_10857713 3300026116 Bacteria 876
348 Ga0207674_11675277 3300026116 Bacteria 604
349 Ga0207674_11678606 3300026116 Bacteria 604
350 Ga0207675_100018965 3300026118 Bacteria 6422
351 Ga0207675_100074454 3300026118 Bacteria 3177
352 Ga0207683_10197829 3300026121 Bacteria 1826
353 Ga0207683_10501646 3300026121 Bacteria 1121
354 Ga0207683_10589530 3300026121 Bacteria 1028
355 Ga0207698_10026030 3300026142 Bacteria 4133
356 Ga0207698_10037678 3300026142 Bacteria 3564
357 Ga0207698_10258551 3300026142 Bacteria 1598
358 Ga0207698_10384669 3300026142 Bacteria 1336
359 Ga0207698_12048534 3300026142 Bacteria 586
360 Ga0207698_12118610 3300026142 Bacteria 576
361 Ga0209983_1066282 3300027665 Bacteria 801
362 Ga0209813_10024721 3300027866 Bacteria 1721
363 Ga0209813_10060720 3300027866 Bacteria 1206
364 Ga0209974_10385594 3300027876 Bacteria 548
365 Ga0207428_10045521 3300027907 Bacteria 3533
366 Ga0268266_10000497 3300028379 Bacteria 56202
367 Ga0268266_10144602 3300028379 Bacteria 2137
368 Ga0268266_10278694 3300028379 Bacteria 1554
369 Ga0268265_10000750 3300028380 Bacteria 31594
370 Ga0268265_10073522 3300028380 Bacteria 2670
371 Ga0268265_10289286 3300028380 Bacteria 1470
372 Ga0268265_10973714 3300028380 Bacteria 837
373 Ga0268264_10001691 3300028381 Bacteria 20334
374 Ga0268264_10034824 3300028381 Bacteria 4144
375 Ga0268264_10483425 3300028381 Bacteria 1205
376 Ga0268264_11256061 3300028381 Bacteria 751
377 Ga0268264_12506058 3300028381 Unclassified 521
378 Ga0307515_10308406 3300028794 Bacteria 1260
379 Ga0265338_10066892 3300028800 Bacteria 3107
380 Ga0265330_10002970 3300031235 Bacteria 9029
381 Ga0265328_10061172 3300031239 Bacteria 1383
382 Ga0265325_10000940 3300031241 Bacteria 21017
383 Ga0265325_10053270 3300031241 Bacteria 2075
384 Ga0265325_10084551 3300031241 Bacteria 1573
385 Ga0265329_10011067 3300031242 Bacteria 3288
386 Ga0265340_10041669 3300031247 Bacteria 2257
387 Ga0265340_10250544 3300031247 Bacteria 789
388 Ga0265339_10001865 3300031249 Bacteria 15496
389 Ga0265331_10109601 3300031250 Bacteria 1266
390 Ga0265316_10038301 3300031344 Bacteria 3864
391 Ga0265313_10000199 3300031595 Bacteria 64705
392 Ga0265313_10055920 3300031595 Bacteria 1867
393 Ga0265314_10052495 3300031711 Bacteria 2833
394 Ga0265342_10007352 3300031712 Bacteria 8081
395 Ga0307413_10493087 3300031824 Bacteria 982
396 Ga0307406_10655960 3300031901 Bacteria 871
397 Ga0307406_10821883 3300031901 Bacteria 786
398 Ga0307412_10195914 3300031911 Bacteria 1531
399 Ga0307414_10405015 3300032004 Bacteria 1186
400 Ga0307411_10242621 3300032005 Unclassified 1412
401 Ga0307415_100837240 3300032126 Bacteria 843
402 Ga0373958_0055079 3300034819 Bacteria 849
403 Ga0373932_0133341 3300035112 Bacteria 839
404 Ga0373957_0134283 3300035120 Unclassified 1009
405 Ga0373960_0019087 3300035121 Bacteria 1797
406 Ga0373955_0429165 3300035172 Unclassified 804
407 Ga0373942_0031292 3300035207 Bacteria 1406
408 Ga0373961_0051898 3300035241 Bacteria 1219
409 Ga0373924_0358487 3300035410 Unclassified 650
410 Ga0373931_0013785 3300035691 Bacteria 3940
411 Ga0373931_0194945 3300035691 Bacteria 1207
412 Ga0373935_0603468 3300035692 Unclassified 803
413 Ga0373937_1107378 3300036401 Unclassified 740
414 Ga0395905_0795331 3300037471 Bacteria 849
415 Ga0436360_1134027 3300039438 Bacteria 1190
416 Ga0439465_0216930 3300041413 Bacteria 701
417 Ga0451789_0487006 3300041443 Bacteria 505
418 Ga0451802_1721981 3300041460 Bacteria 738
419 Ga0451804_0293700 3300041463 Bacteria 848
420 Ga0451845_0599271 3300041501 Bacteria 725
421 Ga0451853_1429455 3300041512 Bacteria 731
422 Ga0439431_0197800 3300041997 Bacteria 585
423 Ga0439445_0151756 3300042004 Bacteria 675
424 Ga0439434_0319459 3300042435 Bacteria 539
425 Ga0466966_0473625 3300044684 Bacteria 753
426 Ga0466963_1340312 3300044694 Bacteria 502
427 Ga0466971_0491538 3300044719 Bacteria 605
428 Ga0466968_0021716 3300044735 Bacteria 2601
429 Ga0466968_0445211 3300044735 Bacteria 640
430 Ga0466960_0030041 3300044901 Bacteria 2499
431 Ga0466960_0083699 3300044901 Bacteria 1613
432 Ga0466959_0184260 3300045049 Bacteria 1459
433 Ga0466959_1152019 3300045049 Bacteria 515
434 Ga0466959_1198464 3300045049 Bacteria 505
435 Ga0466967_0138643 3300045976 Bacteria 2264
436 Ga0495590_0295115 3300046457 Unclassified 609
437 Ga0495610_0126979 3300046512 Bacteria 1111
438 Ga0495668_0156308 3300046616 Bacteria 1249
439 Ga0495634_0343898 3300046642 Unclassified 894
440 Ga0495635_0682326 3300046663 Unclassified 667
441 Ga0495680_0815720 3300047322 Unclassified 608
442 Ga0495686_0713779 3300047472 Bacteria 511
443 Ga0496100_0236521 3300048903 Bacteria 1346
444 Ga0496101_0072574 3300048904 Bacteria 2527
445 Ga0496102_0011343 3300048905 Bacteria 7677
446 Ga0496103_0005222 3300048906 Bacteria 7803
447 Ga0496104_0003542 3300048907 Bacteria 13465
448 Ga0496104_0188101 3300048907 Bacteria 1976
449 Ga0496104_0377450 3300048907 Bacteria 1330
450 Ga0496105_0015197 3300048908 Bacteria 6130
451 Ga0496105_0209253 3300048908 Bacteria 1590
452 Ga0496106_0004061 3300048909 Bacteria 10921
453 Ga0496107_0015512 3300048910 Bacteria 5343
454 Ga0496108_0000622 3300048911 Bacteria 27771
455 Ga0496108_0446810 3300048911 Bacteria 1129
456 Ga0496108_0951206 3300048911 Bacteria 735
457 Ga0496109_0001193 3300048912 Bacteria 21610
458 Ga0496109_0104791 3300048912 Bacteria 2626
459 Ga0496109_0347647 3300048912 Bacteria 1401
460 Ga0496110_0108498 3300048913 Bacteria 2492
461 Ga0496111_0007095 3300048914 Bacteria 7321
462 Ga0496112_0064205 3300048915 Bacteria 3623
463 Ga0496112_0717989 3300048915 Bacteria 927
464 Ga0496113_0007933 3300048916 Bacteria 6874
465 Ga0496113_0488512 3300048916 Bacteria 989
466 Ga0496115_0040443 3300048918 Bacteria 3707
467 Ga0496117_0083209 3300048920 Bacteria 2093
468 Ga0496118_0240785 3300048921 Bacteria 1036
469 Ga0496118_0390149 3300048921 Bacteria 727
470 Ga0496118_0410317 3300048921 Bacteria 700
471 Ga0496119_0257966 3300048922 Bacteria 876
472 Ga0496120_0137153 3300048923 Bacteria 1246
473 Ga0496121_0259288 3300048924 Bacteria 1201
474 Ga0496121_0449705 3300048924 Bacteria 830
475 Ga0496122_0041656 3300048925 Bacteria 3627
476 Ga0496122_0135123 3300048925 Bacteria 1556
477 Ga0496123_0034206 3300048926 Bacteria 3644
478 Ga0496123_0063921 3300048926 Bacteria 2348
479 Ga0496124_0363817 3300048927 Bacteria 1018
480 Ga0496125_0065961 3300048928 Bacteria 2864
481 Ga0496126_0157353 3300048929 Bacteria 1944
482 Ga0496126_0354273 3300048929 Bacteria 1200
483 Ga0501031_0006302 3300049568 Bacteria 7733
484 Ga0501031_0251467 3300049568 Bacteria 1149
485 Ga0501032_0051913 3300049569 Bacteria 2763
486 Ga0501032_0551059 3300049569 Bacteria 735
487 Ga0501033_0028432 3300049570 Bacteria 4200
488 Ga0501033_0033495 3300049570 Bacteria 3856
489 Ga0501033_0569397 3300049570 Bacteria 779
490 Ga0501033_1122300 3300049570 Bacteria 522
491 Ga0501034_0003130 3300049571 Bacteria 19056
492 Ga0501034_0011723 3300049571 Bacteria 9069
493 Ga0501034_0025085 3300049571 Bacteria 6067
494 Ga0501034_0044452 3300049571 Bacteria 4493
495 Ga0501034_0061210 3300049571 Bacteria 3781
496 Ga0501034_0061500 3300049571 Bacteria 3771
497 Ga0501034_0279597 3300049571 Bacteria 1609
498 Ga0501034_0292786 3300049571 Bacteria 1565
499 Ga0501034_0526200 3300049571 Bacteria 1094
500 Ga0501034_0626073 3300049571 Bacteria 979
501 Ga0501034_1047638 3300049571 Bacteria 698
502 Ga0501036_0215834 3300049572 Bacteria 1611
503 Ga0501036_0440503 3300049572 Bacteria 1086
504 Ga0501036_1305926 3300049572 Bacteria 590
505 Ga0501037_0204181 3300049573 Bacteria 1396
506 Ga0501037_0862646 3300049573 Bacteria 595
507 Ga0501038_0000038 3300049574 Bacteria 123099
508 Ga0501038_0015297 3300049574 Bacteria 6975
509 Ga0501038_0443912 3300049574 Bacteria 998
510 Ga0501038_1321102 3300049574 Bacteria 520
511 Ga0501039_0016085 3300049575 Bacteria 5729
512 Ga0501043_0795329 3300049579 Bacteria 684
513 Ga0501046_0339546 3300049580 Bacteria 1092
514 Ga0501047_0148052 3300049581 Bacteria 2224
515 Ga0501047_0260105 3300049581 Bacteria 1583
516 Ga0501068_0914924 3300049584 Bacteria 577
517 Ga0501070_0065862 3300049586 Bacteria 3000
518 Ga0501070_0242671 3300049586 Bacteria 1474
519 Ga0501070_1354788 3300049586 Bacteria 542
520 Ga0501073_0560313 3300049589 Bacteria 789
521 Ga0501223_037564 3300049663 Bacteria 941
522 Ga0501259_111709 3300049688 Bacteria 640
523 Ga0501080_0039111 3300049742 Bacteria 4427
524 Ga0501080_0419099 3300049742 Bacteria 1203
525 Ga0501081_0261963 3300049743 Bacteria 1264
526 Ga0501083_0094446 3300049744 Bacteria 1974
527 Ga0501035_0125905 3300049822 Bacteria 2236
528 Ga0501035_0249302 3300049822 Bacteria 1508
529 Ga0501035_0252713 3300049822 Bacteria 1496
530 Ga0501035_0737504 3300049822 Bacteria 792
531 Ga0501044_0101273 3300049823 Bacteria 2898
532 Ga0501044_0645560 3300049823 Bacteria 948
533 Ga0501044_0708264 3300049823 Bacteria 892
534 Ga0501044_0789419 3300049823 Bacteria 829
535 Ga0501045_1189038 3300049824 Bacteria 556
536 nmdc:mga03683_604488_c1 3300050489 Bacteria 537
537 nmdc:mga03n38_19607_c1 3300050490 Bacteria 2690
538 nmdc:mga03n38_199788_c1 3300050490 Bacteria 1034
539 nmdc:mga00v17_63070_c1 3300050491 Bacteria 2282
540 nmdc:mga0yw44_365771_c1 3300050492 Bacteria 972
541 nmdc:mga0yw44_53602_c1 3300050492 Bacteria 2450
542 nmdc:mga0k408_217506_c1 3300050493 Bacteria 1141
543 nmdc:mga06z11_14834_c1 3300050494 Bacteria 3462
544 nmdc:mga06z11_163766_c1 3300050494 Bacteria 1273
545 nmdc:mga06z11_22461_c1 3300050494 Bacteria 2948
546 nmdc:mga06z11_5482_c1 3300050494 Bacteria 5096
547 nmdc:mga04h51_1256_c1 3300050495 Bacteria 5871
548 nmdc:mga04h51_34096_c1 3300050495 Bacteria 1624
549 nmdc:mga04h51_72461_c1 3300050495 Bacteria 1206
550 nmdc:mga07m45_19495_c1 3300050496 Bacteria 3676
551 nmdc:mga05p37_574289_c1 3300050507 Bacteria 1278
552 nmdc:mga0qj67_31184_c1 3300050509 Bacteria 4152
553 nmdc:mga06r32_24113_c1 3300050510 Bacteria 5641
554 nmdc:mga08y16_1120075_c1 3300050511 Bacteria 761
555 nmdc:mga08y16_638129_c1 3300050511 Bacteria 1070
556 Ga0500578_0512204 3300053086 Bacteria 673
557 Ga0500643_063943 3300053087 Bacteria 1029
558 Ga0500641_0440913 3300053096 Bacteria 504
559 Ga0500561_0057266 3300053137 Bacteria 1082
560 Ga0500568_0352464 3300053139 Bacteria 534
561 Ga0500577_0144915 3300053142 Bacteria 1004
562 Ga0500616_0046909 3300053153 Bacteria 2296
563 Ga0500616_0182989 3300053153 Bacteria 942
564 Ga0500622_0024490 3300053156 Bacteria 3191
565 Ga0500627_0140892 3300053158 Bacteria 1089
566 Ga0500637_0568307 3300053178 Bacteria 545
567 Ga0500645_041208 3300053730 Bacteria 1364
568 Ga0587076_162813 3300059645 Unclassified 550
569 2643758956 2643221547 Bacteria 4740017
570 2819721673 2818991467 Bacteria 5893227
571 2889310878 2889306138 Bacteria 6358934
572 Ga0006562J51391_1116801
573 RicEn_FSXC46108_g7
574 JGI24740J21852_10071045
575 JGI24737J22298_10111037
576 JGI24735J21928_10031045
577 JGI25164J39214_1023140
578 JGI25159J45721_1010820
579 JGI25151J46595_10000036
580 JGI25151J46595_10000209
581 JGI25151J46595_10000244
582 rootH2_10049313
583 rootH1_10068225
584 rootH1_10186067
585 Ga0006562J51391_1116802
586 Ga0055526_1000391
587 Ga0055524_1000014
588 Ga0055524_1046451
589 Ga0055543_1012411
590 Ga0065165_1000048
591 Ga0070658_10002972
592 Ga0070658_10012683
593 Ga0070658_10054268
594 Ga0070683_100091808
595 Ga0070690_100839352
596 Ga0070670_100042450
597 Ga0070670_101200591
598 Ga0068869_100024349
599 Ga0068869_100317725
600 Ga0068869_100338409
601 Ga0070680_100004506
602 Ga0070680_100035168
603 Ga0070680_100706645
604 Ga0070682_100234068
605 Ga0068868_100111377
606 Ga0068868_101181200
607 Ga0070660_100014765
608 Ga0070660_100038237
609 Ga0070660_100077302
610 Ga0070689_100003662
611 Ga0070689_100082434
612 Ga0070689_100830747
613 Ga0070691_10126737
614 Ga0070691_10237256
615 Ga0070687_100094799
616 Ga0070661_100001446
617 Ga0070661_100003809
618 Ga0070661_100726596
619 Ga0070692_10043927
620 Ga0070668_100239682
621 Ga0070671_100626679
622 Ga0070673_102020586
623 Ga0070688_100095192
624 Ga0070688_100306638
625 Ga0070659_100007639
626 Ga0070659_100009861
627 Ga0070659_100719674
628 Ga0070703_10000544
629 Ga0070709_10312267
630 Ga0070714_101248437
631 Ga0070714_101284733
632 Ga0070710_10150659
633 Ga0070710_11398756
634 Ga0070701_10009637
635 Ga0070701_10021510
636 Ga0070701_10593582
637 Ga0070705_100000469
638 Ga0070705_100010171
639 Ga0070705_100372448
640 Ga0070700_100001016
641 Ga0070700_100449529
642 Ga0070694_100009240
643 Ga0070694_100017048
644 Ga0070694_100566180
645 Ga0070708_100017602
646 Ga0070663_100002136
647 Ga0070663_100077543
648 Ga0070663_100734154
649 Ga0070678_100756634
650 Ga0070678_101594405
651 Ga0070662_100094839
652 Ga0070681_10087753
653 Ga0068867_101356962
654 Ga0070707_100711881
655 Ga0070698_100170281
656 Ga0070699_100001512
657 Ga0070679_100033302
658 Ga0070679_101720822
659 Ga0070679_101808511
660 Ga0070697_100007219
661 Ga0068853_100005627
662 Ga0068853_100056663
663 Ga0068853_100169938
664 Ga0068853_100286023
665 Ga0068853_101049708
666 Ga0068853_101346431
667 Ga0068853_101443337
668 Ga0070672_100122633
669 Ga0070672_101747406
670 Ga0070686_100010980
671 Ga0070695_100003955
672 Ga0070695_100114795
673 Ga0070695_101718818
674 Ga0070696_100000758
675 Ga0070696_100035460
676 Ga0070693_100006856
677 Ga0070693_100874009
678 Ga0070693_101152296
679 Ga0070665_100000668
680 Ga0070665_100303019
681 Ga0070665_100691501
682 Ga0070665_101152205
683 Ga0070704_100084359
684 Ga0070704_100191593
685 Ga0068855_100040013
686 Ga0068855_100139707
687 Ga0068855_101045323
688 Ga0068855_101504453
689 Ga0070664_100029550
690 Ga0070664_100091931
691 Ga0070664_100479923
692 Ga0070664_100738193
693 Ga0070664_100980440
694 Ga0068857_100046014
695 Ga0068857_100051801
696 Ga0068854_100002452
697 Ga0068854_100009277
698 Ga0068854_100351221
699 Ga0068854_100609323
700 Ga0068854_101662108
701 Ga0068856_100057421
702 Ga0068856_100146752
703 Ga0068856_100676225
704 Ga0070702_100033166
705 Ga0070702_100045198
706 Ga0070702_100049916
707 Ga0070702_100501587
708 Ga0068852_100002904
709 Ga0068852_100057323
710 Ga0068852_100690160
711 Ga0068852_101653188
712 Ga0068852_101717079
713 Ga0068859_100004727
714 Ga0068859_100150573
715 Ga0068859_100660800
716 Ga0068864_100035916
717 Ga0068866_10873769
718 Ga0068861_100032032
719 Ga0068861_100104002
720 Ga0068861_100625780
721 Ga0068861_100878416
722 Ga0068851_10209167
723 Ga0068870_10265125
724 Ga0068870_10313605
725 Ga0068863_100159468
726 Ga0068863_100918796
727 Ga0068858_100095627
728 Ga0068858_101669731
729 Ga0068860_100002721
730 Ga0068860_100128743
731 Ga0068862_100005737
732 Ga0068862_100129258
733 Ga0075365_10121704
734 Ga0075365_10288378
735 Ga0075365_10449808
736 Ga0075365_11019837
737 Ga0075368_10122252
738 Ga0075368_10148228
739 Ga0075363_100035222
740 Ga0075363_100060548
741 Ga0075363_100258766
742 Ga0075364_10018304
743 Ga0075364_11235645
744 Ga0075362_10020090
745 Ga0075367_10015133
746 Ga0075367_10048455
747 Ga0075367_10053275
748 Ga0075367_10085311
749 Ga0075367_10732017
750 Ga0075366_10152369
751 Ga0097621_100608233
752 Ga0075370_10032759
753 Ga0075370_10400689
754 Ga0068871_100436607
755 Ga0075428_100355564
756 Ga0075430_100013000
757 Ga0075431_100000778
758 Ga0068865_100287560
759 Ga0097620_100004727
760 Ga0097620_100150574
761 Ga0097620_100660809
762 Ga0105240_10067644
763 Ga0105240_10342086
764 Ga0111539_10458451
765 Ga0111539_12038058
766 Ga0105245_10861933
767 Ga0114129_10158333
768 Ga0114129_11201796
769 Ga0105243_10188062
770 Ga0105243_11135691
771 Ga0105241_10480444
772 Ga0105241_11243835
773 Ga0105242_11022957
774 Ga0105237_10332670
775 Ga0105237_11405005
776 Ga0105238_10018169
777 Ga0105238_10020597
778 Ga0105238_10095570
779 Ga0105238_10217774
780 Ga0105249_10007251
781 Ga0105249_11069727
782 Ga0105239_10066045
783 Ga0105239_10126663
784 Ga0105239_10830797
785 Ga0105239_13167181
786 Ga0105246_10043807
787 Ga0105246_10414033
788 Ga0157373_10782489
789 Ga0157371_10234314
790 Ga0157371_10269420
791 Ga0157370_10018933
792 Ga0157370_10171579
793 Ga0157370_10607355
794 Ga0157369_10026540
795 Ga0157369_10304807
796 Ga0171462_1007
797 Ga0157374_10999309
798 Ga0157378_10060959
799 Ga0157372_10012923
800 Ga0157372_11886984
801 Ga0157375_10170795
802 Ga0157375_11120976
803 Ga0163163_10021474
804 Ga0163163_10646615
805 Ga0163163_10683327
806 Ga0163163_11848613
807 Ga0163163_12172553
808 Ga0157380_10465612
809 Ga0157380_10636774
810 Ga0157380_11019108
811 Ga0157380_11267783
812 Ga0182008_10111879
813 Ga0157379_10434904
814 Ga0157376_10469269
815 Ga0206354_11195405
816 Ga0207427_103217
817 Ga0209233_1000572
818 Ga0209130_1000071
819 Ga0209675_1000633
820 Ga0209025_1000017
821 Ga0209025_1042360
822 Ga0209025_1097529
823 Ga0209564_1000082
824 Ga0209758_1120155
825 Ga0209256_1000033
826 Ga0209256_1001059
827 Ga0207426_1008734
828 Ga0209257_1042604
829 Ga0207656_10141815
830 Ga0207653_10002711
831 Ga0207692_10108014
832 Ga0207699_10342338
833 Ga0207645_10129162
834 Ga0207643_10299692
835 Ga0207705_10028538
836 Ga0207705_10130132
837 Ga0207705_10173695
838 Ga0207705_10944470
839 Ga0207707_10070774
840 Ga0207695_10044478
841 Ga0207695_10374405
842 Ga0207695_10747977
843 Ga0207671_10161119
844 Ga0207660_10062408
845 Ga0207660_11321809
846 Ga0207662_10057287
847 Ga0207657_10003807
848 Ga0207657_10019310
849 Ga0207657_10090488
850 Ga0207649_10002797
851 Ga0207649_10007229
852 Ga0207649_10710140
853 Ga0207652_10315918
854 Ga0207652_10687163
855 Ga0207694_10034911
856 Ga0207694_10064406
857 Ga0207694_10465231
858 Ga0207694_10865070
859 Ga0207694_11604397
860 Ga0207650_10217470
861 Ga0207650_11015083
862 Ga0207687_11100267
863 Ga0207664_11031170
864 Ga0207644_10561755
865 Ga0207690_10027817
866 Ga0207690_10062050
867 Ga0207690_10456525
868 Ga0207690_11803422
869 Ga0207706_10077012
870 Ga0207706_10179354
871 Ga0207709_10105548
872 Ga0207709_10910722
873 Ga0207670_10033087
874 Ga0207691_11417707
875 Ga0207689_10014108
876 Ga0207689_10155825
877 Ga0207689_10754492
878 Ga0207661_10113179
879 Ga0207661_10721372
880 Ga0207679_10015875
881 Ga0207679_10139019
882 Ga0207679_11212993
883 Ga0207679_11467888
884 Ga0207667_10002392
885 Ga0207667_10048388
886 Ga0207667_10308163
887 Ga0207667_10879968
888 Ga0207667_11653287
889 Ga0207712_10000922
890 Ga0207668_10237051
891 Ga0207640_10037490
892 Ga0207640_10196285
893 Ga0207640_10333804
894 Ga0207658_10992577
895 Ga0207677_10013800
896 Ga0207677_10562473
897 Ga0207677_11591260
898 Ga0207677_11887748
899 Ga0207703_10977848
900 Ga0207639_10001619
901 Ga0207639_10236792
902 Ga0207639_10496605
903 Ga0207639_11079649
904 Ga0207678_10030183
905 Ga0207678_10060448
906 Ga0207678_10223873
907 Ga0207708_10003376
908 Ga0207702_10211519
909 Ga0207702_11419964
910 Ga0207641_10174382
911 Ga0207641_11083924
912 Ga0207648_10094331
913 Ga0207648_10207172
914 Ga0207676_10049749
915 Ga0207676_11935349
916 Ga0207674_10010079
917 Ga0207674_10012034
918 Ga0207674_10857713
919 Ga0207674_11675277
920 Ga0207674_11678606
921 Ga0207675_100018965
922 Ga0207675_100074454
923 Ga0207683_10197829
924 Ga0207683_10501646
925 Ga0207683_10589530
926 Ga0207698_10026030
927 Ga0207698_10037678
928 Ga0207698_10258551
929 Ga0207698_10384669
930 Ga0207698_12048534
931 Ga0207698_12118610
932 Ga0209983_1066282
933 Ga0209813_10024721
934 Ga0209813_10060720
935 Ga0209974_10385594
936 Ga0207428_10045521
937 Ga0268266_10000497
938 Ga0268266_10144602
939 Ga0268266_10278694
940 Ga0268265_10000750
941 Ga0268265_10073522
942 Ga0268265_10289286
943 Ga0268265_10973714
944 Ga0268264_10001691
945 Ga0268264_10034824
946 Ga0268264_10483425
947 Ga0268264_11256061
948 Ga0268264_12506058
949 Ga0307515_10308406
950 Ga0265338_10066892
951 Ga0265330_10002970
952 Ga0265328_10061172
953 Ga0265325_10000940
954 Ga0265325_10053270
955 Ga0265325_10084551
956 Ga0265329_10011067
957 Ga0265340_10041669
958 Ga0265340_10250544
959 Ga0265339_10001865
960 Ga0265331_10109601
961 Ga0265316_10038301
962 Ga0265313_10000199
963 Ga0265313_10055920
964 Ga0265314_10052495
965 Ga0265342_10007352
966 Ga0307413_10493087
967 Ga0307406_10655960
968 Ga0307406_10821883
969 Ga0307412_10195914
970 Ga0307414_10405015
971 Ga0307411_10242621
972 Ga0307415_100837240
973 Ga0373958_0055079
974 Ga0373932_0133341
975 Ga0373957_0134283
976 Ga0373960_0019087
977 Ga0373955_0429165
978 Ga0373942_0031292
979 Ga0373961_0051898
980 Ga0373924_0358487
981 Ga0373931_0013785
982 Ga0373931_0194945
983 Ga0373935_0603468
984 Ga0373937_1107378
985 Ga0395905_0795331
986 Ga0436360_1134027
987 Ga0439465_0216930
988 Ga0451789_0487006
989 Ga0451802_1721981
990 Ga0451804_0293700
991 Ga0451845_0599271
992 Ga0451853_1429455
993 Ga0439431_0197800
994 Ga0439445_0151756
995 Ga0439434_0319459
996 Ga0466966_0473625
997 Ga0466963_1340312
998 Ga0466971_0491538
999 Ga0466968_0021716
1000 Ga0466968_0445211
1001 Ga0466960_0030041
1002 Ga0466960_0083699
1003 Ga0466959_0184260
1004 Ga0466959_1152019
1005 Ga0466959_1198464
1006 Ga0466967_0138643
1007 Ga0495590_0295115
1008 Ga0495610_0126979
1009 Ga0495668_0156308
1010 Ga0495634_0343898
1011 Ga0495635_0682326
1012 Ga0495680_0815720
1013 Ga0495686_0713779
1014 Ga0496100_0236521
1015 Ga0496101_0072574
1016 Ga0496102_0011343
1017 Ga0496103_0005222
1018 Ga0496104_0003542
1019 Ga0496104_0188101
1020 Ga0496104_0377450
1021 Ga0496105_0015197
1022 Ga0496105_0209253
1023 Ga0496106_0004061
1024 Ga0496107_0015512
1025 Ga0496108_0000622
1026 Ga0496108_0446810
1027 Ga0496108_0951206
1028 Ga0496109_0001193
1029 Ga0496109_0104791
1030 Ga0496109_0347647
1031 Ga0496110_0108498
1032 Ga0496111_0007095
1033 Ga0496112_0064205
1034 Ga0496112_0717989
1035 Ga0496113_0007933
1036 Ga0496113_0488512
1037 Ga0496115_0040443
1038 Ga0496117_0083209
1039 Ga0496118_0240785
1040 Ga0496118_0390149
1041 Ga0496118_0410317
1042 Ga0496119_0257966
1043 Ga0496120_0137153
1044 Ga0496121_0259288
1045 Ga0496121_0449705
1046 Ga0496122_0041656
1047 Ga0496122_0135123
1048 Ga0496123_0034206
1049 Ga0496123_0063921
1050 Ga0496124_0363817
1051 Ga0496125_0065961
1052 Ga0496126_0157353
1053 Ga0496126_0354273
1054 Ga0501031_0006302
1055 Ga0501031_0251467
1056 Ga0501032_0051913
1057 Ga0501032_0551059
1058 Ga0501033_0028432
1059 Ga0501033_0033495
1060 Ga0501033_0569397
1061 Ga0501033_1122300
1062 Ga0501034_0003130
1063 Ga0501034_0011723
1064 Ga0501034_0025085
1065 Ga0501034_0044452
1066 Ga0501034_0061210
1067 Ga0501034_0061500
1068 Ga0501034_0279597
1069 Ga0501034_0292786
1070 Ga0501034_0526200
1071 Ga0501034_0626073
1072 Ga0501034_1047638
1073 Ga0501036_0215834
1074 Ga0501036_0440503
1075 Ga0501036_1305926
1076 Ga0501037_0204181
1077 Ga0501037_0862646
1078 Ga0501038_0000038
1079 Ga0501038_0015297
1080 Ga0501038_0443912
1081 Ga0501038_1321102
1082 Ga0501039_0016085
1083 Ga0501043_0795329
1084 Ga0501046_0339546
1085 Ga0501047_0148052
1086 Ga0501047_0260105
1087 Ga0501068_0914924
1088 Ga0501070_0065862
1089 Ga0501070_0242671
1090 Ga0501070_1354788
1091 Ga0501073_0560313
1092 Ga0501223_037564
1093 Ga0501259_111709
1094 Ga0501080_0039111
1095 Ga0501080_0419099
1096 Ga0501081_0261963
1097 Ga0501083_0094446
1098 Ga0501035_0125905
1099 Ga0501035_0249302
1100 Ga0501035_0252713
1101 Ga0501035_0737504
1102 Ga0501044_0101273
1103 Ga0501044_0645560
1104 Ga0501044_0708264
1105 Ga0501044_0789419
1106 Ga0501045_1189038
1107 nmdc:mga03683_604488_c1
1108 nmdc:mga03n38_19607_c1
1109 nmdc:mga03n38_199788_c1
1110 nmdc:mga00v17_63070_c1
1111 nmdc:mga0yw44_365771_c1
1112 nmdc:mga0yw44_53602_c1
1113 nmdc:mga0k408_217506_c1
1114 nmdc:mga06z11_14834_c1
1115 nmdc:mga06z11_163766_c1
1116 nmdc:mga06z11_22461_c1
1117 nmdc:mga06z11_5482_c1
1118 nmdc:mga04h51_1256_c1
1119 nmdc:mga04h51_34096_c1
1120 nmdc:mga04h51_72461_c1
1121 nmdc:mga07m45_19495_c1
1122 nmdc:mga05p37_574289_c1
1123 nmdc:mga0qj67_31184_c1
1124 nmdc:mga06r32_24113_c1
1125 nmdc:mga08y16_1120075_c1
1126 nmdc:mga08y16_638129_c1
1127 Ga0500578_0512204
1128 Ga0500643_063943
1129 Ga0500641_0440913
1130 Ga0500561_0057266
1131 Ga0500568_0352464
1132 Ga0500577_0144915
1133 Ga0500616_0046909
1134 Ga0500616_0182989
1135 Ga0500622_0024490
1136 Ga0500627_0140892
1137 Ga0500637_0568307
1138 Ga0500645_041208
1139 Ga0587076_162813
1140 2643758956
1141 2819721673
1142 2889310878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

21

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mja-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a75i 0.9637 2 82
4mjb-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a79s 0.9633 2 82
3qmx-assembly1.cif.gz_A x-ray crystal structure of synechocystis sp. pcc 6803 glutaredoxin a 0.9619 2 82
4mje-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-r27l 0.9614 2 83
4mjc-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a - p84r 0.9612 2 82
ID Description Score Start End Superfamily
af_A0A1D6GDU0_1_74_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9648 14 82 3.40.30.10
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9426 1 83 3.40.30.10
af_O36032_1_101_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9046 4 81 3.40.30.10
af_Q9UTI2_1_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9024 4 84 3.40.30.10
af_A4HYU2_3_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8998 2 83 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1M3KKS5-F1-model_v4 Glutaredoxin 1.004 1 82 GO:0005737
GO:0015038
GO:0034599
GO:0045454
AF-A0A1Y6GCY8-F1-model_v4 Glutaredoxin 1 1 83 GO:0005737
GO:0015038
GO:0034599
GO:0045454
AF-A0A2E7UII9-F1-model_v4 Glutaredoxin 0.996 2 83 GO:0015035
AF-A0A6F8URK4-F1-model_v4 Glutaredoxin 0.9959 1 83 GO:0005737
GO:0015038
GO:0034599
GO:0045454
AF-U7FPF7-F1-model_v4 deleted 0.9952 1 83

Map