F464908
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 571 | 224 | 520 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_101550017|Ga0068869_1015500172 |
| Length | 114 |
| Sequence | MDTEAIQIIKLIASGLPYLAIVVALGVGGSLLSTWLKIKNGYPISSSWGIPMHPKGDREAAERIKLLTNENAKLRTEIKSVTDRLANVERIVTDQPSRLMRDIDALAIDKEGTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 2 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 3 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 4 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 5 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 174 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 177 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 178 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 179 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 180 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 181 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 182 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 207 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 209 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 213 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 214 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 215 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 216 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 217 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 218 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 219 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 220 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 221 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 222 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 223 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 0.35 |
| Isolates | 0.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.68 |
| Nodule | 0 |
| Rhizoplane | 3.15 |
| Rhizosphere | 92.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006386 | 3300001979 | Bacteria | 4887 |
| 2 | JGI24740J21852_10055235 | 3300001979 | Bacteria | 1118 |
| 3 | JGI24739J22299_10000378 | 3300001989 | Bacteria | 15359 |
| 4 | JGI24739J22299_10023939 | 3300001989 | Unclassified | 2155 |
| 5 | JGI24737J22298_10000438 | 3300001990 | Bacteria | 14246 |
| 6 | JGI24737J22298_10001085 | 3300001990 | Bacteria | 9564 |
| 7 | JGI24737J22298_10001931 | 3300001990 | Bacteria | 7414 |
| 8 | JGI24737J22298_10003378 | 3300001990 | Bacteria | 5643 |
| 9 | JGI24735J21928_10026590 | 3300002067 | Bacteria | 1738 |
| 10 | JGI24750J21931_1086221 | 3300002070 | Bacteria | 527 |
| 11 | JGI24738J21930_10003426 | 3300002075 | Bacteria | 4002 |
| 12 | JGI24035J26624_1001446 | 3300002126 | Bacteria | 2244 |
| 13 | Ga0065712_10096286 | 3300005290 | Bacteria | 2188 |
| 14 | Ga0070658_10003538 | 3300005327 | Bacteria | 12823 |
| 15 | Ga0070658_10104808 | 3300005327 | Bacteria | 2340 |
| 16 | Ga0070658_10117065 | 3300005327 | Bacteria | 2212 |
| 17 | Ga0070658_10155221 | 3300005327 | Archaea | 1918 |
| 18 | Ga0070658_10230811 | 3300005327 | Bacteria | 1567 |
| 19 | Ga0070658_10783061 | 3300005327 | Bacteria | 828 |
| 20 | Ga0070658_11315729 | 3300005327 | Bacteria | 628 |
| 21 | Ga0070658_11350954 | 3300005327 | Bacteria | 619 |
| 22 | Ga0070658_11410158 | 3300005327 | Unclassified | 604 |
| 23 | Ga0070676_10005815 | 3300005328 | Bacteria | 6575 |
| 24 | Ga0070676_10132106 | 3300005328 | Bacteria | 1580 |
| 25 | Ga0070683_100005945 | 3300005329 | Bacteria | 10211 |
| 26 | Ga0070690_100057917 | 3300005330 | Bacteria | 2487 |
| 27 | Ga0070690_100157438 | 3300005330 | Bacteria | 1554 |
| 28 | Ga0070670_100002725 | 3300005331 | Bacteria | 14599 |
| 29 | Ga0070670_100034717 | 3300005331 | Bacteria | 4340 |
| 30 | Ga0070670_100065445 | 3300005331 | Bacteria | 3119 |
| 31 | Ga0070670_100994455 | 3300005331 | Bacteria | 763 |
| 32 | Ga0068869_100000728 | 3300005334 | Bacteria | 18720 |
| 33 | Ga0068869_101550017 | 3300005334 | Bacteria | 589 |
| 34 | Ga0070666_10000623 | 3300005335 | Bacteria | 21258 |
| 35 | Ga0070666_10033780 | 3300005335 | Bacteria | 3387 |
| 36 | Ga0070680_101712779 | 3300005336 | Unclassified | 545 |
| 37 | Ga0070682_100012598 | 3300005337 | Bacteria | 4851 |
| 38 | Ga0068868_100006361 | 3300005338 | Bacteria | 8354 |
| 39 | Ga0068868_100645563 | 3300005338 | Bacteria | 942 |
| 40 | Ga0070660_100000560 | 3300005339 | Bacteria | 24966 |
| 41 | Ga0070660_100233247 | 3300005339 | Unclassified | 1497 |
| 42 | Ga0070660_100298812 | 3300005339 | Bacteria | 1320 |
| 43 | Ga0070660_100557161 | 3300005339 | Bacteria | 956 |
| 44 | Ga0070660_100618015 | 3300005339 | Unclassified | 907 |
| 45 | Ga0070660_101556080 | 3300005339 | Bacteria | 562 |
| 46 | Ga0070660_101643002 | 3300005339 | Bacteria | 547 |
| 47 | Ga0070660_101932395 | 3300005339 | Unclassified | 503 |
| 48 | Ga0070689_100129460 | 3300005340 | Bacteria | 2023 |
| 49 | Ga0070661_100000075 | 3300005344 | Bacteria | 79164 |
| 50 | Ga0070661_100012615 | 3300005344 | Bacteria | 5913 |
| 51 | Ga0070661_100053915 | 3300005344 | Bacteria | 2945 |
| 52 | Ga0070661_100845167 | 3300005344 | Bacteria | 753 |
| 53 | Ga0070661_100865048 | 3300005344 | Bacteria | 745 |
| 54 | Ga0070692_10611819 | 3300005345 | Bacteria | 722 |
| 55 | Ga0070668_100238951 | 3300005347 | Unclassified | 1504 |
| 56 | Ga0070669_100000565 | 3300005353 | Bacteria | 27565 |
| 57 | Ga0070669_100239061 | 3300005353 | Bacteria | 1442 |
| 58 | Ga0070669_100573039 | 3300005353 | Bacteria | 943 |
| 59 | Ga0070675_100043992 | 3300005354 | Bacteria | 3652 |
| 60 | Ga0070675_100719424 | 3300005354 | Unclassified | 910 |
| 61 | Ga0070675_101645997 | 3300005354 | Unclassified | 592 |
| 62 | Ga0070671_100040800 | 3300005355 | Bacteria | 3856 |
| 63 | Ga0070671_100062925 | 3300005355 | Bacteria | 3089 |
| 64 | Ga0070671_101653758 | 3300005355 | Bacteria | 568 |
| 65 | Ga0070674_100010817 | 3300005356 | Bacteria | 5533 |
| 66 | Ga0070674_100542519 | 3300005356 | Bacteria | 974 |
| 67 | Ga0070673_100010306 | 3300005364 | Bacteria | 6321 |
| 68 | Ga0070673_101539176 | 3300005364 | Bacteria | 628 |
| 69 | Ga0070659_100004211 | 3300005366 | Bacteria | 10269 |
| 70 | Ga0070659_100004345 | 3300005366 | Bacteria | 10118 |
| 71 | Ga0070659_100010071 | 3300005366 | Bacteria | 6960 |
| 72 | Ga0070659_100068069 | 3300005366 | Bacteria | 2824 |
| 73 | Ga0070659_100189959 | 3300005366 | Bacteria | 1688 |
| 74 | Ga0070659_100321637 | 3300005366 | Bacteria | 1293 |
| 75 | Ga0070659_100330303 | 3300005366 | Unclassified | 1276 |
| 76 | Ga0070659_101215312 | 3300005366 | Bacteria | 667 |
| 77 | Ga0070659_101485069 | 3300005366 | Bacteria | 604 |
| 78 | Ga0070667_100002091 | 3300005367 | Bacteria | 17620 |
| 79 | Ga0070667_100091190 | 3300005367 | Bacteria | 2620 |
| 80 | Ga0070667_100114429 | 3300005367 | Bacteria | 2342 |
| 81 | Ga0070714_100455907 | 3300005435 | Bacteria | 1215 |
| 82 | Ga0070714_101970003 | 3300005435 | Bacteria | 570 |
| 83 | Ga0070701_11141507 | 3300005438 | Bacteria | 550 |
| 84 | Ga0070700_101026994 | 3300005441 | Bacteria | 679 |
| 85 | Ga0070663_100004025 | 3300005455 | Bacteria | 8576 |
| 86 | Ga0070663_100049278 | 3300005455 | Bacteria | 2990 |
| 87 | Ga0070663_100096689 | 3300005455 | Bacteria | 2197 |
| 88 | Ga0070678_101060444 | 3300005456 | Bacteria | 747 |
| 89 | Ga0070662_100003155 | 3300005457 | Bacteria | 10241 |
| 90 | Ga0070662_100003479 | 3300005457 | Bacteria | 9817 |
| 91 | Ga0070662_100017276 | 3300005457 | Bacteria | 4861 |
| 92 | Ga0070662_100188363 | 3300005457 | Unclassified | 1630 |
| 93 | Ga0068867_100008041 | 3300005459 | Bacteria | 7453 |
| 94 | Ga0068867_100122997 | 3300005459 | Bacteria | 2007 |
| 95 | Ga0070685_10237222 | 3300005466 | Unclassified | 1202 |
| 96 | Ga0070684_100097876 | 3300005535 | Bacteria | 2617 |
| 97 | Ga0068853_100006609 | 3300005539 | Bacteria | 9230 |
| 98 | Ga0068853_100032999 | 3300005539 | Bacteria | 4389 |
| 99 | Ga0068853_101291893 | 3300005539 | Bacteria | 705 |
| 100 | Ga0070672_100061279 | 3300005543 | Bacteria | 2965 |
| 101 | Ga0070672_100089143 | 3300005543 | Bacteria | 2485 |
| 102 | Ga0070693_100019899 | 3300005547 | Bacteria | 3530 |
| 103 | Ga0070665_100005836 | 3300005548 | Bacteria | 12629 |
| 104 | Ga0070665_100027367 | 3300005548 | Bacteria | 5744 |
| 105 | Ga0070665_100382244 | 3300005548 | Bacteria | 1415 |
| 106 | Ga0070665_100925679 | 3300005548 | Bacteria | 884 |
| 107 | Ga0068855_100002720 | 3300005563 | Bacteria | 21788 |
| 108 | Ga0068855_100054360 | 3300005563 | Bacteria | 4706 |
| 109 | Ga0068855_100294384 | 3300005563 | Bacteria | 1799 |
| 110 | Ga0068855_101005715 | 3300005563 | Bacteria | 876 |
| 111 | Ga0068855_102382175 | 3300005563 | Bacteria | 528 |
| 112 | Ga0070664_100004841 | 3300005564 | Bacteria | 10784 |
| 113 | Ga0070664_100148690 | 3300005564 | Bacteria | 2067 |
| 114 | Ga0070664_100809911 | 3300005564 | Bacteria | 876 |
| 115 | Ga0070664_101197154 | 3300005564 | Bacteria | 717 |
| 116 | Ga0070664_101991089 | 3300005564 | Unclassified | 551 |
| 117 | Ga0068857_100002337 | 3300005577 | Bacteria | 15430 |
| 118 | Ga0068857_100011311 | 3300005577 | Bacteria | 7764 |
| 119 | Ga0068857_101287420 | 3300005577 | Bacteria | 709 |
| 120 | Ga0068854_100028696 | 3300005578 | Bacteria | 3847 |
| 121 | Ga0068854_100116632 | 3300005578 | Unclassified | 2021 |
| 122 | Ga0068854_100225714 | 3300005578 | Bacteria | 1484 |
| 123 | Ga0068854_100237794 | 3300005578 | Bacteria | 1449 |
| 124 | Ga0068856_100000538 | 3300005614 | Bacteria | 41802 |
| 125 | Ga0068856_100112232 | 3300005614 | Bacteria | 2723 |
| 126 | Ga0068856_100230506 | 3300005614 | Bacteria | 1867 |
| 127 | Ga0068856_100246487 | 3300005614 | Bacteria | 1802 |
| 128 | Ga0068856_101258322 | 3300005614 | Bacteria | 756 |
| 129 | Ga0070702_100177155 | 3300005615 | Bacteria | 1392 |
| 130 | Ga0068852_100001259 | 3300005616 | Bacteria | 16883 |
| 131 | Ga0068852_100053492 | 3300005616 | Bacteria | 3475 |
| 132 | Ga0068852_100260972 | 3300005616 | Bacteria | 1663 |
| 133 | Ga0068852_100706425 | 3300005616 | Bacteria | 1018 |
| 134 | Ga0068859_100060129 | 3300005617 | Bacteria | 3829 |
| 135 | Ga0068859_102924392 | 3300005617 | Unclassified | 523 |
| 136 | Ga0068864_100001241 | 3300005618 | Bacteria | 21225 |
| 137 | Ga0068864_100010872 | 3300005618 | Bacteria | 7524 |
| 138 | Ga0068864_100080885 | 3300005618 | Bacteria | 2847 |
| 139 | Ga0068866_10055233 | 3300005718 | Bacteria | 2039 |
| 140 | Ga0068861_100717386 | 3300005719 | Bacteria | 931 |
| 141 | Ga0068851_10009861 | 3300005834 | Bacteria | 4448 |
| 142 | Ga0068870_10674752 | 3300005840 | Bacteria | 710 |
| 143 | Ga0068863_100008879 | 3300005841 | Bacteria | 9813 |
| 144 | Ga0068863_100293271 | 3300005841 | Bacteria | 1577 |
| 145 | Ga0068858_100050928 | 3300005842 | Bacteria | 3832 |
| 146 | Ga0068858_100181733 | 3300005842 | Bacteria | 1986 |
| 147 | Ga0068858_101875986 | 3300005842 | Unclassified | 592 |
| 148 | Ga0068860_100070910 | 3300005843 | Bacteria | 3312 |
| 149 | Ga0068860_100243529 | 3300005843 | Bacteria | 1749 |
| 150 | Ga0068860_100548700 | 3300005843 | Bacteria | 1158 |
| 151 | Ga0068860_101104620 | 3300005843 | Bacteria | 812 |
| 152 | Ga0068860_101317612 | 3300005843 | Unclassified | 743 |
| 153 | Ga0068862_101414856 | 3300005844 | Bacteria | 699 |
| 154 | Ga0075362_10185252 | 3300006177 | Unclassified | 1010 |
| 155 | Ga0075366_10064254 | 3300006195 | Bacteria | 2183 |
| 156 | Ga0075366_10156186 | 3300006195 | Bacteria | 1382 |
| 157 | Ga0097621_100501650 | 3300006237 | Bacteria | 1099 |
| 158 | Ga0075370_10374496 | 3300006353 | Bacteria | 852 |
| 159 | Ga0068871_100314255 | 3300006358 | Bacteria | 1378 |
| 160 | Ga0068871_100770893 | 3300006358 | Unclassified | 885 |
| 161 | Ga0068865_100005554 | 3300006881 | Bacteria | 7648 |
| 162 | Ga0097620_100060129 | 3300006931 | Bacteria | 3829 |
| 163 | Ga0097620_102923561 | 3300006931 | Unclassified | 523 |
| 164 | Ga0105240_10251421 | 3300009093 | Unclassified | 2044 |
| 165 | Ga0105245_10000782 | 3300009098 | Bacteria | 28837 |
| 166 | Ga0105243_10128177 | 3300009148 | Bacteria | 2149 |
| 167 | Ga0105241_10060615 | 3300009174 | Bacteria | 2911 |
| 168 | Ga0105241_10384031 | 3300009174 | Bacteria | 1228 |
| 169 | Ga0105242_10208097 | 3300009176 | Bacteria | 1741 |
| 170 | Ga0105248_10000443 | 3300009177 | Bacteria | 47083 |
| 171 | Ga0105248_10003845 | 3300009177 | Bacteria | 16630 |
| 172 | Ga0105248_10101834 | 3300009177 | Bacteria | 3237 |
| 173 | Ga0105248_10681596 | 3300009177 | Bacteria | 1160 |
| 174 | Ga0105248_12025696 | 3300009177 | Bacteria | 654 |
| 175 | Ga0105238_10079835 | 3300009551 | Bacteria | 3261 |
| 176 | Ga0105239_10020946 | 3300010375 | Bacteria | 7213 |
| 177 | Ga0105246_10007706 | 3300011119 | Bacteria | 6605 |
| 178 | Ga0105246_10097921 | 3300011119 | Bacteria | 2130 |
| 179 | Ga0157373_10042025 | 3300013100 | Bacteria | 3268 |
| 180 | Ga0157373_10050093 | 3300013100 | Bacteria | 2975 |
| 181 | Ga0157373_10060575 | 3300013100 | Bacteria | 2681 |
| 182 | Ga0157373_10973855 | 3300013100 | Unclassified | 632 |
| 183 | Ga0157371_10005198 | 3300013102 | Bacteria | 11066 |
| 184 | Ga0157371_10008659 | 3300013102 | Bacteria | 8083 |
| 185 | Ga0157371_10058334 | 3300013102 | Bacteria | 2738 |
| 186 | Ga0157371_10402067 | 3300013102 | Unclassified | 1002 |
| 187 | Ga0157371_10741771 | 3300013102 | Bacteria | 737 |
| 188 | Ga0157371_11004210 | 3300013102 | Bacteria | 637 |
| 189 | Ga0157371_11226065 | 3300013102 | Bacteria | 579 |
| 190 | Ga0157370_10176867 | 3300013104 | Bacteria | 1983 |
| 191 | Ga0157370_10990875 | 3300013104 | Bacteria | 761 |
| 192 | Ga0157369_10151556 | 3300013105 | Bacteria | 2450 |
| 193 | Ga0157369_10313943 | 3300013105 | Bacteria | 1630 |
| 194 | Ga0157369_11743629 | 3300013105 | Unclassified | 633 |
| 195 | Ga0157374_10104177 | 3300013296 | Bacteria | 2723 |
| 196 | Ga0157374_10121425 | 3300013296 | Bacteria | 2522 |
| 197 | Ga0157374_11081040 | 3300013296 | Bacteria | 822 |
| 198 | Ga0157374_11704982 | 3300013296 | Bacteria | 655 |
| 199 | Ga0157378_10022210 | 3300013297 | Bacteria | 5584 |
| 200 | Ga0157378_11453793 | 3300013297 | Bacteria | 729 |
| 201 | Ga0163162_10160585 | 3300013306 | Bacteria | 2369 |
| 202 | Ga0163162_11555214 | 3300013306 | Bacteria | 754 |
| 203 | Ga0157372_10197417 | 3300013307 | Unclassified | 2331 |
| 204 | Ga0157372_10204285 | 3300013307 | Bacteria | 2289 |
| 205 | Ga0157372_10599810 | 3300013307 | Bacteria | 1284 |
| 206 | Ga0157372_10636881 | 3300013307 | Bacteria | 1242 |
| 207 | Ga0157372_11213320 | 3300013307 | Bacteria | 871 |
| 208 | Ga0157375_10115316 | 3300013308 | Bacteria | 2789 |
| 209 | Ga0157375_12973265 | 3300013308 | Unclassified | 566 |
| 210 | Ga0163163_10000058 | 3300014325 | Bacteria | 123478 |
| 211 | Ga0163163_10177794 | 3300014325 | Bacteria | 2175 |
| 212 | Ga0157380_11839815 | 3300014326 | Bacteria | 665 |
| 213 | Ga0157377_10063203 | 3300014745 | Bacteria | 2120 |
| 214 | Ga0157377_10171874 | 3300014745 | Unclassified | 1356 |
| 215 | Ga0157379_10012614 | 3300014968 | Bacteria | 7382 |
| 216 | Ga0157379_10147537 | 3300014968 | Bacteria | 2121 |
| 217 | Ga0206350_11096168 | 3300020080 | Bacteria | 561 |
| 218 | Ga0209257_1005674 | 3300025304 | Bacteria | 8604 |
| 219 | Ga0207697_10003187 | 3300025315 | Bacteria | 8160 |
| 220 | Ga0207656_10004042 | 3300025321 | Bacteria | 5090 |
| 221 | Ga0207656_10145172 | 3300025321 | Bacteria | 1121 |
| 222 | Ga0207642_10493520 | 3300025899 | Bacteria | 748 |
| 223 | Ga0207688_10203916 | 3300025901 | Bacteria | 1187 |
| 224 | Ga0207680_10012374 | 3300025903 | Bacteria | 4343 |
| 225 | Ga0207680_10035996 | 3300025903 | Bacteria | 2848 |
| 226 | Ga0207647_10013604 | 3300025904 | Bacteria | 5634 |
| 227 | Ga0207647_10016767 | 3300025904 | Bacteria | 4991 |
| 228 | Ga0207647_10047835 | 3300025904 | Bacteria | 2658 |
| 229 | Ga0207647_10067163 | 3300025904 | Bacteria | 2174 |
| 230 | Ga0207647_10085108 | 3300025904 | Bacteria | 1891 |
| 231 | Ga0207645_10015526 | 3300025907 | Bacteria | 5057 |
| 232 | Ga0207643_10125879 | 3300025908 | Bacteria | 1521 |
| 233 | Ga0207705_10002347 | 3300025909 | Bacteria | 14636 |
| 234 | Ga0207705_10089556 | 3300025909 | Bacteria | 2252 |
| 235 | Ga0207705_10103475 | 3300025909 | Bacteria | 2097 |
| 236 | Ga0207705_10174512 | 3300025909 | Bacteria | 1620 |
| 237 | Ga0207705_10299218 | 3300025909 | Bacteria | 1234 |
| 238 | Ga0207705_10496941 | 3300025909 | Unclassified | 947 |
| 239 | Ga0207705_10865480 | 3300025909 | Bacteria | 701 |
| 240 | Ga0207705_10914860 | 3300025909 | Bacteria | 679 |
| 241 | Ga0207705_10973361 | 3300025909 | Unclassified | 656 |
| 242 | Ga0207705_11323001 | 3300025909 | Unclassified | 550 |
| 243 | Ga0207654_10069321 | 3300025911 | Unclassified | 2089 |
| 244 | Ga0207654_10082082 | 3300025911 | Bacteria | 1943 |
| 245 | Ga0207695_10038233 | 3300025913 | Bacteria | 5169 |
| 246 | Ga0207695_10600691 | 3300025913 | Bacteria | 981 |
| 247 | Ga0207660_11230233 | 3300025917 | Bacteria | 609 |
| 248 | Ga0207657_10000126 | 3300025919 | Bacteria | 76430 |
| 249 | Ga0207657_10009347 | 3300025919 | Bacteria | 9867 |
| 250 | Ga0207657_10128352 | 3300025919 | Bacteria | 2080 |
| 251 | Ga0207657_10435724 | 3300025919 | Bacteria | 1029 |
| 252 | Ga0207657_10436475 | 3300025919 | Bacteria | 1028 |
| 253 | Ga0207657_11279539 | 3300025919 | Unclassified | 555 |
| 254 | Ga0207649_10000937 | 3300025920 | Bacteria | 18258 |
| 255 | Ga0207649_10004887 | 3300025920 | Bacteria | 7249 |
| 256 | Ga0207649_10650346 | 3300025920 | Bacteria | 814 |
| 257 | Ga0207652_10405992 | 3300025921 | Bacteria | 1229 |
| 258 | Ga0207652_10706333 | 3300025921 | Bacteria | 899 |
| 259 | Ga0207681_10010000 | 3300025923 | Bacteria | 5806 |
| 260 | Ga0207681_10325184 | 3300025923 | Bacteria | 1224 |
| 261 | Ga0207681_10353964 | 3300025923 | Bacteria | 1176 |
| 262 | Ga0207694_10200517 | 3300025924 | Bacteria | 1623 |
| 263 | Ga0207650_10003655 | 3300025925 | Bacteria | 10522 |
| 264 | Ga0207650_10011665 | 3300025925 | Bacteria | 6054 |
| 265 | Ga0207650_10032491 | 3300025925 | Bacteria | 3775 |
| 266 | Ga0207659_10469907 | 3300025926 | Bacteria | 1061 |
| 267 | Ga0207659_11659972 | 3300025926 | Unclassified | 545 |
| 268 | Ga0207687_10013795 | 3300025927 | Bacteria | 5278 |
| 269 | Ga0207644_10012689 | 3300025931 | Bacteria | 5601 |
| 270 | Ga0207644_10068554 | 3300025931 | Bacteria | 2588 |
| 271 | Ga0207690_10000106 | 3300025932 | Bacteria | 67786 |
| 272 | Ga0207690_10006739 | 3300025932 | Bacteria | 6808 |
| 273 | Ga0207690_10021928 | 3300025932 | Bacteria | 3967 |
| 274 | Ga0207690_10069367 | 3300025932 | Bacteria | 2425 |
| 275 | Ga0207690_10752391 | 3300025932 | Bacteria | 803 |
| 276 | Ga0207690_10773564 | 3300025932 | Bacteria | 792 |
| 277 | Ga0207690_10825599 | 3300025932 | Unclassified | 767 |
| 278 | Ga0207690_10880787 | 3300025932 | Bacteria | 742 |
| 279 | Ga0207706_10000151 | 3300025933 | Bacteria | 76455 |
| 280 | Ga0207706_10005896 | 3300025933 | Bacteria | 11395 |
| 281 | Ga0207706_10029147 | 3300025933 | Bacteria | 4928 |
| 282 | Ga0207670_10113380 | 3300025936 | Bacteria | 1958 |
| 283 | Ga0207669_10009539 | 3300025937 | Bacteria | 4631 |
| 284 | Ga0207669_10094289 | 3300025937 | Bacteria | 1958 |
| 285 | Ga0207704_10006757 | 3300025938 | Bacteria | 5376 |
| 286 | Ga0207691_10007770 | 3300025940 | Bacteria | 10327 |
| 287 | Ga0207691_10134197 | 3300025940 | Bacteria | 2185 |
| 288 | Ga0207711_10001912 | 3300025941 | Bacteria | 18916 |
| 289 | Ga0207711_10004040 | 3300025941 | Bacteria | 12594 |
| 290 | Ga0207711_10020785 | 3300025941 | Bacteria | 5477 |
| 291 | Ga0207711_10279823 | 3300025941 | Bacteria | 1536 |
| 292 | Ga0207689_10000167 | 3300025942 | Bacteria | 57116 |
| 293 | Ga0207689_11567860 | 3300025942 | Bacteria | 549 |
| 294 | Ga0207661_10006497 | 3300025944 | Bacteria | 8265 |
| 295 | Ga0207661_11169757 | 3300025944 | Bacteria | 708 |
| 296 | Ga0207679_10002382 | 3300025945 | Bacteria | 11568 |
| 297 | Ga0207679_10475078 | 3300025945 | Bacteria | 1112 |
| 298 | Ga0207667_10002108 | 3300025949 | Bacteria | 24944 |
| 299 | Ga0207667_10042138 | 3300025949 | Bacteria | 4854 |
| 300 | Ga0207667_10284484 | 3300025949 | Bacteria | 1690 |
| 301 | Ga0207651_10009127 | 3300025960 | Bacteria | 5402 |
| 302 | Ga0207668_10071748 | 3300025972 | Bacteria | 2475 |
| 303 | Ga0207640_10025143 | 3300025981 | Bacteria | 3601 |
| 304 | Ga0207640_10035980 | 3300025981 | Bacteria | 3104 |
| 305 | Ga0207640_10077650 | 3300025981 | Bacteria | 2258 |
| 306 | Ga0207640_10249811 | 3300025981 | Bacteria | 1376 |
| 307 | Ga0207658_10002624 | 3300025986 | Bacteria | 13051 |
| 308 | Ga0207658_10029117 | 3300025986 | Bacteria | 3896 |
| 309 | Ga0207677_10043649 | 3300026023 | Bacteria | 2982 |
| 310 | Ga0207703_10115143 | 3300026035 | Bacteria | 2300 |
| 311 | Ga0207703_10156311 | 3300026035 | Bacteria | 1993 |
| 312 | Ga0207639_10000573 | 3300026041 | Bacteria | 25324 |
| 313 | Ga0207639_10002893 | 3300026041 | Bacteria | 11542 |
| 314 | Ga0207639_11025388 | 3300026041 | Bacteria | 773 |
| 315 | Ga0207678_10006756 | 3300026067 | Bacteria | 10174 |
| 316 | Ga0207678_10010888 | 3300026067 | Bacteria | 7992 |
| 317 | Ga0207678_10040488 | 3300026067 | Bacteria | 4041 |
| 318 | Ga0207678_10044567 | 3300026067 | Bacteria | 3837 |
| 319 | Ga0207678_10570384 | 3300026067 | Bacteria | 991 |
| 320 | Ga0207702_10001045 | 3300026078 | Bacteria | 28350 |
| 321 | Ga0207702_10092718 | 3300026078 | Bacteria | 2648 |
| 322 | Ga0207702_10226895 | 3300026078 | Bacteria | 1743 |
| 323 | Ga0207702_10647226 | 3300026078 | Bacteria | 1039 |
| 324 | Ga0207702_11381153 | 3300026078 | Bacteria | 698 |
| 325 | Ga0207641_10006636 | 3300026088 | Bacteria | 9715 |
| 326 | Ga0207641_12604265 | 3300026088 | Bacteria | 504 |
| 327 | Ga0207648_10001222 | 3300026089 | Bacteria | 28812 |
| 328 | Ga0207648_10016014 | 3300026089 | Bacteria | 6869 |
| 329 | Ga0207676_10007892 | 3300026095 | Bacteria | 7571 |
| 330 | Ga0207676_10016650 | 3300026095 | Bacteria | 5325 |
| 331 | Ga0207676_10031648 | 3300026095 | Bacteria | 3980 |
| 332 | Ga0207676_10107859 | 3300026095 | Bacteria | 2323 |
| 333 | Ga0207676_10251030 | 3300026095 | Bacteria | 1592 |
| 334 | Ga0207676_11417808 | 3300026095 | Bacteria | 691 |
| 335 | Ga0207674_10002073 | 3300026116 | Bacteria | 25416 |
| 336 | Ga0207674_10003779 | 3300026116 | Bacteria | 18470 |
| 337 | Ga0207674_10635407 | 3300026116 | Bacteria | 1031 |
| 338 | Ga0207675_100045075 | 3300026118 | Bacteria | 4120 |
| 339 | Ga0207698_10002899 | 3300026142 | Bacteria | 10260 |
| 340 | Ga0207698_10026332 | 3300026142 | Bacteria | 4113 |
| 341 | Ga0207698_10049615 | 3300026142 | Bacteria | 3196 |
| 342 | Ga0207698_10530824 | 3300026142 | Bacteria | 1150 |
| 343 | Ga0268266_10000950 | 3300028379 | Bacteria | 36937 |
| 344 | Ga0268266_10017332 | 3300028379 | Bacteria | 6147 |
| 345 | Ga0268266_10828334 | 3300028379 | Bacteria | 894 |
| 346 | Ga0307515_10359232 | 3300028794 | Bacteria | 1099 |
| 347 | Ga0307408_100081935 | 3300031548 | Bacteria | 2414 |
| 348 | Ga0307405_10115273 | 3300031731 | Bacteria | 1828 |
| 349 | Ga0307413_10033984 | 3300031824 | Bacteria | 2909 |
| 350 | Ga0307413_11081818 | 3300031824 | Bacteria | 691 |
| 351 | Ga0307413_11253256 | 3300031824 | Bacteria | 647 |
| 352 | Ga0307410_10015921 | 3300031852 | Bacteria | 4470 |
| 353 | Ga0307410_10426408 | 3300031852 | Bacteria | 1077 |
| 354 | Ga0307407_10979547 | 3300031903 | Bacteria | 652 |
| 355 | Ga0307412_10269777 | 3300031911 | Bacteria | 1331 |
| 356 | Ga0307409_100007295 | 3300031995 | Bacteria | 6600 |
| 357 | Ga0307409_101047440 | 3300031995 | Bacteria | 835 |
| 358 | Ga0307416_100011123 | 3300032002 | Bacteria | 5985 |
| 359 | Ga0307416_102897196 | 3300032002 | Bacteria | 574 |
| 360 | Ga0307414_10019348 | 3300032004 | Bacteria | 4217 |
| 361 | Ga0307414_10276570 | 3300032004 | Bacteria | 1409 |
| 362 | Ga0307411_10006880 | 3300032005 | Bacteria | 5733 |
| 363 | Ga0307411_10196236 | 3300032005 | Bacteria | 1546 |
| 364 | Ga0307411_10647321 | 3300032005 | Bacteria | 914 |
| 365 | Ga0307415_100001290 | 3300032126 | Bacteria | 11817 |
| 366 | Ga0307415_100049467 | 3300032126 | Bacteria | 2843 |
| 367 | Ga0373951_0141259 | 3300035091 | Bacteria | 669 |
| 368 | Ga0373939_0027810 | 3300035114 | Bacteria | 1605 |
| 369 | Ga0373943_0007352 | 3300035170 | Bacteria | 4945 |
| 370 | Ga0373946_0016959 | 3300035171 | Bacteria | 2781 |
| 371 | Ga0373942_0126811 | 3300035207 | Bacteria | 802 |
| 372 | Ga0373962_0048664 | 3300035242 | Bacteria | 1216 |
| 373 | Ga0373931_0308469 | 3300035691 | Bacteria | 979 |
| 374 | Ga0373935_0420357 | 3300035692 | Bacteria | 962 |
| 375 | Ga0373927_0057767 | 3300035695 | Bacteria | 2509 |
| 376 | Ga0373925_0033179 | 3300037068 | Bacteria | 3805 |
| 377 | Ga0395899_0025167 | 3300037312 | Bacteria | 4495 |
| 378 | Ga0395899_0030099 | 3300037312 | Bacteria | 4084 |
| 379 | Ga0395899_0054789 | 3300037312 | Bacteria | 2950 |
| 380 | Ga0395899_0089925 | 3300037312 | Bacteria | 2226 |
| 381 | Ga0395899_0410681 | 3300037312 | Bacteria | 894 |
| 382 | Ga0395899_0476198 | 3300037312 | Bacteria | 814 |
| 383 | Ga0395900_0007724 | 3300037418 | Bacteria | 11091 |
| 384 | Ga0395900_0022607 | 3300037418 | Bacteria | 6435 |
| 385 | Ga0395900_0027275 | 3300037418 | Bacteria | 5848 |
| 386 | Ga0395900_0033836 | 3300037418 | Bacteria | 5259 |
| 387 | Ga0395900_0073120 | 3300037418 | Bacteria | 3524 |
| 388 | Ga0395900_0085076 | 3300037418 | Bacteria | 3250 |
| 389 | Ga0395900_0108524 | 3300037418 | Bacteria | 2851 |
| 390 | Ga0395900_0131992 | 3300037418 | Bacteria | 2559 |
| 391 | Ga0395900_0196244 | 3300037418 | Bacteria | 2045 |
| 392 | Ga0395900_0206376 | 3300037418 | Bacteria | 1986 |
| 393 | Ga0395900_0273050 | 3300037418 | Bacteria | 1685 |
| 394 | Ga0395900_0401685 | 3300037418 | Bacteria | 1334 |
| 395 | Ga0395900_0408822 | 3300037418 | Bacteria | 1320 |
| 396 | Ga0395900_0458836 | 3300037418 | Bacteria | 1229 |
| 397 | Ga0395900_0922985 | 3300037418 | Bacteria | 795 |
| 398 | Ga0395900_1326620 | 3300037418 | Bacteria | 633 |
| 399 | Ga0395900_1812479 | 3300037418 | Bacteria | 521 |
| 400 | Ga0395898_0008927 | 3300037466 | Bacteria | 10558 |
| 401 | Ga0395898_0016010 | 3300037466 | Bacteria | 7680 |
| 402 | Ga0395898_0055058 | 3300037466 | Bacteria | 3880 |
| 403 | Ga0395898_0199573 | 3300037466 | Bacteria | 1910 |
| 404 | Ga0395898_0251225 | 3300037466 | Bacteria | 1686 |
| 405 | Ga0395898_0300269 | 3300037466 | Bacteria | 1532 |
| 406 | Ga0395898_0588861 | 3300037466 | Bacteria | 1055 |
| 407 | Ga0395898_0932874 | 3300037466 | Bacteria | 805 |
| 408 | Ga0395898_1733103 | 3300037466 | Bacteria | 547 |
| 409 | Ga0395905_0009247 | 3300037471 | Bacteria | 9646 |
| 410 | Ga0395905_0010012 | 3300037471 | Bacteria | 9241 |
| 411 | Ga0395905_0014735 | 3300037471 | Bacteria | 7455 |
| 412 | Ga0395905_0040657 | 3300037471 | Bacteria | 4362 |
| 413 | Ga0395905_0058199 | 3300037471 | Bacteria | 3614 |
| 414 | Ga0395905_0102517 | 3300037471 | Bacteria | 2686 |
| 415 | Ga0395905_0113152 | 3300037471 | Bacteria | 2549 |
| 416 | Ga0395905_0123225 | 3300037471 | Bacteria | 2437 |
| 417 | Ga0395905_0219643 | 3300037471 | Bacteria | 1779 |
| 418 | Ga0395905_0254464 | 3300037471 | Bacteria | 1640 |
| 419 | Ga0395905_0592483 | 3300037471 | Bacteria | 1010 |
| 420 | Ga0395905_1035231 | 3300037471 | Bacteria | 724 |
| 421 | Ga0395905_1147405 | 3300037471 | Bacteria | 680 |
| 422 | Ga0436364_0219673 | 3300037853 | Bacteria | 931 |
| 423 | Ga0436364_0755345 | 3300037853 | Bacteria | 36897 |
| 424 | Ga0395901_0006189 | 3300038443 | Bacteria | 12126 |
| 425 | Ga0395901_0007713 | 3300038443 | Bacteria | 10854 |
| 426 | Ga0395901_0023864 | 3300038443 | Bacteria | 6273 |
| 427 | Ga0395901_0025512 | 3300038443 | Bacteria | 6068 |
| 428 | Ga0395901_0035010 | 3300038443 | Bacteria | 5188 |
| 429 | Ga0395901_0043349 | 3300038443 | Bacteria | 4668 |
| 430 | Ga0395901_0044592 | 3300038443 | Bacteria | 4599 |
| 431 | Ga0395901_0048833 | 3300038443 | Bacteria | 4395 |
| 432 | Ga0395901_0167363 | 3300038443 | Bacteria | 2307 |
| 433 | Ga0395901_0284858 | 3300038443 | Bacteria | 1716 |
| 434 | Ga0395901_0428250 | 3300038443 | Unclassified | 1356 |
| 435 | Ga0395901_0582015 | 3300038443 | Bacteria | 1131 |
| 436 | Ga0395901_1213635 | 3300038443 | Bacteria | 719 |
| 437 | Ga0451798_1147024 | 3300041458 | Bacteria | 751 |
| 438 | Ga0439445_0020157 | 3300042004 | Bacteria | 1667 |
| 439 | Ga0439448_0004253 | 3300042005 | Bacteria | 4035 |
| 440 | Ga0439432_044624 | 3300042006 | Bacteria | 1396 |
| 441 | Ga0439449_0047741 | 3300042007 | Bacteria | 1585 |
| 442 | Ga0439455_0151325 | 3300042012 | Bacteria | 660 |
| 443 | Ga0439457_062596 | 3300042014 | Bacteria | 844 |
| 444 | Ga0450923_016796 | 3300042125 | Bacteria | 1383 |
| 445 | Ga0450923_196282 | 3300042125 | Bacteria | 501 |
| 446 | Ga0450898_089057 | 3300042134 | Bacteria | 635 |
| 447 | Ga0439458_0000154 | 3300042157 | Bacteria | 15118 |
| 448 | Ga0439458_0000268 | 3300042157 | Bacteria | 12769 |
| 449 | Ga0466969_0342983 | 3300044656 | Bacteria | 676 |
| 450 | Ga0466972_0086811 | 3300044658 | Bacteria | 1487 |
| 451 | Ga0466965_0698772 | 3300044683 | Bacteria | 582 |
| 452 | Ga0466965_0823072 | 3300044683 | Unclassified | 538 |
| 453 | Ga0466966_0102477 | 3300044684 | Bacteria | 1769 |
| 454 | Ga0466963_0011810 | 3300044694 | Bacteria | 5328 |
| 455 | Ga0466963_0016999 | 3300044694 | Bacteria | 4531 |
| 456 | Ga0466963_0874574 | 3300044694 | Bacteria | 633 |
| 457 | Ga0466963_1228140 | 3300044694 | Unclassified | 526 |
| 458 | Ga0466964_0478975 | 3300044706 | Bacteria | 665 |
| 459 | Ga0466970_0038621 | 3300044765 | Bacteria | 2533 |
| 460 | Ga0466970_0062943 | 3300044765 | Bacteria | 1989 |
| 461 | Ga0466957_0062554 | 3300044842 | Bacteria | 2286 |
| 462 | Ga0466957_0103080 | 3300044842 | Bacteria | 1801 |
| 463 | Ga0466957_0239652 | 3300044842 | Bacteria | 1203 |
| 464 | Ga0466957_0339745 | 3300044842 | Bacteria | 1017 |
| 465 | Ga0466957_0363780 | 3300044842 | Bacteria | 984 |
| 466 | Ga0466957_0915841 | 3300044842 | Bacteria | 627 |
| 467 | Ga0466959_0206105 | 3300045049 | Bacteria | 1368 |
| 468 | Ga0466967_0007211 | 3300045976 | Bacteria | 7988 |
| 469 | Ga0466967_0034787 | 3300045976 | Bacteria | 4281 |
| 470 | Ga0466967_0186458 | 3300045976 | Bacteria | 1959 |
| 471 | Ga0466967_0210844 | 3300045976 | Bacteria | 1842 |
| 472 | Ga0466967_0308512 | 3300045976 | Bacteria | 1524 |
| 473 | Ga0466967_0371621 | 3300045976 | Bacteria | 1387 |
| 474 | Ga0466967_0584268 | 3300045976 | Bacteria | 1101 |
| 475 | Ga0466967_0718956 | 3300045976 | Bacteria | 990 |
| 476 | Ga0466967_1650810 | 3300045976 | Bacteria | 638 |
| 477 | Ga0495597_0016597 | 3300046542 | Bacteria | 3477 |
| 478 | Ga0495668_0209510 | 3300046616 | Bacteria | 1067 |
| 479 | Ga0495668_0564200 | 3300046616 | Bacteria | 628 |
| 480 | Ga0495625_0042984 | 3300046660 | Bacteria | 3280 |
| 481 | Ga0495669_0085688 | 3300046684 | Bacteria | 1450 |
| 482 | Ga0495670_0000066 | 3300046691 | Bacteria | 46500 |
| 483 | Ga0496101_0318541 | 3300048904 | Bacteria | 1220 |
| 484 | Ga0496106_1246089 | 3300048909 | Bacteria | 579 |
| 485 | Ga0496107_0186800 | 3300048910 | Bacteria | 1539 |
| 486 | Ga0496107_0721599 | 3300048910 | Bacteria | 732 |
| 487 | Ga0496108_0145985 | 3300048911 | Bacteria | 2040 |
| 488 | Ga0496109_0191881 | 3300048912 | Bacteria | 1920 |
| 489 | Ga0496109_0692541 | 3300048912 | Bacteria | 956 |
| 490 | Ga0496109_1665466 | 3300048912 | Bacteria | 572 |
| 491 | Ga0496109_1856184 | 3300048912 | Bacteria | 535 |
| 492 | Ga0496110_0061180 | 3300048913 | Bacteria | 3323 |
| 493 | Ga0496110_0102725 | 3300048913 | Bacteria | 2564 |
| 494 | Ga0496110_0644424 | 3300048913 | Bacteria | 959 |
| 495 | Ga0496110_1649394 | 3300048913 | Bacteria | 551 |
| 496 | Ga0496111_0158133 | 3300048914 | Bacteria | 1682 |
| 497 | Ga0496111_0362500 | 3300048914 | Bacteria | 1073 |
| 498 | Ga0496111_0487054 | 3300048914 | Bacteria | 908 |
| 499 | Ga0496112_0475772 | 3300048915 | Unclassified | 1186 |
| 500 | Ga0501295_183902 | 3300049518 | Bacteria | 525 |
| 501 | Ga0501225_0058248 | 3300049705 | Bacteria | 1084 |
| 502 | Ga0501269_052849 | 3300049766 | Bacteria | 562 |
| 503 | nmdc:mga03683_185133_c1 | 3300050489 | Unclassified | 951 |
| 504 | nmdc:mga0k408_159862_c1 | 3300050493 | Bacteria | 1342 |
| 505 | nmdc:mga0k408_226820_c1 | 3300050493 | Bacteria | 1115 |
| 506 | nmdc:mga07m45_122327_c1 | 3300050496 | Bacteria | 1503 |
| 507 | Ga0500643_006643 | 3300053087 | Bacteria | 4804 |
| 508 | Ga0500566_0000560 | 3300053094 | Bacteria | 20897 |
| 509 | Ga0500650_0107524 | 3300053098 | Bacteria | 1303 |
| 510 | Ga0500556_0000014 | 3300053104 | Bacteria | 232989 |
| 511 | Ga0500557_113302 | 3300053105 | Bacteria | 900 |
| 512 | Ga0500562_012077 | 3300053108 | Bacteria | 2194 |
| 513 | Ga0500562_067615 | 3300053108 | Bacteria | 963 |
| 514 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 515 | Ga0500652_231109 | 3300053131 | Bacteria | 740 |
| 516 | Ga0500627_0147707 | 3300053158 | Bacteria | 1062 |
| 517 | Ga0500645_006494 | 3300053730 | Bacteria | 4162 |
| 518 | Ga0500596_058333 | 3300053735 | Bacteria | 642 |
| 519 | Ga0587084_045075 | 3300059477 | Bacteria | 763 |
| 520 | Ga0466962_0059360 | 3300061719 | Bacteria | 1826 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053735 | Ga0500596_058333 | Ga0500596_058333_24_320 | 93 |
| 2 | 3300049705 | Ga0501225_0058248 | Ga0501225_0058248_314_610 | 94 |
| 3 | iso_pu_bacteria | 2848297114 | 2848297393 | 94 |
| 4 | 3300037418 | Ga0395900_1812479 | Ga0395900_1812479_104_448 | 97 |
| 5 | 3300042004 | Ga0439445_0020157 | Ga0439445_0020157_649_975 | 97 |
| 6 | 3300042125 | Ga0450923_016796 | Ga0450923_016796_647_973 | 97 |
| 7 | iso_pu_bacteria | 2808606401 | 2809065342 | 98 |
| 8 | iso_pu_bacteria | 2808606404 | 2809081266 | 98 |
| 9 | iso_pu_bacteria | 2808606405 | 2809085631 | 98 |
| 10 | iso_pu_bacteria | 2880518877 | 2880520814 | 98 |
| 11 | 3300045976 | Ga0466967_0584268 | Ga0466967_0584268_441_767 | 99 |
| 12 | 3300005435 | Ga0070714_100455907 | Ga0070714_1004559072 | 100 |
| 13 | 3300037312 | Ga0395899_0054789 | Ga0395899_0054789_215_559 | 100 |
| 14 | 3300037418 | Ga0395900_0007724 | Ga0395900_0007724_7031_7375 | 100 |
| 15 | 3300037466 | Ga0395898_0008927 | Ga0395898_0008927_2264_2608 | 100 |
| 16 | 3300037471 | Ga0395905_0058199 | Ga0395905_0058199_2969_3313 | 100 |
| 17 | 3300038443 | Ga0395901_0025512 | Ga0395901_0025512_1538_1882 | 100 |
| 18 | 3300044694 | Ga0466963_0011810 | Ga0466963_0011810_59_403 | 100 |
| 19 | 3300044842 | Ga0466957_0915841 | Ga0466957_0915841_215_559 | 100 |
| 20 | 3300045976 | Ga0466967_0034787 | Ga0466967_0034787_3676_4020 | 100 |
| 21 | 3300046691 | Ga0495670_0000066 | Ga0495670_0000066_30046_30363 | 100 |
| 22 | 3300053158 | Ga0500627_0147707 | Ga0500627_0147707_577_894 | 100 |
| 23 | 3300005367 | Ga0070667_100114429 | Ga0070667_1001144294 | 103 |
| 24 | 3300005843 | Ga0068860_100070910 | Ga0068860_1000709106 | 103 |
| 25 | 3300025304 | Ga0209257_1005674 | Ga0209257_10056743 | 103 |
| 26 | 3300025913 | Ga0207695_10038233 | Ga0207695_100382337 | 103 |
| 27 | 3300028794 | Ga0307515_10359232 | Ga0307515_103592322 | 103 |
| 28 | 3300037312 | Ga0395899_0089925 | Ga0395899_0089925_981_1304 | 103 |
| 29 | 3300037418 | Ga0395900_0922985 | Ga0395900_0922985_18_341 | 103 |
| 30 | 3300037466 | Ga0395898_0932874 | Ga0395898_0932874_276_599 | 103 |
| 31 | 3300038443 | Ga0395901_0023864 | Ga0395901_0023864_2663_2986 | 103 |
| 32 | 3300041458 | Ga0451798_1147024 | Ga0451798_1147024_251_580 | 103 |
| 33 | 3300044658 | Ga0466972_0086811 | Ga0466972_0086811_612_935 | 103 |
| 34 | 3300044765 | Ga0466970_0062943 | Ga0466970_0062943_1104_1427 | 103 |
| 35 | 3300044842 | Ga0466957_0239652 | Ga0466957_0239652_59_382 | 103 |
| 36 | 3300045976 | Ga0466967_0210844 | Ga0466967_0210844_792_1115 | 103 |
| 37 | 3300045976 | Ga0466967_0308512 | Ga0466967_0308512_924_1247 | 103 |
| 38 | 3300049518 | Ga0501295_183902 | Ga0501295_183902_174_506 | 103 |
| 39 | 3300053108 | Ga0500562_067615 | Ga0500562_067615_400_726 | 103 |
| 40 | 3300053131 | Ga0500652_231109 | Ga0500652_231109_278_604 | 103 |
| 41 | 3300005327 | Ga0070658_11350954 | Ga0070658_113509542 | 104 |
| 42 | 3300006195 | Ga0075366_10064254 | Ga0075366_100642543 | 104 |
| 43 | 3300006353 | Ga0075370_10374496 | Ga0075370_103744963 | 104 |
| 44 | 3300013307 | Ga0157372_11213320 | Ga0157372_112133202 | 104 |
| 45 | 3300046542 | Ga0495597_0016597 | Ga0495597_0016597_3111_3446 | 104 |
| 46 | 3300046616 | Ga0495668_0209510 | Ga0495668_0209510_340_675 | 104 |
| 47 | 3300046660 | Ga0495625_0042984 | Ga0495625_0042984_2139_2474 | 104 |
| 48 | 3300049766 | Ga0501269_052849 | Ga0501269_052849_76_411 | 104 |
| 49 | 3300050493 | nmdc:mga0k408_159862_c1 | nmdc:mga0k408_159862_c1_461_796 | 104 |
| 50 | 3300050496 | nmdc:mga07m45_122327_c1 | nmdc:mga07m45_122327_c1_58_393 | 104 |
| 51 | 3300053087 | Ga0500643_006643 | Ga0500643_006643_2351_2686 | 104 |
| 52 | 3300053094 | Ga0500566_0000560 | Ga0500566_0000560_9030_9362 | 104 |
| 53 | 3300053098 | Ga0500650_0107524 | Ga0500650_0107524_240_575 | 104 |
| 54 | 3300053104 | Ga0500556_0000014 | Ga0500556_0000014_85844_86179 | 104 |
| 55 | 3300053105 | Ga0500557_113302 | Ga0500557_113302_440_775 | 104 |
| 56 | 3300053108 | Ga0500562_012077 | Ga0500562_012077_399_734 | 104 |
| 57 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_712123_712458 | 104 |
| 58 | 3300053730 | Ga0500645_006494 | Ga0500645_006494_2598_2933 | 104 |
| 59 | 3300005366 | Ga0070659_101215312 | Ga0070659_1012153122 | 106 |
| 60 | 3300031548 | Ga0307408_100081935 | Ga0307408_1000819356 | 106 |
| 61 | 3300031731 | Ga0307405_10115273 | Ga0307405_101152732 | 106 |
| 62 | 3300031824 | Ga0307413_10033984 | Ga0307413_100339845 | 106 |
| 63 | 3300031824 | Ga0307413_11081818 | Ga0307413_110818182 | 106 |
| 64 | 3300031824 | Ga0307413_11253256 | Ga0307413_112532562 | 106 |
| 65 | 3300031852 | Ga0307410_10015921 | Ga0307410_100159215 | 106 |
| 66 | 3300031903 | Ga0307407_10979547 | Ga0307407_109795471 | 106 |
| 67 | 3300031911 | Ga0307412_10269777 | Ga0307412_102697772 | 106 |
| 68 | 3300031995 | Ga0307409_100007295 | Ga0307409_1000072952 | 106 |
| 69 | 3300031995 | Ga0307409_101047440 | Ga0307409_1010474402 | 106 |
| 70 | 3300032002 | Ga0307416_100011123 | Ga0307416_1000111237 | 106 |
| 71 | 3300032002 | Ga0307416_102897196 | Ga0307416_1028971961 | 106 |
| 72 | 3300032004 | Ga0307414_10019348 | Ga0307414_100193485 | 106 |
| 73 | 3300032004 | Ga0307414_10276570 | Ga0307414_102765703 | 106 |
| 74 | 3300032005 | Ga0307411_10006880 | Ga0307411_100068806 | 106 |
| 75 | 3300032005 | Ga0307411_10196236 | Ga0307411_101962362 | 106 |
| 76 | 3300032005 | Ga0307411_10647321 | Ga0307411_106473212 | 106 |
| 77 | 3300032126 | Ga0307415_100001290 | Ga0307415_10000129011 | 106 |
| 78 | 3300032126 | Ga0307415_100049467 | Ga0307415_1000494674 | 106 |
| 79 | 3300042006 | Ga0439432_044624 | Ga0439432_044624_627_977 | 106 |
| 80 | 3300042007 | Ga0439449_0047741 | Ga0439449_0047741_457_807 | 106 |
| 81 | 3300042014 | Ga0439457_062596 | Ga0439457_062596_58_402 | 106 |
| 82 | 3300042125 | Ga0450923_196282 | Ga0450923_196282_28_372 | 106 |
| 83 | 3300046616 | Ga0495668_0564200 | Ga0495668_0564200_47_376 | 106 |
| 84 | 3300048912 | Ga0496109_0692541 | Ga0496109_0692541_76_405 | 106 |
| 85 | 3300013100 | Ga0157373_10060575 | Ga0157373_100605753 | 107 |
| 86 | 3300013105 | Ga0157369_11743629 | Ga0157369_117436292 | 107 |
| 87 | 3300025942 | Ga0207689_11567860 | Ga0207689_115678602 | 107 |
| 88 | 3300042134 | Ga0450898_089057 | Ga0450898_089057_36_377 | 107 |
| 89 | 3300044706 | Ga0466964_0478975 | Ga0466964_0478975_16_339 | 107 |
| 90 | 3300048913 | Ga0496110_0061180 | Ga0496110_0061180_775_1122 | 107 |
| 91 | 3300042157 | Ga0439458_0000268 | Ga0439458_0000268_455_805 | 108 |
| 92 | 3300002067 | JGI24735J21928_10026590 | JGI24735J21928_100265901 | 109 |
| 93 | 3300005327 | Ga0070658_10104808 | Ga0070658_101048082 | 109 |
| 94 | 3300005327 | Ga0070658_10117065 | Ga0070658_101170654 | 109 |
| 95 | 3300005327 | Ga0070658_11315729 | Ga0070658_113157291 | 109 |
| 96 | 3300005614 | Ga0068856_100112232 | Ga0068856_1001122321 | 109 |
| 97 | 3300013102 | Ga0157371_10058334 | Ga0157371_100583344 | 109 |
| 98 | 3300013296 | Ga0157374_11081040 | Ga0157374_110810402 | 109 |
| 99 | 3300025909 | Ga0207705_10089556 | Ga0207705_100895564 | 109 |
| 100 | 3300025909 | Ga0207705_10103475 | Ga0207705_101034754 | 109 |
| 101 | 3300025909 | Ga0207705_10299218 | Ga0207705_102992181 | 109 |
| 102 | 3300025909 | Ga0207705_10496941 | Ga0207705_104969412 | 109 |
| 103 | 3300025909 | Ga0207705_11323001 | Ga0207705_113230012 | 109 |
| 104 | 3300025917 | Ga0207660_11230233 | Ga0207660_112302331 | 109 |
| 105 | 3300025919 | Ga0207657_10435724 | Ga0207657_104357242 | 109 |
| 106 | 3300025919 | Ga0207657_10436475 | Ga0207657_104364752 | 109 |
| 107 | 3300025921 | Ga0207652_10706333 | Ga0207652_107063332 | 109 |
| 108 | 3300025932 | Ga0207690_10752391 | Ga0207690_107523911 | 109 |
| 109 | 3300026067 | Ga0207678_10006756 | Ga0207678_1000675610 | 109 |
| 110 | 3300037418 | Ga0395900_0401685 | Ga0395900_0401685_944_1273 | 109 |
| 111 | 3300037471 | Ga0395905_0123225 | Ga0395905_0123225_1420_1749 | 109 |
| 112 | 3300001979 | JGI24740J21852_10006386 | JGI24740J21852_1000638610 | 110 |
| 113 | 3300001979 | JGI24740J21852_10055235 | JGI24740J21852_100552351 | 110 |
| 114 | 3300001989 | JGI24739J22299_10000378 | JGI24739J22299_1000037819 | 110 |
| 115 | 3300001989 | JGI24739J22299_10023939 | JGI24739J22299_100239393 | 110 |
| 116 | 3300001990 | JGI24737J22298_10000438 | JGI24737J22298_100004388 | 110 |
| 117 | 3300001990 | JGI24737J22298_10001085 | JGI24737J22298_100010852 | 110 |
| 118 | 3300001990 | JGI24737J22298_10001931 | JGI24737J22298_1000193110 | 110 |
| 119 | 3300001990 | JGI24737J22298_10003378 | JGI24737J22298_1000337811 | 110 |
| 120 | 3300002070 | JGI24750J21931_1086221 | JGI24750J21931_10862211 | 110 |
| 121 | 3300002075 | JGI24738J21930_10003426 | JGI24738J21930_100034262 | 110 |
| 122 | 3300002126 | JGI24035J26624_1001446 | JGI24035J26624_10014465 | 110 |
| 123 | 3300005290 | Ga0065712_10096286 | Ga0065712_100962861 | 110 |
| 124 | 3300005327 | Ga0070658_10003538 | Ga0070658_1000353814 | 110 |
| 125 | 3300005327 | Ga0070658_10155221 | Ga0070658_101552212 | 110 |
| 126 | 3300005327 | Ga0070658_10230811 | Ga0070658_102308114 | 110 |
| 127 | 3300005327 | Ga0070658_10783061 | Ga0070658_107830612 | 110 |
| 128 | 3300005327 | Ga0070658_11410158 | Ga0070658_114101581 | 110 |
| 129 | 3300005328 | Ga0070676_10005815 | Ga0070676_1000581511 | 110 |
| 130 | 3300005328 | Ga0070676_10005815 | Ga0070676_1000581512 | 110 |
| 131 | 3300005328 | Ga0070676_10132106 | Ga0070676_101321063 | 110 |
| 132 | 3300005329 | Ga0070683_100005945 | Ga0070683_1000059459 | 110 |
| 133 | 3300005330 | Ga0070690_100057917 | Ga0070690_1000579172 | 110 |
| 134 | 3300005330 | Ga0070690_100157438 | Ga0070690_1001574384 | 110 |
| 135 | 3300005330 | Ga0070690_100157438 | Ga0070690_1001574385 | 110 |
| 136 | 3300005331 | Ga0070670_100002725 | Ga0070670_1000027255 | 110 |
| 137 | 3300005331 | Ga0070670_100034717 | Ga0070670_1000347173 | 110 |
| 138 | 3300005331 | Ga0070670_100065445 | Ga0070670_1000654456 | 110 |
| 139 | 3300005331 | Ga0070670_100994455 | Ga0070670_1009944552 | 110 |
| 140 | 3300005334 | Ga0068869_100000728 | Ga0068869_1000007285 | 110 |
| 141 | 3300005334 | Ga0068869_100000728 | Ga0068869_1000007286 | 110 |
| 142 | 3300005334 | Ga0068869_101550017 | Ga0068869_1015500172 | 110 |
| 143 | 3300005335 | Ga0070666_10000623 | Ga0070666_100006236 | 110 |
| 144 | 3300005335 | Ga0070666_10033780 | Ga0070666_100337805 | 110 |
| 145 | 3300005336 | Ga0070680_101712779 | Ga0070680_1017127791 | 110 |
| 146 | 3300005337 | Ga0070682_100012598 | Ga0070682_1000125982 | 110 |
| 147 | 3300005338 | Ga0068868_100006361 | Ga0068868_10000636112 | 110 |
| 148 | 3300005338 | Ga0068868_100006361 | Ga0068868_10000636113 | 110 |
| 149 | 3300005338 | Ga0068868_100645563 | Ga0068868_1006455632 | 110 |
| 150 | 3300005339 | Ga0070660_100000560 | Ga0070660_10000056015 | 110 |
| 151 | 3300005339 | Ga0070660_100233247 | Ga0070660_1002332472 | 110 |
| 152 | 3300005339 | Ga0070660_100233247 | Ga0070660_1002332473 | 110 |
| 153 | 3300005339 | Ga0070660_100298812 | Ga0070660_1002988122 | 110 |
| 154 | 3300005339 | Ga0070660_100557161 | Ga0070660_1005571612 | 110 |
| 155 | 3300005339 | Ga0070660_100618015 | Ga0070660_1006180151 | 110 |
| 156 | 3300005339 | Ga0070660_101556080 | Ga0070660_1015560801 | 110 |
| 157 | 3300005339 | Ga0070660_101643002 | Ga0070660_1016430021 | 110 |
| 158 | 3300005339 | Ga0070660_101932395 | Ga0070660_1019323951 | 110 |
| 159 | 3300005340 | Ga0070689_100129460 | Ga0070689_1001294604 | 110 |
| 160 | 3300005344 | Ga0070661_100000075 | Ga0070661_10000007514 | 110 |
| 161 | 3300005344 | Ga0070661_100012615 | Ga0070661_1000126155 | 110 |
| 162 | 3300005344 | Ga0070661_100053915 | Ga0070661_1000539154 | 110 |
| 163 | 3300005344 | Ga0070661_100053915 | Ga0070661_1000539155 | 110 |
| 164 | 3300005344 | Ga0070661_100845167 | Ga0070661_1008451672 | 110 |
| 165 | 3300005344 | Ga0070661_100865048 | Ga0070661_1008650481 | 110 |
| 166 | 3300005345 | Ga0070692_10611819 | Ga0070692_106118191 | 110 |
| 167 | 3300005347 | Ga0070668_100238951 | Ga0070668_1002389515 | 110 |
| 168 | 3300005353 | Ga0070669_100000565 | Ga0070669_10000056510 | 110 |
| 169 | 3300005353 | Ga0070669_100239061 | Ga0070669_1002390612 | 110 |
| 170 | 3300005353 | Ga0070669_100573039 | Ga0070669_1005730392 | 110 |
| 171 | 3300005354 | Ga0070675_100043992 | Ga0070675_1000439924 | 110 |
| 172 | 3300005354 | Ga0070675_100043992 | Ga0070675_1000439925 | 110 |
| 173 | 3300005354 | Ga0070675_100719424 | Ga0070675_1007194241 | 110 |
| 174 | 3300005354 | Ga0070675_101645997 | Ga0070675_1016459971 | 110 |
| 175 | 3300005355 | Ga0070671_100040800 | Ga0070671_1000408007 | 110 |
| 176 | 3300005355 | Ga0070671_100062925 | Ga0070671_1000629257 | 110 |
| 177 | 3300005355 | Ga0070671_101653758 | Ga0070671_1016537581 | 110 |
| 178 | 3300005356 | Ga0070674_100010817 | Ga0070674_1000108179 | 110 |
| 179 | 3300005356 | Ga0070674_100542519 | Ga0070674_1005425192 | 110 |
| 180 | 3300005364 | Ga0070673_100010306 | Ga0070673_10001030610 | 110 |
| 181 | 3300005364 | Ga0070673_100010306 | Ga0070673_1000103069 | 110 |
| 182 | 3300005364 | Ga0070673_101539176 | Ga0070673_1015391761 | 110 |
| 183 | 3300005366 | Ga0070659_100004211 | Ga0070659_10000421110 | 110 |
| 184 | 3300005366 | Ga0070659_100004211 | Ga0070659_1000042119 | 110 |
| 185 | 3300005366 | Ga0070659_100004345 | Ga0070659_1000043459 | 110 |
| 186 | 3300005366 | Ga0070659_100010071 | Ga0070659_1000100715 | 110 |
| 187 | 3300005366 | Ga0070659_100068069 | Ga0070659_1000680695 | 110 |
| 188 | 3300005366 | Ga0070659_100189959 | Ga0070659_1001899592 | 110 |
| 189 | 3300005366 | Ga0070659_100321637 | Ga0070659_1003216372 | 110 |
| 190 | 3300005366 | Ga0070659_100330303 | Ga0070659_1003303034 | 110 |
| 191 | 3300005366 | Ga0070659_101485069 | Ga0070659_1014850692 | 110 |
| 192 | 3300005367 | Ga0070667_100002091 | Ga0070667_10000209111 | 110 |
| 193 | 3300005367 | Ga0070667_100091190 | Ga0070667_1000911903 | 110 |
| 194 | 3300005435 | Ga0070714_101970003 | Ga0070714_1019700031 | 110 |
| 195 | 3300005438 | Ga0070701_11141507 | Ga0070701_111415072 | 110 |
| 196 | 3300005441 | Ga0070700_101026994 | Ga0070700_1010269941 | 110 |
| 197 | 3300005455 | Ga0070663_100004025 | Ga0070663_1000040257 | 110 |
| 198 | 3300005455 | Ga0070663_100049278 | Ga0070663_1000492784 | 110 |
| 199 | 3300005455 | Ga0070663_100096689 | Ga0070663_1000966893 | 110 |
| 200 | 3300005456 | Ga0070678_101060444 | Ga0070678_1010604442 | 110 |
| 201 | 3300005457 | Ga0070662_100003155 | Ga0070662_1000031559 | 110 |
| 202 | 3300005457 | Ga0070662_100003479 | Ga0070662_10000347915 | 110 |
| 203 | 3300005457 | Ga0070662_100017276 | Ga0070662_1000172768 | 110 |
| 204 | 3300005457 | Ga0070662_100188363 | Ga0070662_1001883631 | 110 |
| 205 | 3300005459 | Ga0068867_100008041 | Ga0068867_1000080419 | 110 |
| 206 | 3300005459 | Ga0068867_100122997 | Ga0068867_1001229972 | 110 |
| 207 | 3300005466 | Ga0070685_10237222 | Ga0070685_102372223 | 110 |
| 208 | 3300005535 | Ga0070684_100097876 | Ga0070684_1000978762 | 110 |
| 209 | 3300005539 | Ga0068853_100006609 | Ga0068853_1000066097 | 110 |
| 210 | 3300005539 | Ga0068853_100032999 | Ga0068853_1000329997 | 110 |
| 211 | 3300005539 | Ga0068853_100032999 | Ga0068853_1000329998 | 110 |
| 212 | 3300005539 | Ga0068853_101291893 | Ga0068853_1012918932 | 110 |
| 213 | 3300005543 | Ga0070672_100061279 | Ga0070672_1000612797 | 110 |
| 214 | 3300005543 | Ga0070672_100089143 | Ga0070672_1000891435 | 110 |
| 215 | 3300005547 | Ga0070693_100019899 | Ga0070693_1000198997 | 110 |
| 216 | 3300005548 | Ga0070665_100005836 | Ga0070665_10000583615 | 110 |
| 217 | 3300005548 | Ga0070665_100027367 | Ga0070665_1000273673 | 110 |
| 218 | 3300005548 | Ga0070665_100382244 | Ga0070665_1003822443 | 110 |
| 219 | 3300005548 | Ga0070665_100925679 | Ga0070665_1009256793 | 110 |
| 220 | 3300005563 | Ga0068855_100002720 | Ga0068855_10000272020 | 110 |
| 221 | 3300005563 | Ga0068855_100054360 | Ga0068855_1000543602 | 110 |
| 222 | 3300005563 | Ga0068855_100294384 | Ga0068855_1002943842 | 110 |
| 223 | 3300005563 | Ga0068855_101005715 | Ga0068855_1010057153 | 110 |
| 224 | 3300005563 | Ga0068855_102382175 | Ga0068855_1023821752 | 110 |
| 225 | 3300005564 | Ga0070664_100004841 | Ga0070664_1000048419 | 110 |
| 226 | 3300005564 | Ga0070664_100148690 | Ga0070664_1001486906 | 110 |
| 227 | 3300005564 | Ga0070664_100809911 | Ga0070664_1008099112 | 110 |
| 228 | 3300005564 | Ga0070664_101197154 | Ga0070664_1011971542 | 110 |
| 229 | 3300005564 | Ga0070664_101991089 | Ga0070664_1019910891 | 110 |
| 230 | 3300005577 | Ga0068857_100002337 | Ga0068857_10000233716 | 110 |
| 231 | 3300005577 | Ga0068857_100011311 | Ga0068857_1000113118 | 110 |
| 232 | 3300005577 | Ga0068857_100011311 | Ga0068857_1000113119 | 110 |
| 233 | 3300005577 | Ga0068857_101287420 | Ga0068857_1012874202 | 110 |
| 234 | 3300005578 | Ga0068854_100028696 | Ga0068854_1000286967 | 110 |
| 235 | 3300005578 | Ga0068854_100028696 | Ga0068854_1000286968 | 110 |
| 236 | 3300005578 | Ga0068854_100116632 | Ga0068854_1001166324 | 110 |
| 237 | 3300005578 | Ga0068854_100225714 | Ga0068854_1002257144 | 110 |
| 238 | 3300005578 | Ga0068854_100237794 | Ga0068854_1002377942 | 110 |
| 239 | 3300005614 | Ga0068856_100000538 | Ga0068856_1000005389 | 110 |
| 240 | 3300005614 | Ga0068856_100230506 | Ga0068856_1002305064 | 110 |
| 241 | 3300005614 | Ga0068856_100246487 | Ga0068856_1002464875 | 110 |
| 242 | 3300005614 | Ga0068856_101258322 | Ga0068856_1012583222 | 110 |
| 243 | 3300005615 | Ga0070702_100177155 | Ga0070702_1001771554 | 110 |
| 244 | 3300005616 | Ga0068852_100001259 | Ga0068852_1000012599 | 110 |
| 245 | 3300005616 | Ga0068852_100053492 | Ga0068852_1000534922 | 110 |
| 246 | 3300005616 | Ga0068852_100260972 | Ga0068852_1002609721 | 110 |
| 247 | 3300005616 | Ga0068852_100706425 | Ga0068852_1007064252 | 110 |
| 248 | 3300005617 | Ga0068859_100060129 | Ga0068859_1000601297 | 110 |
| 249 | 3300005617 | Ga0068859_100060129 | Ga0068859_1000601298 | 110 |
| 250 | 3300005617 | Ga0068859_102924392 | Ga0068859_1029243921 | 110 |
| 251 | 3300005618 | Ga0068864_100001241 | Ga0068864_10000124119 | 110 |
| 252 | 3300005618 | Ga0068864_100001241 | Ga0068864_10000124120 | 110 |
| 253 | 3300005618 | Ga0068864_100010872 | Ga0068864_10001087210 | 110 |
| 254 | 3300005618 | Ga0068864_100080885 | Ga0068864_1000808853 | 110 |
| 255 | 3300005718 | Ga0068866_10055233 | Ga0068866_100552336 | 110 |
| 256 | 3300005718 | Ga0068866_10055233 | Ga0068866_100552337 | 110 |
| 257 | 3300005719 | Ga0068861_100717386 | Ga0068861_1007173861 | 110 |
| 258 | 3300005719 | Ga0068861_100717386 | Ga0068861_1007173862 | 110 |
| 259 | 3300005834 | Ga0068851_10009861 | Ga0068851_100098618 | 110 |
| 260 | 3300005840 | Ga0068870_10674752 | Ga0068870_106747522 | 110 |
| 261 | 3300005841 | Ga0068863_100008879 | Ga0068863_10000887911 | 110 |
| 262 | 3300005841 | Ga0068863_100293271 | Ga0068863_1002932715 | 110 |
| 263 | 3300005842 | Ga0068858_100050928 | Ga0068858_1000509285 | 110 |
| 264 | 3300005842 | Ga0068858_100050928 | Ga0068858_1000509286 | 110 |
| 265 | 3300005842 | Ga0068858_100181733 | Ga0068858_1001817332 | 110 |
| 266 | 3300005842 | Ga0068858_101875986 | Ga0068858_1018759861 | 110 |
| 267 | 3300005843 | Ga0068860_100243529 | Ga0068860_1002435293 | 110 |
| 268 | 3300005843 | Ga0068860_100548700 | Ga0068860_1005487002 | 110 |
| 269 | 3300005843 | Ga0068860_101104620 | Ga0068860_1011046203 | 110 |
| 270 | 3300005843 | Ga0068860_101317612 | Ga0068860_1013176122 | 110 |
| 271 | 3300005844 | Ga0068862_101414856 | Ga0068862_1014148562 | 110 |
| 272 | 3300006177 | Ga0075362_10185252 | Ga0075362_101852522 | 110 |
| 273 | 3300006195 | Ga0075366_10156186 | Ga0075366_101561864 | 110 |
| 274 | 3300006237 | Ga0097621_100501650 | Ga0097621_1005016502 | 110 |
| 275 | 3300006358 | Ga0068871_100314255 | Ga0068871_1003142553 | 110 |
| 276 | 3300006358 | Ga0068871_100770893 | Ga0068871_1007708931 | 110 |
| 277 | 3300006881 | Ga0068865_100005554 | Ga0068865_10000555411 | 110 |
| 278 | 3300006931 | Ga0097620_100060129 | Ga0097620_1000601297 | 110 |
| 279 | 3300006931 | Ga0097620_100060129 | Ga0097620_1000601298 | 110 |
| 280 | 3300006931 | Ga0097620_102923561 | Ga0097620_1029235612 | 110 |
| 281 | 3300009093 | Ga0105240_10251421 | Ga0105240_102514213 | 110 |
| 282 | 3300009093 | Ga0105240_10251421 | Ga0105240_102514214 | 110 |
| 283 | 3300009098 | Ga0105245_10000782 | Ga0105245_1000078225 | 110 |
| 284 | 3300009148 | Ga0105243_10128177 | Ga0105243_101281775 | 110 |
| 285 | 3300009174 | Ga0105241_10060615 | Ga0105241_100606155 | 110 |
| 286 | 3300009174 | Ga0105241_10384031 | Ga0105241_103840313 | 110 |
| 287 | 3300009176 | Ga0105242_10208097 | Ga0105242_102080973 | 110 |
| 288 | 3300009176 | Ga0105242_10208097 | Ga0105242_102080974 | 110 |
| 289 | 3300009177 | Ga0105248_10000443 | Ga0105248_1000044335 | 110 |
| 290 | 3300009177 | Ga0105248_10003845 | Ga0105248_100038456 | 110 |
| 291 | 3300009177 | Ga0105248_10003845 | Ga0105248_100038457 | 110 |
| 292 | 3300009177 | Ga0105248_10101834 | Ga0105248_101018343 | 110 |
| 293 | 3300009177 | Ga0105248_10681596 | Ga0105248_106815962 | 110 |
| 294 | 3300009177 | Ga0105248_12025696 | Ga0105248_120256961 | 110 |
| 295 | 3300009551 | Ga0105238_10079835 | Ga0105238_100798353 | 110 |
| 296 | 3300010375 | Ga0105239_10020946 | Ga0105239_100209467 | 110 |
| 297 | 3300010375 | Ga0105239_10020946 | Ga0105239_100209468 | 110 |
| 298 | 3300011119 | Ga0105246_10007706 | Ga0105246_1000770610 | 110 |
| 299 | 3300011119 | Ga0105246_10007706 | Ga0105246_1000770611 | 110 |
| 300 | 3300011119 | Ga0105246_10097921 | Ga0105246_100979213 | 110 |
| 301 | 3300013100 | Ga0157373_10042025 | Ga0157373_100420253 | 110 |
| 302 | 3300013100 | Ga0157373_10050093 | Ga0157373_100500935 | 110 |
| 303 | 3300013100 | Ga0157373_10973855 | Ga0157373_109738552 | 110 |
| 304 | 3300013102 | Ga0157371_10005198 | Ga0157371_1000519815 | 110 |
| 305 | 3300013102 | Ga0157371_10005198 | Ga0157371_1000519816 | 110 |
| 306 | 3300013102 | Ga0157371_10008659 | Ga0157371_100086599 | 110 |
| 307 | 3300013102 | Ga0157371_10402067 | Ga0157371_104020672 | 110 |
| 308 | 3300013102 | Ga0157371_10741771 | Ga0157371_107417711 | 110 |
| 309 | 3300013102 | Ga0157371_11004210 | Ga0157371_110042102 | 110 |
| 310 | 3300013102 | Ga0157371_11226065 | Ga0157371_112260652 | 110 |
| 311 | 3300013104 | Ga0157370_10176867 | Ga0157370_101768674 | 110 |
| 312 | 3300013104 | Ga0157370_10990875 | Ga0157370_109908752 | 110 |
| 313 | 3300013105 | Ga0157369_10151556 | Ga0157369_101515567 | 110 |
| 314 | 3300013105 | Ga0157369_10313943 | Ga0157369_103139433 | 110 |
| 315 | 3300013296 | Ga0157374_10104177 | Ga0157374_101041773 | 110 |
| 316 | 3300013296 | Ga0157374_10121425 | Ga0157374_101214256 | 110 |
| 317 | 3300013296 | Ga0157374_11704982 | Ga0157374_117049822 | 110 |
| 318 | 3300013297 | Ga0157378_10022210 | Ga0157378_100222108 | 110 |
| 319 | 3300013297 | Ga0157378_11453793 | Ga0157378_114537931 | 110 |
| 320 | 3300013306 | Ga0163162_10160585 | Ga0163162_101605855 | 110 |
| 321 | 3300013306 | Ga0163162_11555214 | Ga0163162_115552142 | 110 |
| 322 | 3300013307 | Ga0157372_10197417 | Ga0157372_101974176 | 110 |
| 323 | 3300013307 | Ga0157372_10204285 | Ga0157372_102042856 | 110 |
| 324 | 3300013307 | Ga0157372_10599810 | Ga0157372_105998103 | 110 |
| 325 | 3300013307 | Ga0157372_10636881 | Ga0157372_106368813 | 110 |
| 326 | 3300013308 | Ga0157375_10115316 | Ga0157375_101153162 | 110 |
| 327 | 3300013308 | Ga0157375_12973265 | Ga0157375_129732652 | 110 |
| 328 | 3300014325 | Ga0163163_10000058 | Ga0163163_1000005815 | 110 |
| 329 | 3300014325 | Ga0163163_10177794 | Ga0163163_101777946 | 110 |
| 330 | 3300014326 | Ga0157380_11839815 | Ga0157380_118398152 | 110 |
| 331 | 3300014745 | Ga0157377_10063203 | Ga0157377_100632034 | 110 |
| 332 | 3300014745 | Ga0157377_10063203 | Ga0157377_100632035 | 110 |
| 333 | 3300014745 | Ga0157377_10171874 | Ga0157377_101718742 | 110 |
| 334 | 3300014968 | Ga0157379_10012614 | Ga0157379_1001261412 | 110 |
| 335 | 3300014968 | Ga0157379_10147537 | Ga0157379_101475376 | 110 |
| 336 | 3300020080 | Ga0206350_11096168 | Ga0206350_110961682 | 110 |
| 337 | 3300025315 | Ga0207697_10003187 | Ga0207697_1000318710 | 110 |
| 338 | 3300025315 | Ga0207697_10003187 | Ga0207697_100031879 | 110 |
| 339 | 3300025321 | Ga0207656_10004042 | Ga0207656_100040425 | 110 |
| 340 | 3300025321 | Ga0207656_10145172 | Ga0207656_101451721 | 110 |
| 341 | 3300025899 | Ga0207642_10493520 | Ga0207642_104935202 | 110 |
| 342 | 3300025901 | Ga0207688_10203916 | Ga0207688_102039162 | 110 |
| 343 | 3300025903 | Ga0207680_10012374 | Ga0207680_100123746 | 110 |
| 344 | 3300025903 | Ga0207680_10035996 | Ga0207680_100359962 | 110 |
| 345 | 3300025904 | Ga0207647_10013604 | Ga0207647_100136043 | 110 |
| 346 | 3300025904 | Ga0207647_10016767 | Ga0207647_100167677 | 110 |
| 347 | 3300025904 | Ga0207647_10016767 | Ga0207647_100167678 | 110 |
| 348 | 3300025904 | Ga0207647_10047835 | Ga0207647_100478353 | 110 |
| 349 | 3300025904 | Ga0207647_10067163 | Ga0207647_100671636 | 110 |
| 350 | 3300025904 | Ga0207647_10085108 | Ga0207647_100851084 | 110 |
| 351 | 3300025907 | Ga0207645_10015526 | Ga0207645_1001552610 | 110 |
| 352 | 3300025907 | Ga0207645_10015526 | Ga0207645_100155269 | 110 |
| 353 | 3300025908 | Ga0207643_10125879 | Ga0207643_101258792 | 110 |
| 354 | 3300025909 | Ga0207705_10002347 | Ga0207705_100023479 | 110 |
| 355 | 3300025909 | Ga0207705_10174512 | Ga0207705_101745122 | 110 |
| 356 | 3300025909 | Ga0207705_10865480 | Ga0207705_108654802 | 110 |
| 357 | 3300025909 | Ga0207705_10914860 | Ga0207705_109148602 | 110 |
| 358 | 3300025909 | Ga0207705_10973361 | Ga0207705_109733611 | 110 |
| 359 | 3300025911 | Ga0207654_10069321 | Ga0207654_100693213 | 110 |
| 360 | 3300025911 | Ga0207654_10082082 | Ga0207654_100820822 | 110 |
| 361 | 3300025913 | Ga0207695_10600691 | Ga0207695_106006912 | 110 |
| 362 | 3300025919 | Ga0207657_10000126 | Ga0207657_100001269 | 110 |
| 363 | 3300025919 | Ga0207657_10009347 | Ga0207657_100093473 | 110 |
| 364 | 3300025919 | Ga0207657_10009347 | Ga0207657_100093474 | 110 |
| 365 | 3300025919 | Ga0207657_10128352 | Ga0207657_101283526 | 110 |
| 366 | 3300025919 | Ga0207657_11279539 | Ga0207657_112795392 | 110 |
| 367 | 3300025920 | Ga0207649_10000937 | Ga0207649_100009371 | 110 |
| 368 | 3300025920 | Ga0207649_10004887 | Ga0207649_1000488711 | 110 |
| 369 | 3300025920 | Ga0207649_10650346 | Ga0207649_106503462 | 110 |
| 370 | 3300025921 | Ga0207652_10405992 | Ga0207652_104059923 | 110 |
| 371 | 3300025923 | Ga0207681_10010000 | Ga0207681_100100009 | 110 |
| 372 | 3300025923 | Ga0207681_10325184 | Ga0207681_103251843 | 110 |
| 373 | 3300025923 | Ga0207681_10353964 | Ga0207681_103539643 | 110 |
| 374 | 3300025924 | Ga0207694_10200517 | Ga0207694_102005173 | 110 |
| 375 | 3300025925 | Ga0207650_10003655 | Ga0207650_100036555 | 110 |
| 376 | 3300025925 | Ga0207650_10011665 | Ga0207650_100116659 | 110 |
| 377 | 3300025925 | Ga0207650_10032491 | Ga0207650_100324918 | 110 |
| 378 | 3300025926 | Ga0207659_10469907 | Ga0207659_104699072 | 110 |
| 379 | 3300025926 | Ga0207659_10469907 | Ga0207659_104699073 | 110 |
| 380 | 3300025926 | Ga0207659_11659972 | Ga0207659_116599721 | 110 |
| 381 | 3300025927 | Ga0207687_10013795 | Ga0207687_100137958 | 110 |
| 382 | 3300025931 | Ga0207644_10012689 | Ga0207644_100126896 | 110 |
| 383 | 3300025931 | Ga0207644_10068554 | Ga0207644_100685542 | 110 |
| 384 | 3300025931 | Ga0207644_10068554 | Ga0207644_100685543 | 110 |
| 385 | 3300025932 | Ga0207690_10000106 | Ga0207690_1000010651 | 110 |
| 386 | 3300025932 | Ga0207690_10006739 | Ga0207690_100067394 | 110 |
| 387 | 3300025932 | Ga0207690_10006739 | Ga0207690_100067395 | 110 |
| 388 | 3300025932 | Ga0207690_10021928 | Ga0207690_100219286 | 110 |
| 389 | 3300025932 | Ga0207690_10069367 | Ga0207690_100693675 | 110 |
| 390 | 3300025932 | Ga0207690_10773564 | Ga0207690_107735642 | 110 |
| 391 | 3300025932 | Ga0207690_10825599 | Ga0207690_108255992 | 110 |
| 392 | 3300025932 | Ga0207690_10880787 | Ga0207690_108807872 | 110 |
| 393 | 3300025933 | Ga0207706_10000151 | Ga0207706_1000015170 | 110 |
| 394 | 3300025933 | Ga0207706_10005896 | Ga0207706_1000589614 | 110 |
| 395 | 3300025933 | Ga0207706_10029147 | Ga0207706_100291476 | 110 |
| 396 | 3300025936 | Ga0207670_10113380 | Ga0207670_101133802 | 110 |
| 397 | 3300025937 | Ga0207669_10009539 | Ga0207669_100095395 | 110 |
| 398 | 3300025937 | Ga0207669_10094289 | Ga0207669_100942894 | 110 |
| 399 | 3300025937 | Ga0207669_10094289 | Ga0207669_100942895 | 110 |
| 400 | 3300025938 | Ga0207704_10006757 | Ga0207704_100067577 | 110 |
| 401 | 3300025938 | Ga0207704_10006757 | Ga0207704_100067578 | 110 |
| 402 | 3300025940 | Ga0207691_10007770 | Ga0207691_1000777015 | 110 |
| 403 | 3300025940 | Ga0207691_10134197 | Ga0207691_101341974 | 110 |
| 404 | 3300025941 | Ga0207711_10001912 | Ga0207711_1000191216 | 110 |
| 405 | 3300025941 | Ga0207711_10004040 | Ga0207711_1000404016 | 110 |
| 406 | 3300025941 | Ga0207711_10020785 | Ga0207711_100207852 | 110 |
| 407 | 3300025941 | Ga0207711_10279823 | Ga0207711_102798234 | 110 |
| 408 | 3300025942 | Ga0207689_10000167 | Ga0207689_1000016743 | 110 |
| 409 | 3300025942 | Ga0207689_10000167 | Ga0207689_1000016744 | 110 |
| 410 | 3300025944 | Ga0207661_10006497 | Ga0207661_1000649714 | 110 |
| 411 | 3300025944 | Ga0207661_11169757 | Ga0207661_111697571 | 110 |
| 412 | 3300025945 | Ga0207679_10002382 | Ga0207679_100023829 | 110 |
| 413 | 3300025945 | Ga0207679_10475078 | Ga0207679_104750781 | 110 |
| 414 | 3300025945 | Ga0207679_10475078 | Ga0207679_104750782 | 110 |
| 415 | 3300025949 | Ga0207667_10002108 | Ga0207667_1000210820 | 110 |
| 416 | 3300025949 | Ga0207667_10042138 | Ga0207667_100421381 | 110 |
| 417 | 3300025949 | Ga0207667_10042138 | Ga0207667_100421382 | 110 |
| 418 | 3300025949 | Ga0207667_10284484 | Ga0207667_102844844 | 110 |
| 419 | 3300025960 | Ga0207651_10009127 | Ga0207651_100091277 | 110 |
| 420 | 3300025960 | Ga0207651_10009127 | Ga0207651_100091278 | 110 |
| 421 | 3300025972 | Ga0207668_10071748 | Ga0207668_100717482 | 110 |
| 422 | 3300025981 | Ga0207640_10025143 | Ga0207640_100251432 | 110 |
| 423 | 3300025981 | Ga0207640_10035980 | Ga0207640_100359803 | 110 |
| 424 | 3300025981 | Ga0207640_10077650 | Ga0207640_100776504 | 110 |
| 425 | 3300025981 | Ga0207640_10249811 | Ga0207640_102498114 | 110 |
| 426 | 3300025986 | Ga0207658_10002624 | Ga0207658_1000262421 | 110 |
| 427 | 3300025986 | Ga0207658_10029117 | Ga0207658_100291175 | 110 |
| 428 | 3300026023 | Ga0207677_10043649 | Ga0207677_100436492 | 110 |
| 429 | 3300026023 | Ga0207677_10043649 | Ga0207677_100436493 | 110 |
| 430 | 3300026035 | Ga0207703_10115143 | Ga0207703_101151432 | 110 |
| 431 | 3300026035 | Ga0207703_10156311 | Ga0207703_101563116 | 110 |
| 432 | 3300026041 | Ga0207639_10000573 | Ga0207639_1000057314 | 110 |
| 433 | 3300026041 | Ga0207639_10002893 | Ga0207639_100028935 | 110 |
| 434 | 3300026041 | Ga0207639_10002893 | Ga0207639_100028936 | 110 |
| 435 | 3300026041 | Ga0207639_11025388 | Ga0207639_110253882 | 110 |
| 436 | 3300026067 | Ga0207678_10010888 | Ga0207678_100108889 | 110 |
| 437 | 3300026067 | Ga0207678_10040488 | Ga0207678_100404882 | 110 |
| 438 | 3300026067 | Ga0207678_10044567 | Ga0207678_100445676 | 110 |
| 439 | 3300026067 | Ga0207678_10570384 | Ga0207678_105703842 | 110 |
| 440 | 3300026078 | Ga0207702_10001045 | Ga0207702_1000104516 | 110 |
| 441 | 3300026078 | Ga0207702_10092718 | Ga0207702_100927188 | 110 |
| 442 | 3300026078 | Ga0207702_10226895 | Ga0207702_102268954 | 110 |
| 443 | 3300026078 | Ga0207702_10647226 | Ga0207702_106472262 | 110 |
| 444 | 3300026078 | Ga0207702_11381153 | Ga0207702_113811532 | 110 |
| 445 | 3300026088 | Ga0207641_10006636 | Ga0207641_1000663611 | 110 |
| 446 | 3300026088 | Ga0207641_12604265 | Ga0207641_126042652 | 110 |
| 447 | 3300026089 | Ga0207648_10001222 | Ga0207648_100012224 | 110 |
| 448 | 3300026089 | Ga0207648_10001222 | Ga0207648_100012225 | 110 |
| 449 | 3300026089 | Ga0207648_10016014 | Ga0207648_1001601410 | 110 |
| 450 | 3300026095 | Ga0207676_10007892 | Ga0207676_100078929 | 110 |
| 451 | 3300026095 | Ga0207676_10016650 | Ga0207676_100166501 | 110 |
| 452 | 3300026095 | Ga0207676_10031648 | Ga0207676_100316488 | 110 |
| 453 | 3300026095 | Ga0207676_10107859 | Ga0207676_101078595 | 110 |
| 454 | 3300026095 | Ga0207676_10251030 | Ga0207676_102510304 | 110 |
| 455 | 3300026095 | Ga0207676_11417808 | Ga0207676_114178081 | 110 |
| 456 | 3300026116 | Ga0207674_10002073 | Ga0207674_1000207327 | 110 |
| 457 | 3300026116 | Ga0207674_10002073 | Ga0207674_1000207328 | 110 |
| 458 | 3300026116 | Ga0207674_10003779 | Ga0207674_1000377921 | 110 |
| 459 | 3300026116 | Ga0207674_10635407 | Ga0207674_106354073 | 110 |
| 460 | 3300026118 | Ga0207675_100045075 | Ga0207675_1000450752 | 110 |
| 461 | 3300026118 | Ga0207675_100045075 | Ga0207675_1000450753 | 110 |
| 462 | 3300026142 | Ga0207698_10002899 | Ga0207698_100028996 | 110 |
| 463 | 3300026142 | Ga0207698_10026332 | Ga0207698_100263324 | 110 |
| 464 | 3300026142 | Ga0207698_10049615 | Ga0207698_100496155 | 110 |
| 465 | 3300026142 | Ga0207698_10049615 | Ga0207698_100496156 | 110 |
| 466 | 3300026142 | Ga0207698_10530824 | Ga0207698_105308242 | 110 |
| 467 | 3300028379 | Ga0268266_10000950 | Ga0268266_100009504 | 110 |
| 468 | 3300028379 | Ga0268266_10017332 | Ga0268266_100173329 | 110 |
| 469 | 3300028379 | Ga0268266_10828334 | Ga0268266_108283343 | 110 |
| 470 | 3300031852 | Ga0307410_10426408 | Ga0307410_104264084 | 110 |
| 471 | 3300035091 | Ga0373951_0141259 | Ga0373951_0141259_59_403 | 110 |
| 472 | 3300035114 | Ga0373939_0027810 | Ga0373939_0027810_684_1028 | 110 |
| 473 | 3300035170 | Ga0373943_0007352 | Ga0373943_0007352_1409_1753 | 110 |
| 474 | 3300035171 | Ga0373946_0016959 | Ga0373946_0016959_401_745 | 110 |
| 475 | 3300035207 | Ga0373942_0126811 | Ga0373942_0126811_421_765 | 110 |
| 476 | 3300035242 | Ga0373962_0048664 | Ga0373962_0048664_264_608 | 110 |
| 477 | 3300035691 | Ga0373931_0308469 | Ga0373931_0308469_260_604 | 110 |
| 478 | 3300035692 | Ga0373935_0420357 | Ga0373935_0420357_111_455 | 110 |
| 479 | 3300035695 | Ga0373927_0057767 | Ga0373927_0057767_441_785 | 110 |
| 480 | 3300037068 | Ga0373925_0033179 | Ga0373925_0033179_1120_1464 | 110 |
| 481 | 3300037312 | Ga0395899_0025167 | Ga0395899_0025167_1099_1443 | 110 |
| 482 | 3300037312 | Ga0395899_0030099 | Ga0395899_0030099_2574_2918 | 110 |
| 483 | 3300037312 | Ga0395899_0410681 | Ga0395899_0410681_455_799 | 110 |
| 484 | 3300037312 | Ga0395899_0476198 | Ga0395899_0476198_14_358 | 110 |
| 485 | 3300037418 | Ga0395900_0022607 | Ga0395900_0022607_1461_1805 | 110 |
| 486 | 3300037418 | Ga0395900_0027275 | Ga0395900_0027275_2112_2456 | 110 |
| 487 | 3300037418 | Ga0395900_0033836 | Ga0395900_0033836_2148_2492 | 110 |
| 488 | 3300037418 | Ga0395900_0073120 | Ga0395900_0073120_1407_1751 | 110 |
| 489 | 3300037418 | Ga0395900_0085076 | Ga0395900_0085076_1555_1899 | 110 |
| 490 | 3300037418 | Ga0395900_0108524 | Ga0395900_0108524_2243_2587 | 110 |
| 491 | 3300037418 | Ga0395900_0131992 | Ga0395900_0131992_841_1185 | 110 |
| 492 | 3300037418 | Ga0395900_0196244 | Ga0395900_0196244_1216_1560 | 110 |
| 493 | 3300037418 | Ga0395900_0206376 | Ga0395900_0206376_1482_1826 | 110 |
| 494 | 3300037418 | Ga0395900_0273050 | Ga0395900_0273050_1149_1493 | 110 |
| 495 | 3300037418 | Ga0395900_0401685 | Ga0395900_0401685_600_944 | 110 |
| 496 | 3300037418 | Ga0395900_0408822 | Ga0395900_0408822_793_1137 | 110 |
| 497 | 3300037418 | Ga0395900_0458836 | Ga0395900_0458836_871_1215 | 110 |
| 498 | 3300037418 | Ga0395900_1326620 | Ga0395900_1326620_202_546 | 110 |
| 499 | 3300037466 | Ga0395898_0016010 | Ga0395898_0016010_4387_4731 | 110 |
| 500 | 3300037466 | Ga0395898_0055058 | Ga0395898_0055058_2004_2348 | 110 |
| 501 | 3300037466 | Ga0395898_0199573 | Ga0395898_0199573_1115_1459 | 110 |
| 502 | 3300037466 | Ga0395898_0251225 | Ga0395898_0251225_1231_1575 | 110 |
| 503 | 3300037466 | Ga0395898_0300269 | Ga0395898_0300269_361_705 | 110 |
| 504 | 3300037466 | Ga0395898_0588861 | Ga0395898_0588861_503_847 | 110 |
| 505 | 3300037466 | Ga0395898_1733103 | Ga0395898_1733103_152_496 | 110 |
| 506 | 3300037471 | Ga0395905_0009247 | Ga0395905_0009247_8941_9285 | 110 |
| 507 | 3300037471 | Ga0395905_0010012 | Ga0395905_0010012_4125_4469 | 110 |
| 508 | 3300037471 | Ga0395905_0014735 | Ga0395905_0014735_177_521 | 110 |
| 509 | 3300037471 | Ga0395905_0040657 | Ga0395905_0040657_520_864 | 110 |
| 510 | 3300037471 | Ga0395905_0102517 | Ga0395905_0102517_142_486 | 110 |
| 511 | 3300037471 | Ga0395905_0113152 | Ga0395905_0113152_1048_1392 | 110 |
| 512 | 3300037471 | Ga0395905_0123225 | Ga0395905_0123225_1749_2093 | 110 |
| 513 | 3300037471 | Ga0395905_0219643 | Ga0395905_0219643_714_1058 | 110 |
| 514 | 3300037471 | Ga0395905_0254464 | Ga0395905_0254464_23_367 | 110 |
| 515 | 3300037471 | Ga0395905_0592483 | Ga0395905_0592483_15_359 | 110 |
| 516 | 3300037471 | Ga0395905_1035231 | Ga0395905_1035231_222_566 | 110 |
| 517 | 3300037471 | Ga0395905_1147405 | Ga0395905_1147405_221_565 | 110 |
| 518 | 3300037853 | Ga0436364_0219673 | Ga0436364_0219673_188_532 | 110 |
| 519 | 3300037853 | Ga0436364_0755345 | Ga0436364_0755345_6459_6803 | 110 |
| 520 | 3300038443 | Ga0395901_0006189 | Ga0395901_0006189_8857_9201 | 110 |
| 521 | 3300038443 | Ga0395901_0007713 | Ga0395901_0007713_2809_3153 | 110 |
| 522 | 3300038443 | Ga0395901_0035010 | Ga0395901_0035010_1586_1930 | 110 |
| 523 | 3300038443 | Ga0395901_0043349 | Ga0395901_0043349_1324_1668 | 110 |
| 524 | 3300038443 | Ga0395901_0044592 | Ga0395901_0044592_3088_3432 | 110 |
| 525 | 3300038443 | Ga0395901_0048833 | Ga0395901_0048833_3891_4235 | 110 |
| 526 | 3300038443 | Ga0395901_0167363 | Ga0395901_0167363_927_1271 | 110 |
| 527 | 3300038443 | Ga0395901_0284858 | Ga0395901_0284858_102_446 | 110 |
| 528 | 3300038443 | Ga0395901_0428250 | Ga0395901_0428250_487_831 | 110 |
| 529 | 3300038443 | Ga0395901_0582015 | Ga0395901_0582015_438_782 | 110 |
| 530 | 3300038443 | Ga0395901_1213635 | Ga0395901_1213635_56_400 | 110 |
| 531 | 3300042005 | Ga0439448_0004253 | Ga0439448_0004253_3250_3594 | 110 |
| 532 | 3300042012 | Ga0439455_0151325 | Ga0439455_0151325_173_517 | 110 |
| 533 | 3300042157 | Ga0439458_0000154 | Ga0439458_0000154_11963_12307 | 110 |
| 534 | 3300044656 | Ga0466969_0342983 | Ga0466969_0342983_272_616 | 110 |
| 535 | 3300044683 | Ga0466965_0698772 | Ga0466965_0698772_147_491 | 110 |
| 536 | 3300044683 | Ga0466965_0823072 | Ga0466965_0823072_99_443 | 110 |
| 537 | 3300044684 | Ga0466966_0102477 | Ga0466966_0102477_55_399 | 110 |
| 538 | 3300044694 | Ga0466963_0016999 | Ga0466963_0016999_3295_3639 | 110 |
| 539 | 3300044694 | Ga0466963_0874574 | Ga0466963_0874574_247_591 | 110 |
| 540 | 3300044694 | Ga0466963_1228140 | Ga0466963_1228140_131_475 | 110 |
| 541 | 3300044765 | Ga0466970_0038621 | Ga0466970_0038621_706_1050 | 110 |
| 542 | 3300044842 | Ga0466957_0062554 | Ga0466957_0062554_54_398 | 110 |
| 543 | 3300044842 | Ga0466957_0103080 | Ga0466957_0103080_188_532 | 110 |
| 544 | 3300044842 | Ga0466957_0339745 | Ga0466957_0339745_447_791 | 110 |
| 545 | 3300044842 | Ga0466957_0363780 | Ga0466957_0363780_354_698 | 110 |
| 546 | 3300045049 | Ga0466959_0206105 | Ga0466959_0206105_762_1106 | 110 |
| 547 | 3300045976 | Ga0466967_0007211 | Ga0466967_0007211_205_549 | 110 |
| 548 | 3300045976 | Ga0466967_0186458 | Ga0466967_0186458_431_775 | 110 |
| 549 | 3300045976 | Ga0466967_0371621 | Ga0466967_0371621_100_444 | 110 |
| 550 | 3300045976 | Ga0466967_0718956 | Ga0466967_0718956_244_588 | 110 |
| 551 | 3300045976 | Ga0466967_1650810 | Ga0466967_1650810_276_620 | 110 |
| 552 | 3300046684 | Ga0495669_0085688 | Ga0495669_0085688_95_439 | 110 |
| 553 | 3300048904 | Ga0496101_0318541 | Ga0496101_0318541_857_1201 | 110 |
| 554 | 3300048909 | Ga0496106_1246089 | Ga0496106_1246089_103_447 | 110 |
| 555 | 3300048910 | Ga0496107_0186800 | Ga0496107_0186800_227_571 | 110 |
| 556 | 3300048910 | Ga0496107_0721599 | Ga0496107_0721599_342_686 | 110 |
| 557 | 3300048911 | Ga0496108_0145985 | Ga0496108_0145985_1249_1593 | 110 |
| 558 | 3300048912 | Ga0496109_0191881 | Ga0496109_0191881_1523_1867 | 110 |
| 559 | 3300048912 | Ga0496109_1665466 | Ga0496109_1665466_67_411 | 110 |
| 560 | 3300048912 | Ga0496109_1856184 | Ga0496109_1856184_133_480 | 110 |
| 561 | 3300048913 | Ga0496110_0102725 | Ga0496110_0102725_2105_2449 | 110 |
| 562 | 3300048913 | Ga0496110_0644424 | Ga0496110_0644424_332_676 | 110 |
| 563 | 3300048913 | Ga0496110_1649394 | Ga0496110_1649394_161_505 | 110 |
| 564 | 3300048914 | Ga0496111_0158133 | Ga0496111_0158133_1083_1427 | 110 |
| 565 | 3300048914 | Ga0496111_0362500 | Ga0496111_0362500_321_668 | 110 |
| 566 | 3300048914 | Ga0496111_0487054 | Ga0496111_0487054_317_661 | 110 |
| 567 | 3300048915 | Ga0496112_0475772 | Ga0496112_0475772_741_1085 | 110 |
| 568 | 3300050489 | nmdc:mga03683_185133_c1 | nmdc:mga03683_185133_c1_434_778 | 110 |
| 569 | 3300050493 | nmdc:mga0k408_226820_c1 | nmdc:mga0k408_226820_c1_148_492 | 110 |
| 570 | 3300059477 | Ga0587084_045075 | Ga0587084_045075_319_663 | 110 |
| 571 | 3300061719 | Ga0466962_0059360 | Ga0466962_0059360_808_1152 | 110 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar