F464908

General Info

Members Datasets Scaffolds Average Seq Length
571 224 520 112

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_101550017|Ga0068869_1015500172
Length 114
Sequence MDTEAIQIIKLIASGLPYLAIVVALGVGGSLLSTWLKIKNGYPISSSWGIPMHPKGDREAAERIKLLTNENAKLRTEIKSVTDRLANVERIVTDQPSRLMRDIDALAIDKEGTR

Samples

Sample ID Description Type Environment
1 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
2 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
3 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
4 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
5 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
180 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
181 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
223 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.35
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 3.15
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006386 3300001979 Bacteria 4887
2 JGI24740J21852_10055235 3300001979 Bacteria 1118
3 JGI24739J22299_10000378 3300001989 Bacteria 15359
4 JGI24739J22299_10023939 3300001989 Unclassified 2155
5 JGI24737J22298_10000438 3300001990 Bacteria 14246
6 JGI24737J22298_10001085 3300001990 Bacteria 9564
7 JGI24737J22298_10001931 3300001990 Bacteria 7414
8 JGI24737J22298_10003378 3300001990 Bacteria 5643
9 JGI24735J21928_10026590 3300002067 Bacteria 1738
10 JGI24750J21931_1086221 3300002070 Bacteria 527
11 JGI24738J21930_10003426 3300002075 Bacteria 4002
12 JGI24035J26624_1001446 3300002126 Bacteria 2244
13 Ga0065712_10096286 3300005290 Bacteria 2188
14 Ga0070658_10003538 3300005327 Bacteria 12823
15 Ga0070658_10104808 3300005327 Bacteria 2340
16 Ga0070658_10117065 3300005327 Bacteria 2212
17 Ga0070658_10155221 3300005327 Archaea 1918
18 Ga0070658_10230811 3300005327 Bacteria 1567
19 Ga0070658_10783061 3300005327 Bacteria 828
20 Ga0070658_11315729 3300005327 Bacteria 628
21 Ga0070658_11350954 3300005327 Bacteria 619
22 Ga0070658_11410158 3300005327 Unclassified 604
23 Ga0070676_10005815 3300005328 Bacteria 6575
24 Ga0070676_10132106 3300005328 Bacteria 1580
25 Ga0070683_100005945 3300005329 Bacteria 10211
26 Ga0070690_100057917 3300005330 Bacteria 2487
27 Ga0070690_100157438 3300005330 Bacteria 1554
28 Ga0070670_100002725 3300005331 Bacteria 14599
29 Ga0070670_100034717 3300005331 Bacteria 4340
30 Ga0070670_100065445 3300005331 Bacteria 3119
31 Ga0070670_100994455 3300005331 Bacteria 763
32 Ga0068869_100000728 3300005334 Bacteria 18720
33 Ga0068869_101550017 3300005334 Bacteria 589
34 Ga0070666_10000623 3300005335 Bacteria 21258
35 Ga0070666_10033780 3300005335 Bacteria 3387
36 Ga0070680_101712779 3300005336 Unclassified 545
37 Ga0070682_100012598 3300005337 Bacteria 4851
38 Ga0068868_100006361 3300005338 Bacteria 8354
39 Ga0068868_100645563 3300005338 Bacteria 942
40 Ga0070660_100000560 3300005339 Bacteria 24966
41 Ga0070660_100233247 3300005339 Unclassified 1497
42 Ga0070660_100298812 3300005339 Bacteria 1320
43 Ga0070660_100557161 3300005339 Bacteria 956
44 Ga0070660_100618015 3300005339 Unclassified 907
45 Ga0070660_101556080 3300005339 Bacteria 562
46 Ga0070660_101643002 3300005339 Bacteria 547
47 Ga0070660_101932395 3300005339 Unclassified 503
48 Ga0070689_100129460 3300005340 Bacteria 2023
49 Ga0070661_100000075 3300005344 Bacteria 79164
50 Ga0070661_100012615 3300005344 Bacteria 5913
51 Ga0070661_100053915 3300005344 Bacteria 2945
52 Ga0070661_100845167 3300005344 Bacteria 753
53 Ga0070661_100865048 3300005344 Bacteria 745
54 Ga0070692_10611819 3300005345 Bacteria 722
55 Ga0070668_100238951 3300005347 Unclassified 1504
56 Ga0070669_100000565 3300005353 Bacteria 27565
57 Ga0070669_100239061 3300005353 Bacteria 1442
58 Ga0070669_100573039 3300005353 Bacteria 943
59 Ga0070675_100043992 3300005354 Bacteria 3652
60 Ga0070675_100719424 3300005354 Unclassified 910
61 Ga0070675_101645997 3300005354 Unclassified 592
62 Ga0070671_100040800 3300005355 Bacteria 3856
63 Ga0070671_100062925 3300005355 Bacteria 3089
64 Ga0070671_101653758 3300005355 Bacteria 568
65 Ga0070674_100010817 3300005356 Bacteria 5533
66 Ga0070674_100542519 3300005356 Bacteria 974
67 Ga0070673_100010306 3300005364 Bacteria 6321
68 Ga0070673_101539176 3300005364 Bacteria 628
69 Ga0070659_100004211 3300005366 Bacteria 10269
70 Ga0070659_100004345 3300005366 Bacteria 10118
71 Ga0070659_100010071 3300005366 Bacteria 6960
72 Ga0070659_100068069 3300005366 Bacteria 2824
73 Ga0070659_100189959 3300005366 Bacteria 1688
74 Ga0070659_100321637 3300005366 Bacteria 1293
75 Ga0070659_100330303 3300005366 Unclassified 1276
76 Ga0070659_101215312 3300005366 Bacteria 667
77 Ga0070659_101485069 3300005366 Bacteria 604
78 Ga0070667_100002091 3300005367 Bacteria 17620
79 Ga0070667_100091190 3300005367 Bacteria 2620
80 Ga0070667_100114429 3300005367 Bacteria 2342
81 Ga0070714_100455907 3300005435 Bacteria 1215
82 Ga0070714_101970003 3300005435 Bacteria 570
83 Ga0070701_11141507 3300005438 Bacteria 550
84 Ga0070700_101026994 3300005441 Bacteria 679
85 Ga0070663_100004025 3300005455 Bacteria 8576
86 Ga0070663_100049278 3300005455 Bacteria 2990
87 Ga0070663_100096689 3300005455 Bacteria 2197
88 Ga0070678_101060444 3300005456 Bacteria 747
89 Ga0070662_100003155 3300005457 Bacteria 10241
90 Ga0070662_100003479 3300005457 Bacteria 9817
91 Ga0070662_100017276 3300005457 Bacteria 4861
92 Ga0070662_100188363 3300005457 Unclassified 1630
93 Ga0068867_100008041 3300005459 Bacteria 7453
94 Ga0068867_100122997 3300005459 Bacteria 2007
95 Ga0070685_10237222 3300005466 Unclassified 1202
96 Ga0070684_100097876 3300005535 Bacteria 2617
97 Ga0068853_100006609 3300005539 Bacteria 9230
98 Ga0068853_100032999 3300005539 Bacteria 4389
99 Ga0068853_101291893 3300005539 Bacteria 705
100 Ga0070672_100061279 3300005543 Bacteria 2965
101 Ga0070672_100089143 3300005543 Bacteria 2485
102 Ga0070693_100019899 3300005547 Bacteria 3530
103 Ga0070665_100005836 3300005548 Bacteria 12629
104 Ga0070665_100027367 3300005548 Bacteria 5744
105 Ga0070665_100382244 3300005548 Bacteria 1415
106 Ga0070665_100925679 3300005548 Bacteria 884
107 Ga0068855_100002720 3300005563 Bacteria 21788
108 Ga0068855_100054360 3300005563 Bacteria 4706
109 Ga0068855_100294384 3300005563 Bacteria 1799
110 Ga0068855_101005715 3300005563 Bacteria 876
111 Ga0068855_102382175 3300005563 Bacteria 528
112 Ga0070664_100004841 3300005564 Bacteria 10784
113 Ga0070664_100148690 3300005564 Bacteria 2067
114 Ga0070664_100809911 3300005564 Bacteria 876
115 Ga0070664_101197154 3300005564 Bacteria 717
116 Ga0070664_101991089 3300005564 Unclassified 551
117 Ga0068857_100002337 3300005577 Bacteria 15430
118 Ga0068857_100011311 3300005577 Bacteria 7764
119 Ga0068857_101287420 3300005577 Bacteria 709
120 Ga0068854_100028696 3300005578 Bacteria 3847
121 Ga0068854_100116632 3300005578 Unclassified 2021
122 Ga0068854_100225714 3300005578 Bacteria 1484
123 Ga0068854_100237794 3300005578 Bacteria 1449
124 Ga0068856_100000538 3300005614 Bacteria 41802
125 Ga0068856_100112232 3300005614 Bacteria 2723
126 Ga0068856_100230506 3300005614 Bacteria 1867
127 Ga0068856_100246487 3300005614 Bacteria 1802
128 Ga0068856_101258322 3300005614 Bacteria 756
129 Ga0070702_100177155 3300005615 Bacteria 1392
130 Ga0068852_100001259 3300005616 Bacteria 16883
131 Ga0068852_100053492 3300005616 Bacteria 3475
132 Ga0068852_100260972 3300005616 Bacteria 1663
133 Ga0068852_100706425 3300005616 Bacteria 1018
134 Ga0068859_100060129 3300005617 Bacteria 3829
135 Ga0068859_102924392 3300005617 Unclassified 523
136 Ga0068864_100001241 3300005618 Bacteria 21225
137 Ga0068864_100010872 3300005618 Bacteria 7524
138 Ga0068864_100080885 3300005618 Bacteria 2847
139 Ga0068866_10055233 3300005718 Bacteria 2039
140 Ga0068861_100717386 3300005719 Bacteria 931
141 Ga0068851_10009861 3300005834 Bacteria 4448
142 Ga0068870_10674752 3300005840 Bacteria 710
143 Ga0068863_100008879 3300005841 Bacteria 9813
144 Ga0068863_100293271 3300005841 Bacteria 1577
145 Ga0068858_100050928 3300005842 Bacteria 3832
146 Ga0068858_100181733 3300005842 Bacteria 1986
147 Ga0068858_101875986 3300005842 Unclassified 592
148 Ga0068860_100070910 3300005843 Bacteria 3312
149 Ga0068860_100243529 3300005843 Bacteria 1749
150 Ga0068860_100548700 3300005843 Bacteria 1158
151 Ga0068860_101104620 3300005843 Bacteria 812
152 Ga0068860_101317612 3300005843 Unclassified 743
153 Ga0068862_101414856 3300005844 Bacteria 699
154 Ga0075362_10185252 3300006177 Unclassified 1010
155 Ga0075366_10064254 3300006195 Bacteria 2183
156 Ga0075366_10156186 3300006195 Bacteria 1382
157 Ga0097621_100501650 3300006237 Bacteria 1099
158 Ga0075370_10374496 3300006353 Bacteria 852
159 Ga0068871_100314255 3300006358 Bacteria 1378
160 Ga0068871_100770893 3300006358 Unclassified 885
161 Ga0068865_100005554 3300006881 Bacteria 7648
162 Ga0097620_100060129 3300006931 Bacteria 3829
163 Ga0097620_102923561 3300006931 Unclassified 523
164 Ga0105240_10251421 3300009093 Unclassified 2044
165 Ga0105245_10000782 3300009098 Bacteria 28837
166 Ga0105243_10128177 3300009148 Bacteria 2149
167 Ga0105241_10060615 3300009174 Bacteria 2911
168 Ga0105241_10384031 3300009174 Bacteria 1228
169 Ga0105242_10208097 3300009176 Bacteria 1741
170 Ga0105248_10000443 3300009177 Bacteria 47083
171 Ga0105248_10003845 3300009177 Bacteria 16630
172 Ga0105248_10101834 3300009177 Bacteria 3237
173 Ga0105248_10681596 3300009177 Bacteria 1160
174 Ga0105248_12025696 3300009177 Bacteria 654
175 Ga0105238_10079835 3300009551 Bacteria 3261
176 Ga0105239_10020946 3300010375 Bacteria 7213
177 Ga0105246_10007706 3300011119 Bacteria 6605
178 Ga0105246_10097921 3300011119 Bacteria 2130
179 Ga0157373_10042025 3300013100 Bacteria 3268
180 Ga0157373_10050093 3300013100 Bacteria 2975
181 Ga0157373_10060575 3300013100 Bacteria 2681
182 Ga0157373_10973855 3300013100 Unclassified 632
183 Ga0157371_10005198 3300013102 Bacteria 11066
184 Ga0157371_10008659 3300013102 Bacteria 8083
185 Ga0157371_10058334 3300013102 Bacteria 2738
186 Ga0157371_10402067 3300013102 Unclassified 1002
187 Ga0157371_10741771 3300013102 Bacteria 737
188 Ga0157371_11004210 3300013102 Bacteria 637
189 Ga0157371_11226065 3300013102 Bacteria 579
190 Ga0157370_10176867 3300013104 Bacteria 1983
191 Ga0157370_10990875 3300013104 Bacteria 761
192 Ga0157369_10151556 3300013105 Bacteria 2450
193 Ga0157369_10313943 3300013105 Bacteria 1630
194 Ga0157369_11743629 3300013105 Unclassified 633
195 Ga0157374_10104177 3300013296 Bacteria 2723
196 Ga0157374_10121425 3300013296 Bacteria 2522
197 Ga0157374_11081040 3300013296 Bacteria 822
198 Ga0157374_11704982 3300013296 Bacteria 655
199 Ga0157378_10022210 3300013297 Bacteria 5584
200 Ga0157378_11453793 3300013297 Bacteria 729
201 Ga0163162_10160585 3300013306 Bacteria 2369
202 Ga0163162_11555214 3300013306 Bacteria 754
203 Ga0157372_10197417 3300013307 Unclassified 2331
204 Ga0157372_10204285 3300013307 Bacteria 2289
205 Ga0157372_10599810 3300013307 Bacteria 1284
206 Ga0157372_10636881 3300013307 Bacteria 1242
207 Ga0157372_11213320 3300013307 Bacteria 871
208 Ga0157375_10115316 3300013308 Bacteria 2789
209 Ga0157375_12973265 3300013308 Unclassified 566
210 Ga0163163_10000058 3300014325 Bacteria 123478
211 Ga0163163_10177794 3300014325 Bacteria 2175
212 Ga0157380_11839815 3300014326 Bacteria 665
213 Ga0157377_10063203 3300014745 Bacteria 2120
214 Ga0157377_10171874 3300014745 Unclassified 1356
215 Ga0157379_10012614 3300014968 Bacteria 7382
216 Ga0157379_10147537 3300014968 Bacteria 2121
217 Ga0206350_11096168 3300020080 Bacteria 561
218 Ga0209257_1005674 3300025304 Bacteria 8604
219 Ga0207697_10003187 3300025315 Bacteria 8160
220 Ga0207656_10004042 3300025321 Bacteria 5090
221 Ga0207656_10145172 3300025321 Bacteria 1121
222 Ga0207642_10493520 3300025899 Bacteria 748
223 Ga0207688_10203916 3300025901 Bacteria 1187
224 Ga0207680_10012374 3300025903 Bacteria 4343
225 Ga0207680_10035996 3300025903 Bacteria 2848
226 Ga0207647_10013604 3300025904 Bacteria 5634
227 Ga0207647_10016767 3300025904 Bacteria 4991
228 Ga0207647_10047835 3300025904 Bacteria 2658
229 Ga0207647_10067163 3300025904 Bacteria 2174
230 Ga0207647_10085108 3300025904 Bacteria 1891
231 Ga0207645_10015526 3300025907 Bacteria 5057
232 Ga0207643_10125879 3300025908 Bacteria 1521
233 Ga0207705_10002347 3300025909 Bacteria 14636
234 Ga0207705_10089556 3300025909 Bacteria 2252
235 Ga0207705_10103475 3300025909 Bacteria 2097
236 Ga0207705_10174512 3300025909 Bacteria 1620
237 Ga0207705_10299218 3300025909 Bacteria 1234
238 Ga0207705_10496941 3300025909 Unclassified 947
239 Ga0207705_10865480 3300025909 Bacteria 701
240 Ga0207705_10914860 3300025909 Bacteria 679
241 Ga0207705_10973361 3300025909 Unclassified 656
242 Ga0207705_11323001 3300025909 Unclassified 550
243 Ga0207654_10069321 3300025911 Unclassified 2089
244 Ga0207654_10082082 3300025911 Bacteria 1943
245 Ga0207695_10038233 3300025913 Bacteria 5169
246 Ga0207695_10600691 3300025913 Bacteria 981
247 Ga0207660_11230233 3300025917 Bacteria 609
248 Ga0207657_10000126 3300025919 Bacteria 76430
249 Ga0207657_10009347 3300025919 Bacteria 9867
250 Ga0207657_10128352 3300025919 Bacteria 2080
251 Ga0207657_10435724 3300025919 Bacteria 1029
252 Ga0207657_10436475 3300025919 Bacteria 1028
253 Ga0207657_11279539 3300025919 Unclassified 555
254 Ga0207649_10000937 3300025920 Bacteria 18258
255 Ga0207649_10004887 3300025920 Bacteria 7249
256 Ga0207649_10650346 3300025920 Bacteria 814
257 Ga0207652_10405992 3300025921 Bacteria 1229
258 Ga0207652_10706333 3300025921 Bacteria 899
259 Ga0207681_10010000 3300025923 Bacteria 5806
260 Ga0207681_10325184 3300025923 Bacteria 1224
261 Ga0207681_10353964 3300025923 Bacteria 1176
262 Ga0207694_10200517 3300025924 Bacteria 1623
263 Ga0207650_10003655 3300025925 Bacteria 10522
264 Ga0207650_10011665 3300025925 Bacteria 6054
265 Ga0207650_10032491 3300025925 Bacteria 3775
266 Ga0207659_10469907 3300025926 Bacteria 1061
267 Ga0207659_11659972 3300025926 Unclassified 545
268 Ga0207687_10013795 3300025927 Bacteria 5278
269 Ga0207644_10012689 3300025931 Bacteria 5601
270 Ga0207644_10068554 3300025931 Bacteria 2588
271 Ga0207690_10000106 3300025932 Bacteria 67786
272 Ga0207690_10006739 3300025932 Bacteria 6808
273 Ga0207690_10021928 3300025932 Bacteria 3967
274 Ga0207690_10069367 3300025932 Bacteria 2425
275 Ga0207690_10752391 3300025932 Bacteria 803
276 Ga0207690_10773564 3300025932 Bacteria 792
277 Ga0207690_10825599 3300025932 Unclassified 767
278 Ga0207690_10880787 3300025932 Bacteria 742
279 Ga0207706_10000151 3300025933 Bacteria 76455
280 Ga0207706_10005896 3300025933 Bacteria 11395
281 Ga0207706_10029147 3300025933 Bacteria 4928
282 Ga0207670_10113380 3300025936 Bacteria 1958
283 Ga0207669_10009539 3300025937 Bacteria 4631
284 Ga0207669_10094289 3300025937 Bacteria 1958
285 Ga0207704_10006757 3300025938 Bacteria 5376
286 Ga0207691_10007770 3300025940 Bacteria 10327
287 Ga0207691_10134197 3300025940 Bacteria 2185
288 Ga0207711_10001912 3300025941 Bacteria 18916
289 Ga0207711_10004040 3300025941 Bacteria 12594
290 Ga0207711_10020785 3300025941 Bacteria 5477
291 Ga0207711_10279823 3300025941 Bacteria 1536
292 Ga0207689_10000167 3300025942 Bacteria 57116
293 Ga0207689_11567860 3300025942 Bacteria 549
294 Ga0207661_10006497 3300025944 Bacteria 8265
295 Ga0207661_11169757 3300025944 Bacteria 708
296 Ga0207679_10002382 3300025945 Bacteria 11568
297 Ga0207679_10475078 3300025945 Bacteria 1112
298 Ga0207667_10002108 3300025949 Bacteria 24944
299 Ga0207667_10042138 3300025949 Bacteria 4854
300 Ga0207667_10284484 3300025949 Bacteria 1690
301 Ga0207651_10009127 3300025960 Bacteria 5402
302 Ga0207668_10071748 3300025972 Bacteria 2475
303 Ga0207640_10025143 3300025981 Bacteria 3601
304 Ga0207640_10035980 3300025981 Bacteria 3104
305 Ga0207640_10077650 3300025981 Bacteria 2258
306 Ga0207640_10249811 3300025981 Bacteria 1376
307 Ga0207658_10002624 3300025986 Bacteria 13051
308 Ga0207658_10029117 3300025986 Bacteria 3896
309 Ga0207677_10043649 3300026023 Bacteria 2982
310 Ga0207703_10115143 3300026035 Bacteria 2300
311 Ga0207703_10156311 3300026035 Bacteria 1993
312 Ga0207639_10000573 3300026041 Bacteria 25324
313 Ga0207639_10002893 3300026041 Bacteria 11542
314 Ga0207639_11025388 3300026041 Bacteria 773
315 Ga0207678_10006756 3300026067 Bacteria 10174
316 Ga0207678_10010888 3300026067 Bacteria 7992
317 Ga0207678_10040488 3300026067 Bacteria 4041
318 Ga0207678_10044567 3300026067 Bacteria 3837
319 Ga0207678_10570384 3300026067 Bacteria 991
320 Ga0207702_10001045 3300026078 Bacteria 28350
321 Ga0207702_10092718 3300026078 Bacteria 2648
322 Ga0207702_10226895 3300026078 Bacteria 1743
323 Ga0207702_10647226 3300026078 Bacteria 1039
324 Ga0207702_11381153 3300026078 Bacteria 698
325 Ga0207641_10006636 3300026088 Bacteria 9715
326 Ga0207641_12604265 3300026088 Bacteria 504
327 Ga0207648_10001222 3300026089 Bacteria 28812
328 Ga0207648_10016014 3300026089 Bacteria 6869
329 Ga0207676_10007892 3300026095 Bacteria 7571
330 Ga0207676_10016650 3300026095 Bacteria 5325
331 Ga0207676_10031648 3300026095 Bacteria 3980
332 Ga0207676_10107859 3300026095 Bacteria 2323
333 Ga0207676_10251030 3300026095 Bacteria 1592
334 Ga0207676_11417808 3300026095 Bacteria 691
335 Ga0207674_10002073 3300026116 Bacteria 25416
336 Ga0207674_10003779 3300026116 Bacteria 18470
337 Ga0207674_10635407 3300026116 Bacteria 1031
338 Ga0207675_100045075 3300026118 Bacteria 4120
339 Ga0207698_10002899 3300026142 Bacteria 10260
340 Ga0207698_10026332 3300026142 Bacteria 4113
341 Ga0207698_10049615 3300026142 Bacteria 3196
342 Ga0207698_10530824 3300026142 Bacteria 1150
343 Ga0268266_10000950 3300028379 Bacteria 36937
344 Ga0268266_10017332 3300028379 Bacteria 6147
345 Ga0268266_10828334 3300028379 Bacteria 894
346 Ga0307515_10359232 3300028794 Bacteria 1099
347 Ga0307408_100081935 3300031548 Bacteria 2414
348 Ga0307405_10115273 3300031731 Bacteria 1828
349 Ga0307413_10033984 3300031824 Bacteria 2909
350 Ga0307413_11081818 3300031824 Bacteria 691
351 Ga0307413_11253256 3300031824 Bacteria 647
352 Ga0307410_10015921 3300031852 Bacteria 4470
353 Ga0307410_10426408 3300031852 Bacteria 1077
354 Ga0307407_10979547 3300031903 Bacteria 652
355 Ga0307412_10269777 3300031911 Bacteria 1331
356 Ga0307409_100007295 3300031995 Bacteria 6600
357 Ga0307409_101047440 3300031995 Bacteria 835
358 Ga0307416_100011123 3300032002 Bacteria 5985
359 Ga0307416_102897196 3300032002 Bacteria 574
360 Ga0307414_10019348 3300032004 Bacteria 4217
361 Ga0307414_10276570 3300032004 Bacteria 1409
362 Ga0307411_10006880 3300032005 Bacteria 5733
363 Ga0307411_10196236 3300032005 Bacteria 1546
364 Ga0307411_10647321 3300032005 Bacteria 914
365 Ga0307415_100001290 3300032126 Bacteria 11817
366 Ga0307415_100049467 3300032126 Bacteria 2843
367 Ga0373951_0141259 3300035091 Bacteria 669
368 Ga0373939_0027810 3300035114 Bacteria 1605
369 Ga0373943_0007352 3300035170 Bacteria 4945
370 Ga0373946_0016959 3300035171 Bacteria 2781
371 Ga0373942_0126811 3300035207 Bacteria 802
372 Ga0373962_0048664 3300035242 Bacteria 1216
373 Ga0373931_0308469 3300035691 Bacteria 979
374 Ga0373935_0420357 3300035692 Bacteria 962
375 Ga0373927_0057767 3300035695 Bacteria 2509
376 Ga0373925_0033179 3300037068 Bacteria 3805
377 Ga0395899_0025167 3300037312 Bacteria 4495
378 Ga0395899_0030099 3300037312 Bacteria 4084
379 Ga0395899_0054789 3300037312 Bacteria 2950
380 Ga0395899_0089925 3300037312 Bacteria 2226
381 Ga0395899_0410681 3300037312 Bacteria 894
382 Ga0395899_0476198 3300037312 Bacteria 814
383 Ga0395900_0007724 3300037418 Bacteria 11091
384 Ga0395900_0022607 3300037418 Bacteria 6435
385 Ga0395900_0027275 3300037418 Bacteria 5848
386 Ga0395900_0033836 3300037418 Bacteria 5259
387 Ga0395900_0073120 3300037418 Bacteria 3524
388 Ga0395900_0085076 3300037418 Bacteria 3250
389 Ga0395900_0108524 3300037418 Bacteria 2851
390 Ga0395900_0131992 3300037418 Bacteria 2559
391 Ga0395900_0196244 3300037418 Bacteria 2045
392 Ga0395900_0206376 3300037418 Bacteria 1986
393 Ga0395900_0273050 3300037418 Bacteria 1685
394 Ga0395900_0401685 3300037418 Bacteria 1334
395 Ga0395900_0408822 3300037418 Bacteria 1320
396 Ga0395900_0458836 3300037418 Bacteria 1229
397 Ga0395900_0922985 3300037418 Bacteria 795
398 Ga0395900_1326620 3300037418 Bacteria 633
399 Ga0395900_1812479 3300037418 Bacteria 521
400 Ga0395898_0008927 3300037466 Bacteria 10558
401 Ga0395898_0016010 3300037466 Bacteria 7680
402 Ga0395898_0055058 3300037466 Bacteria 3880
403 Ga0395898_0199573 3300037466 Bacteria 1910
404 Ga0395898_0251225 3300037466 Bacteria 1686
405 Ga0395898_0300269 3300037466 Bacteria 1532
406 Ga0395898_0588861 3300037466 Bacteria 1055
407 Ga0395898_0932874 3300037466 Bacteria 805
408 Ga0395898_1733103 3300037466 Bacteria 547
409 Ga0395905_0009247 3300037471 Bacteria 9646
410 Ga0395905_0010012 3300037471 Bacteria 9241
411 Ga0395905_0014735 3300037471 Bacteria 7455
412 Ga0395905_0040657 3300037471 Bacteria 4362
413 Ga0395905_0058199 3300037471 Bacteria 3614
414 Ga0395905_0102517 3300037471 Bacteria 2686
415 Ga0395905_0113152 3300037471 Bacteria 2549
416 Ga0395905_0123225 3300037471 Bacteria 2437
417 Ga0395905_0219643 3300037471 Bacteria 1779
418 Ga0395905_0254464 3300037471 Bacteria 1640
419 Ga0395905_0592483 3300037471 Bacteria 1010
420 Ga0395905_1035231 3300037471 Bacteria 724
421 Ga0395905_1147405 3300037471 Bacteria 680
422 Ga0436364_0219673 3300037853 Bacteria 931
423 Ga0436364_0755345 3300037853 Bacteria 36897
424 Ga0395901_0006189 3300038443 Bacteria 12126
425 Ga0395901_0007713 3300038443 Bacteria 10854
426 Ga0395901_0023864 3300038443 Bacteria 6273
427 Ga0395901_0025512 3300038443 Bacteria 6068
428 Ga0395901_0035010 3300038443 Bacteria 5188
429 Ga0395901_0043349 3300038443 Bacteria 4668
430 Ga0395901_0044592 3300038443 Bacteria 4599
431 Ga0395901_0048833 3300038443 Bacteria 4395
432 Ga0395901_0167363 3300038443 Bacteria 2307
433 Ga0395901_0284858 3300038443 Bacteria 1716
434 Ga0395901_0428250 3300038443 Unclassified 1356
435 Ga0395901_0582015 3300038443 Bacteria 1131
436 Ga0395901_1213635 3300038443 Bacteria 719
437 Ga0451798_1147024 3300041458 Bacteria 751
438 Ga0439445_0020157 3300042004 Bacteria 1667
439 Ga0439448_0004253 3300042005 Bacteria 4035
440 Ga0439432_044624 3300042006 Bacteria 1396
441 Ga0439449_0047741 3300042007 Bacteria 1585
442 Ga0439455_0151325 3300042012 Bacteria 660
443 Ga0439457_062596 3300042014 Bacteria 844
444 Ga0450923_016796 3300042125 Bacteria 1383
445 Ga0450923_196282 3300042125 Bacteria 501
446 Ga0450898_089057 3300042134 Bacteria 635
447 Ga0439458_0000154 3300042157 Bacteria 15118
448 Ga0439458_0000268 3300042157 Bacteria 12769
449 Ga0466969_0342983 3300044656 Bacteria 676
450 Ga0466972_0086811 3300044658 Bacteria 1487
451 Ga0466965_0698772 3300044683 Bacteria 582
452 Ga0466965_0823072 3300044683 Unclassified 538
453 Ga0466966_0102477 3300044684 Bacteria 1769
454 Ga0466963_0011810 3300044694 Bacteria 5328
455 Ga0466963_0016999 3300044694 Bacteria 4531
456 Ga0466963_0874574 3300044694 Bacteria 633
457 Ga0466963_1228140 3300044694 Unclassified 526
458 Ga0466964_0478975 3300044706 Bacteria 665
459 Ga0466970_0038621 3300044765 Bacteria 2533
460 Ga0466970_0062943 3300044765 Bacteria 1989
461 Ga0466957_0062554 3300044842 Bacteria 2286
462 Ga0466957_0103080 3300044842 Bacteria 1801
463 Ga0466957_0239652 3300044842 Bacteria 1203
464 Ga0466957_0339745 3300044842 Bacteria 1017
465 Ga0466957_0363780 3300044842 Bacteria 984
466 Ga0466957_0915841 3300044842 Bacteria 627
467 Ga0466959_0206105 3300045049 Bacteria 1368
468 Ga0466967_0007211 3300045976 Bacteria 7988
469 Ga0466967_0034787 3300045976 Bacteria 4281
470 Ga0466967_0186458 3300045976 Bacteria 1959
471 Ga0466967_0210844 3300045976 Bacteria 1842
472 Ga0466967_0308512 3300045976 Bacteria 1524
473 Ga0466967_0371621 3300045976 Bacteria 1387
474 Ga0466967_0584268 3300045976 Bacteria 1101
475 Ga0466967_0718956 3300045976 Bacteria 990
476 Ga0466967_1650810 3300045976 Bacteria 638
477 Ga0495597_0016597 3300046542 Bacteria 3477
478 Ga0495668_0209510 3300046616 Bacteria 1067
479 Ga0495668_0564200 3300046616 Bacteria 628
480 Ga0495625_0042984 3300046660 Bacteria 3280
481 Ga0495669_0085688 3300046684 Bacteria 1450
482 Ga0495670_0000066 3300046691 Bacteria 46500
483 Ga0496101_0318541 3300048904 Bacteria 1220
484 Ga0496106_1246089 3300048909 Bacteria 579
485 Ga0496107_0186800 3300048910 Bacteria 1539
486 Ga0496107_0721599 3300048910 Bacteria 732
487 Ga0496108_0145985 3300048911 Bacteria 2040
488 Ga0496109_0191881 3300048912 Bacteria 1920
489 Ga0496109_0692541 3300048912 Bacteria 956
490 Ga0496109_1665466 3300048912 Bacteria 572
491 Ga0496109_1856184 3300048912 Bacteria 535
492 Ga0496110_0061180 3300048913 Bacteria 3323
493 Ga0496110_0102725 3300048913 Bacteria 2564
494 Ga0496110_0644424 3300048913 Bacteria 959
495 Ga0496110_1649394 3300048913 Bacteria 551
496 Ga0496111_0158133 3300048914 Bacteria 1682
497 Ga0496111_0362500 3300048914 Bacteria 1073
498 Ga0496111_0487054 3300048914 Bacteria 908
499 Ga0496112_0475772 3300048915 Unclassified 1186
500 Ga0501295_183902 3300049518 Bacteria 525
501 Ga0501225_0058248 3300049705 Bacteria 1084
502 Ga0501269_052849 3300049766 Bacteria 562
503 nmdc:mga03683_185133_c1 3300050489 Unclassified 951
504 nmdc:mga0k408_159862_c1 3300050493 Bacteria 1342
505 nmdc:mga0k408_226820_c1 3300050493 Bacteria 1115
506 nmdc:mga07m45_122327_c1 3300050496 Bacteria 1503
507 Ga0500643_006643 3300053087 Bacteria 4804
508 Ga0500566_0000560 3300053094 Bacteria 20897
509 Ga0500650_0107524 3300053098 Bacteria 1303
510 Ga0500556_0000014 3300053104 Bacteria 232989
511 Ga0500557_113302 3300053105 Bacteria 900
512 Ga0500562_012077 3300053108 Bacteria 2194
513 Ga0500562_067615 3300053108 Bacteria 963
514 Ga0500642_0000001 3300053130 Bacteria 1468402
515 Ga0500652_231109 3300053131 Bacteria 740
516 Ga0500627_0147707 3300053158 Bacteria 1062
517 Ga0500645_006494 3300053730 Bacteria 4162
518 Ga0500596_058333 3300053735 Bacteria 642
519 Ga0587084_045075 3300059477 Bacteria 763
520 Ga0466962_0059360 3300061719 Bacteria 1826

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053735 Ga0500596_058333 Ga0500596_058333_24_320 93
2 3300049705 Ga0501225_0058248 Ga0501225_0058248_314_610 94
3 iso_pu_bacteria 2848297114 2848297393 94
4 3300037418 Ga0395900_1812479 Ga0395900_1812479_104_448 97
5 3300042004 Ga0439445_0020157 Ga0439445_0020157_649_975 97
6 3300042125 Ga0450923_016796 Ga0450923_016796_647_973 97
7 iso_pu_bacteria 2808606401 2809065342 98
8 iso_pu_bacteria 2808606404 2809081266 98
9 iso_pu_bacteria 2808606405 2809085631 98
10 iso_pu_bacteria 2880518877 2880520814 98
11 3300045976 Ga0466967_0584268 Ga0466967_0584268_441_767 99
12 3300005435 Ga0070714_100455907 Ga0070714_1004559072 100
13 3300037312 Ga0395899_0054789 Ga0395899_0054789_215_559 100
14 3300037418 Ga0395900_0007724 Ga0395900_0007724_7031_7375 100
15 3300037466 Ga0395898_0008927 Ga0395898_0008927_2264_2608 100
16 3300037471 Ga0395905_0058199 Ga0395905_0058199_2969_3313 100
17 3300038443 Ga0395901_0025512 Ga0395901_0025512_1538_1882 100
18 3300044694 Ga0466963_0011810 Ga0466963_0011810_59_403 100
19 3300044842 Ga0466957_0915841 Ga0466957_0915841_215_559 100
20 3300045976 Ga0466967_0034787 Ga0466967_0034787_3676_4020 100
21 3300046691 Ga0495670_0000066 Ga0495670_0000066_30046_30363 100
22 3300053158 Ga0500627_0147707 Ga0500627_0147707_577_894 100
23 3300005367 Ga0070667_100114429 Ga0070667_1001144294 103
24 3300005843 Ga0068860_100070910 Ga0068860_1000709106 103
25 3300025304 Ga0209257_1005674 Ga0209257_10056743 103
26 3300025913 Ga0207695_10038233 Ga0207695_100382337 103
27 3300028794 Ga0307515_10359232 Ga0307515_103592322 103
28 3300037312 Ga0395899_0089925 Ga0395899_0089925_981_1304 103
29 3300037418 Ga0395900_0922985 Ga0395900_0922985_18_341 103
30 3300037466 Ga0395898_0932874 Ga0395898_0932874_276_599 103
31 3300038443 Ga0395901_0023864 Ga0395901_0023864_2663_2986 103
32 3300041458 Ga0451798_1147024 Ga0451798_1147024_251_580 103
33 3300044658 Ga0466972_0086811 Ga0466972_0086811_612_935 103
34 3300044765 Ga0466970_0062943 Ga0466970_0062943_1104_1427 103
35 3300044842 Ga0466957_0239652 Ga0466957_0239652_59_382 103
36 3300045976 Ga0466967_0210844 Ga0466967_0210844_792_1115 103
37 3300045976 Ga0466967_0308512 Ga0466967_0308512_924_1247 103
38 3300049518 Ga0501295_183902 Ga0501295_183902_174_506 103
39 3300053108 Ga0500562_067615 Ga0500562_067615_400_726 103
40 3300053131 Ga0500652_231109 Ga0500652_231109_278_604 103
41 3300005327 Ga0070658_11350954 Ga0070658_113509542 104
42 3300006195 Ga0075366_10064254 Ga0075366_100642543 104
43 3300006353 Ga0075370_10374496 Ga0075370_103744963 104
44 3300013307 Ga0157372_11213320 Ga0157372_112133202 104
45 3300046542 Ga0495597_0016597 Ga0495597_0016597_3111_3446 104
46 3300046616 Ga0495668_0209510 Ga0495668_0209510_340_675 104
47 3300046660 Ga0495625_0042984 Ga0495625_0042984_2139_2474 104
48 3300049766 Ga0501269_052849 Ga0501269_052849_76_411 104
49 3300050493 nmdc:mga0k408_159862_c1 nmdc:mga0k408_159862_c1_461_796 104
50 3300050496 nmdc:mga07m45_122327_c1 nmdc:mga07m45_122327_c1_58_393 104
51 3300053087 Ga0500643_006643 Ga0500643_006643_2351_2686 104
52 3300053094 Ga0500566_0000560 Ga0500566_0000560_9030_9362 104
53 3300053098 Ga0500650_0107524 Ga0500650_0107524_240_575 104
54 3300053104 Ga0500556_0000014 Ga0500556_0000014_85844_86179 104
55 3300053105 Ga0500557_113302 Ga0500557_113302_440_775 104
56 3300053108 Ga0500562_012077 Ga0500562_012077_399_734 104
57 3300053130 Ga0500642_0000001 Ga0500642_0000001_712123_712458 104
58 3300053730 Ga0500645_006494 Ga0500645_006494_2598_2933 104
59 3300005366 Ga0070659_101215312 Ga0070659_1012153122 106
60 3300031548 Ga0307408_100081935 Ga0307408_1000819356 106
61 3300031731 Ga0307405_10115273 Ga0307405_101152732 106
62 3300031824 Ga0307413_10033984 Ga0307413_100339845 106
63 3300031824 Ga0307413_11081818 Ga0307413_110818182 106
64 3300031824 Ga0307413_11253256 Ga0307413_112532562 106
65 3300031852 Ga0307410_10015921 Ga0307410_100159215 106
66 3300031903 Ga0307407_10979547 Ga0307407_109795471 106
67 3300031911 Ga0307412_10269777 Ga0307412_102697772 106
68 3300031995 Ga0307409_100007295 Ga0307409_1000072952 106
69 3300031995 Ga0307409_101047440 Ga0307409_1010474402 106
70 3300032002 Ga0307416_100011123 Ga0307416_1000111237 106
71 3300032002 Ga0307416_102897196 Ga0307416_1028971961 106
72 3300032004 Ga0307414_10019348 Ga0307414_100193485 106
73 3300032004 Ga0307414_10276570 Ga0307414_102765703 106
74 3300032005 Ga0307411_10006880 Ga0307411_100068806 106
75 3300032005 Ga0307411_10196236 Ga0307411_101962362 106
76 3300032005 Ga0307411_10647321 Ga0307411_106473212 106
77 3300032126 Ga0307415_100001290 Ga0307415_10000129011 106
78 3300032126 Ga0307415_100049467 Ga0307415_1000494674 106
79 3300042006 Ga0439432_044624 Ga0439432_044624_627_977 106
80 3300042007 Ga0439449_0047741 Ga0439449_0047741_457_807 106
81 3300042014 Ga0439457_062596 Ga0439457_062596_58_402 106
82 3300042125 Ga0450923_196282 Ga0450923_196282_28_372 106
83 3300046616 Ga0495668_0564200 Ga0495668_0564200_47_376 106
84 3300048912 Ga0496109_0692541 Ga0496109_0692541_76_405 106
85 3300013100 Ga0157373_10060575 Ga0157373_100605753 107
86 3300013105 Ga0157369_11743629 Ga0157369_117436292 107
87 3300025942 Ga0207689_11567860 Ga0207689_115678602 107
88 3300042134 Ga0450898_089057 Ga0450898_089057_36_377 107
89 3300044706 Ga0466964_0478975 Ga0466964_0478975_16_339 107
90 3300048913 Ga0496110_0061180 Ga0496110_0061180_775_1122 107
91 3300042157 Ga0439458_0000268 Ga0439458_0000268_455_805 108
92 3300002067 JGI24735J21928_10026590 JGI24735J21928_100265901 109
93 3300005327 Ga0070658_10104808 Ga0070658_101048082 109
94 3300005327 Ga0070658_10117065 Ga0070658_101170654 109
95 3300005327 Ga0070658_11315729 Ga0070658_113157291 109
96 3300005614 Ga0068856_100112232 Ga0068856_1001122321 109
97 3300013102 Ga0157371_10058334 Ga0157371_100583344 109
98 3300013296 Ga0157374_11081040 Ga0157374_110810402 109
99 3300025909 Ga0207705_10089556 Ga0207705_100895564 109
100 3300025909 Ga0207705_10103475 Ga0207705_101034754 109
101 3300025909 Ga0207705_10299218 Ga0207705_102992181 109
102 3300025909 Ga0207705_10496941 Ga0207705_104969412 109
103 3300025909 Ga0207705_11323001 Ga0207705_113230012 109
104 3300025917 Ga0207660_11230233 Ga0207660_112302331 109
105 3300025919 Ga0207657_10435724 Ga0207657_104357242 109
106 3300025919 Ga0207657_10436475 Ga0207657_104364752 109
107 3300025921 Ga0207652_10706333 Ga0207652_107063332 109
108 3300025932 Ga0207690_10752391 Ga0207690_107523911 109
109 3300026067 Ga0207678_10006756 Ga0207678_1000675610 109
110 3300037418 Ga0395900_0401685 Ga0395900_0401685_944_1273 109
111 3300037471 Ga0395905_0123225 Ga0395905_0123225_1420_1749 109
112 3300001979 JGI24740J21852_10006386 JGI24740J21852_1000638610 110
113 3300001979 JGI24740J21852_10055235 JGI24740J21852_100552351 110
114 3300001989 JGI24739J22299_10000378 JGI24739J22299_1000037819 110
115 3300001989 JGI24739J22299_10023939 JGI24739J22299_100239393 110
116 3300001990 JGI24737J22298_10000438 JGI24737J22298_100004388 110
117 3300001990 JGI24737J22298_10001085 JGI24737J22298_100010852 110
118 3300001990 JGI24737J22298_10001931 JGI24737J22298_1000193110 110
119 3300001990 JGI24737J22298_10003378 JGI24737J22298_1000337811 110
120 3300002070 JGI24750J21931_1086221 JGI24750J21931_10862211 110
121 3300002075 JGI24738J21930_10003426 JGI24738J21930_100034262 110
122 3300002126 JGI24035J26624_1001446 JGI24035J26624_10014465 110
123 3300005290 Ga0065712_10096286 Ga0065712_100962861 110
124 3300005327 Ga0070658_10003538 Ga0070658_1000353814 110
125 3300005327 Ga0070658_10155221 Ga0070658_101552212 110
126 3300005327 Ga0070658_10230811 Ga0070658_102308114 110
127 3300005327 Ga0070658_10783061 Ga0070658_107830612 110
128 3300005327 Ga0070658_11410158 Ga0070658_114101581 110
129 3300005328 Ga0070676_10005815 Ga0070676_1000581511 110
130 3300005328 Ga0070676_10005815 Ga0070676_1000581512 110
131 3300005328 Ga0070676_10132106 Ga0070676_101321063 110
132 3300005329 Ga0070683_100005945 Ga0070683_1000059459 110
133 3300005330 Ga0070690_100057917 Ga0070690_1000579172 110
134 3300005330 Ga0070690_100157438 Ga0070690_1001574384 110
135 3300005330 Ga0070690_100157438 Ga0070690_1001574385 110
136 3300005331 Ga0070670_100002725 Ga0070670_1000027255 110
137 3300005331 Ga0070670_100034717 Ga0070670_1000347173 110
138 3300005331 Ga0070670_100065445 Ga0070670_1000654456 110
139 3300005331 Ga0070670_100994455 Ga0070670_1009944552 110
140 3300005334 Ga0068869_100000728 Ga0068869_1000007285 110
141 3300005334 Ga0068869_100000728 Ga0068869_1000007286 110
142 3300005334 Ga0068869_101550017 Ga0068869_1015500172 110
143 3300005335 Ga0070666_10000623 Ga0070666_100006236 110
144 3300005335 Ga0070666_10033780 Ga0070666_100337805 110
145 3300005336 Ga0070680_101712779 Ga0070680_1017127791 110
146 3300005337 Ga0070682_100012598 Ga0070682_1000125982 110
147 3300005338 Ga0068868_100006361 Ga0068868_10000636112 110
148 3300005338 Ga0068868_100006361 Ga0068868_10000636113 110
149 3300005338 Ga0068868_100645563 Ga0068868_1006455632 110
150 3300005339 Ga0070660_100000560 Ga0070660_10000056015 110
151 3300005339 Ga0070660_100233247 Ga0070660_1002332472 110
152 3300005339 Ga0070660_100233247 Ga0070660_1002332473 110
153 3300005339 Ga0070660_100298812 Ga0070660_1002988122 110
154 3300005339 Ga0070660_100557161 Ga0070660_1005571612 110
155 3300005339 Ga0070660_100618015 Ga0070660_1006180151 110
156 3300005339 Ga0070660_101556080 Ga0070660_1015560801 110
157 3300005339 Ga0070660_101643002 Ga0070660_1016430021 110
158 3300005339 Ga0070660_101932395 Ga0070660_1019323951 110
159 3300005340 Ga0070689_100129460 Ga0070689_1001294604 110
160 3300005344 Ga0070661_100000075 Ga0070661_10000007514 110
161 3300005344 Ga0070661_100012615 Ga0070661_1000126155 110
162 3300005344 Ga0070661_100053915 Ga0070661_1000539154 110
163 3300005344 Ga0070661_100053915 Ga0070661_1000539155 110
164 3300005344 Ga0070661_100845167 Ga0070661_1008451672 110
165 3300005344 Ga0070661_100865048 Ga0070661_1008650481 110
166 3300005345 Ga0070692_10611819 Ga0070692_106118191 110
167 3300005347 Ga0070668_100238951 Ga0070668_1002389515 110
168 3300005353 Ga0070669_100000565 Ga0070669_10000056510 110
169 3300005353 Ga0070669_100239061 Ga0070669_1002390612 110
170 3300005353 Ga0070669_100573039 Ga0070669_1005730392 110
171 3300005354 Ga0070675_100043992 Ga0070675_1000439924 110
172 3300005354 Ga0070675_100043992 Ga0070675_1000439925 110
173 3300005354 Ga0070675_100719424 Ga0070675_1007194241 110
174 3300005354 Ga0070675_101645997 Ga0070675_1016459971 110
175 3300005355 Ga0070671_100040800 Ga0070671_1000408007 110
176 3300005355 Ga0070671_100062925 Ga0070671_1000629257 110
177 3300005355 Ga0070671_101653758 Ga0070671_1016537581 110
178 3300005356 Ga0070674_100010817 Ga0070674_1000108179 110
179 3300005356 Ga0070674_100542519 Ga0070674_1005425192 110
180 3300005364 Ga0070673_100010306 Ga0070673_10001030610 110
181 3300005364 Ga0070673_100010306 Ga0070673_1000103069 110
182 3300005364 Ga0070673_101539176 Ga0070673_1015391761 110
183 3300005366 Ga0070659_100004211 Ga0070659_10000421110 110
184 3300005366 Ga0070659_100004211 Ga0070659_1000042119 110
185 3300005366 Ga0070659_100004345 Ga0070659_1000043459 110
186 3300005366 Ga0070659_100010071 Ga0070659_1000100715 110
187 3300005366 Ga0070659_100068069 Ga0070659_1000680695 110
188 3300005366 Ga0070659_100189959 Ga0070659_1001899592 110
189 3300005366 Ga0070659_100321637 Ga0070659_1003216372 110
190 3300005366 Ga0070659_100330303 Ga0070659_1003303034 110
191 3300005366 Ga0070659_101485069 Ga0070659_1014850692 110
192 3300005367 Ga0070667_100002091 Ga0070667_10000209111 110
193 3300005367 Ga0070667_100091190 Ga0070667_1000911903 110
194 3300005435 Ga0070714_101970003 Ga0070714_1019700031 110
195 3300005438 Ga0070701_11141507 Ga0070701_111415072 110
196 3300005441 Ga0070700_101026994 Ga0070700_1010269941 110
197 3300005455 Ga0070663_100004025 Ga0070663_1000040257 110
198 3300005455 Ga0070663_100049278 Ga0070663_1000492784 110
199 3300005455 Ga0070663_100096689 Ga0070663_1000966893 110
200 3300005456 Ga0070678_101060444 Ga0070678_1010604442 110
201 3300005457 Ga0070662_100003155 Ga0070662_1000031559 110
202 3300005457 Ga0070662_100003479 Ga0070662_10000347915 110
203 3300005457 Ga0070662_100017276 Ga0070662_1000172768 110
204 3300005457 Ga0070662_100188363 Ga0070662_1001883631 110
205 3300005459 Ga0068867_100008041 Ga0068867_1000080419 110
206 3300005459 Ga0068867_100122997 Ga0068867_1001229972 110
207 3300005466 Ga0070685_10237222 Ga0070685_102372223 110
208 3300005535 Ga0070684_100097876 Ga0070684_1000978762 110
209 3300005539 Ga0068853_100006609 Ga0068853_1000066097 110
210 3300005539 Ga0068853_100032999 Ga0068853_1000329997 110
211 3300005539 Ga0068853_100032999 Ga0068853_1000329998 110
212 3300005539 Ga0068853_101291893 Ga0068853_1012918932 110
213 3300005543 Ga0070672_100061279 Ga0070672_1000612797 110
214 3300005543 Ga0070672_100089143 Ga0070672_1000891435 110
215 3300005547 Ga0070693_100019899 Ga0070693_1000198997 110
216 3300005548 Ga0070665_100005836 Ga0070665_10000583615 110
217 3300005548 Ga0070665_100027367 Ga0070665_1000273673 110
218 3300005548 Ga0070665_100382244 Ga0070665_1003822443 110
219 3300005548 Ga0070665_100925679 Ga0070665_1009256793 110
220 3300005563 Ga0068855_100002720 Ga0068855_10000272020 110
221 3300005563 Ga0068855_100054360 Ga0068855_1000543602 110
222 3300005563 Ga0068855_100294384 Ga0068855_1002943842 110
223 3300005563 Ga0068855_101005715 Ga0068855_1010057153 110
224 3300005563 Ga0068855_102382175 Ga0068855_1023821752 110
225 3300005564 Ga0070664_100004841 Ga0070664_1000048419 110
226 3300005564 Ga0070664_100148690 Ga0070664_1001486906 110
227 3300005564 Ga0070664_100809911 Ga0070664_1008099112 110
228 3300005564 Ga0070664_101197154 Ga0070664_1011971542 110
229 3300005564 Ga0070664_101991089 Ga0070664_1019910891 110
230 3300005577 Ga0068857_100002337 Ga0068857_10000233716 110
231 3300005577 Ga0068857_100011311 Ga0068857_1000113118 110
232 3300005577 Ga0068857_100011311 Ga0068857_1000113119 110
233 3300005577 Ga0068857_101287420 Ga0068857_1012874202 110
234 3300005578 Ga0068854_100028696 Ga0068854_1000286967 110
235 3300005578 Ga0068854_100028696 Ga0068854_1000286968 110
236 3300005578 Ga0068854_100116632 Ga0068854_1001166324 110
237 3300005578 Ga0068854_100225714 Ga0068854_1002257144 110
238 3300005578 Ga0068854_100237794 Ga0068854_1002377942 110
239 3300005614 Ga0068856_100000538 Ga0068856_1000005389 110
240 3300005614 Ga0068856_100230506 Ga0068856_1002305064 110
241 3300005614 Ga0068856_100246487 Ga0068856_1002464875 110
242 3300005614 Ga0068856_101258322 Ga0068856_1012583222 110
243 3300005615 Ga0070702_100177155 Ga0070702_1001771554 110
244 3300005616 Ga0068852_100001259 Ga0068852_1000012599 110
245 3300005616 Ga0068852_100053492 Ga0068852_1000534922 110
246 3300005616 Ga0068852_100260972 Ga0068852_1002609721 110
247 3300005616 Ga0068852_100706425 Ga0068852_1007064252 110
248 3300005617 Ga0068859_100060129 Ga0068859_1000601297 110
249 3300005617 Ga0068859_100060129 Ga0068859_1000601298 110
250 3300005617 Ga0068859_102924392 Ga0068859_1029243921 110
251 3300005618 Ga0068864_100001241 Ga0068864_10000124119 110
252 3300005618 Ga0068864_100001241 Ga0068864_10000124120 110
253 3300005618 Ga0068864_100010872 Ga0068864_10001087210 110
254 3300005618 Ga0068864_100080885 Ga0068864_1000808853 110
255 3300005718 Ga0068866_10055233 Ga0068866_100552336 110
256 3300005718 Ga0068866_10055233 Ga0068866_100552337 110
257 3300005719 Ga0068861_100717386 Ga0068861_1007173861 110
258 3300005719 Ga0068861_100717386 Ga0068861_1007173862 110
259 3300005834 Ga0068851_10009861 Ga0068851_100098618 110
260 3300005840 Ga0068870_10674752 Ga0068870_106747522 110
261 3300005841 Ga0068863_100008879 Ga0068863_10000887911 110
262 3300005841 Ga0068863_100293271 Ga0068863_1002932715 110
263 3300005842 Ga0068858_100050928 Ga0068858_1000509285 110
264 3300005842 Ga0068858_100050928 Ga0068858_1000509286 110
265 3300005842 Ga0068858_100181733 Ga0068858_1001817332 110
266 3300005842 Ga0068858_101875986 Ga0068858_1018759861 110
267 3300005843 Ga0068860_100243529 Ga0068860_1002435293 110
268 3300005843 Ga0068860_100548700 Ga0068860_1005487002 110
269 3300005843 Ga0068860_101104620 Ga0068860_1011046203 110
270 3300005843 Ga0068860_101317612 Ga0068860_1013176122 110
271 3300005844 Ga0068862_101414856 Ga0068862_1014148562 110
272 3300006177 Ga0075362_10185252 Ga0075362_101852522 110
273 3300006195 Ga0075366_10156186 Ga0075366_101561864 110
274 3300006237 Ga0097621_100501650 Ga0097621_1005016502 110
275 3300006358 Ga0068871_100314255 Ga0068871_1003142553 110
276 3300006358 Ga0068871_100770893 Ga0068871_1007708931 110
277 3300006881 Ga0068865_100005554 Ga0068865_10000555411 110
278 3300006931 Ga0097620_100060129 Ga0097620_1000601297 110
279 3300006931 Ga0097620_100060129 Ga0097620_1000601298 110
280 3300006931 Ga0097620_102923561 Ga0097620_1029235612 110
281 3300009093 Ga0105240_10251421 Ga0105240_102514213 110
282 3300009093 Ga0105240_10251421 Ga0105240_102514214 110
283 3300009098 Ga0105245_10000782 Ga0105245_1000078225 110
284 3300009148 Ga0105243_10128177 Ga0105243_101281775 110
285 3300009174 Ga0105241_10060615 Ga0105241_100606155 110
286 3300009174 Ga0105241_10384031 Ga0105241_103840313 110
287 3300009176 Ga0105242_10208097 Ga0105242_102080973 110
288 3300009176 Ga0105242_10208097 Ga0105242_102080974 110
289 3300009177 Ga0105248_10000443 Ga0105248_1000044335 110
290 3300009177 Ga0105248_10003845 Ga0105248_100038456 110
291 3300009177 Ga0105248_10003845 Ga0105248_100038457 110
292 3300009177 Ga0105248_10101834 Ga0105248_101018343 110
293 3300009177 Ga0105248_10681596 Ga0105248_106815962 110
294 3300009177 Ga0105248_12025696 Ga0105248_120256961 110
295 3300009551 Ga0105238_10079835 Ga0105238_100798353 110
296 3300010375 Ga0105239_10020946 Ga0105239_100209467 110
297 3300010375 Ga0105239_10020946 Ga0105239_100209468 110
298 3300011119 Ga0105246_10007706 Ga0105246_1000770610 110
299 3300011119 Ga0105246_10007706 Ga0105246_1000770611 110
300 3300011119 Ga0105246_10097921 Ga0105246_100979213 110
301 3300013100 Ga0157373_10042025 Ga0157373_100420253 110
302 3300013100 Ga0157373_10050093 Ga0157373_100500935 110
303 3300013100 Ga0157373_10973855 Ga0157373_109738552 110
304 3300013102 Ga0157371_10005198 Ga0157371_1000519815 110
305 3300013102 Ga0157371_10005198 Ga0157371_1000519816 110
306 3300013102 Ga0157371_10008659 Ga0157371_100086599 110
307 3300013102 Ga0157371_10402067 Ga0157371_104020672 110
308 3300013102 Ga0157371_10741771 Ga0157371_107417711 110
309 3300013102 Ga0157371_11004210 Ga0157371_110042102 110
310 3300013102 Ga0157371_11226065 Ga0157371_112260652 110
311 3300013104 Ga0157370_10176867 Ga0157370_101768674 110
312 3300013104 Ga0157370_10990875 Ga0157370_109908752 110
313 3300013105 Ga0157369_10151556 Ga0157369_101515567 110
314 3300013105 Ga0157369_10313943 Ga0157369_103139433 110
315 3300013296 Ga0157374_10104177 Ga0157374_101041773 110
316 3300013296 Ga0157374_10121425 Ga0157374_101214256 110
317 3300013296 Ga0157374_11704982 Ga0157374_117049822 110
318 3300013297 Ga0157378_10022210 Ga0157378_100222108 110
319 3300013297 Ga0157378_11453793 Ga0157378_114537931 110
320 3300013306 Ga0163162_10160585 Ga0163162_101605855 110
321 3300013306 Ga0163162_11555214 Ga0163162_115552142 110
322 3300013307 Ga0157372_10197417 Ga0157372_101974176 110
323 3300013307 Ga0157372_10204285 Ga0157372_102042856 110
324 3300013307 Ga0157372_10599810 Ga0157372_105998103 110
325 3300013307 Ga0157372_10636881 Ga0157372_106368813 110
326 3300013308 Ga0157375_10115316 Ga0157375_101153162 110
327 3300013308 Ga0157375_12973265 Ga0157375_129732652 110
328 3300014325 Ga0163163_10000058 Ga0163163_1000005815 110
329 3300014325 Ga0163163_10177794 Ga0163163_101777946 110
330 3300014326 Ga0157380_11839815 Ga0157380_118398152 110
331 3300014745 Ga0157377_10063203 Ga0157377_100632034 110
332 3300014745 Ga0157377_10063203 Ga0157377_100632035 110
333 3300014745 Ga0157377_10171874 Ga0157377_101718742 110
334 3300014968 Ga0157379_10012614 Ga0157379_1001261412 110
335 3300014968 Ga0157379_10147537 Ga0157379_101475376 110
336 3300020080 Ga0206350_11096168 Ga0206350_110961682 110
337 3300025315 Ga0207697_10003187 Ga0207697_1000318710 110
338 3300025315 Ga0207697_10003187 Ga0207697_100031879 110
339 3300025321 Ga0207656_10004042 Ga0207656_100040425 110
340 3300025321 Ga0207656_10145172 Ga0207656_101451721 110
341 3300025899 Ga0207642_10493520 Ga0207642_104935202 110
342 3300025901 Ga0207688_10203916 Ga0207688_102039162 110
343 3300025903 Ga0207680_10012374 Ga0207680_100123746 110
344 3300025903 Ga0207680_10035996 Ga0207680_100359962 110
345 3300025904 Ga0207647_10013604 Ga0207647_100136043 110
346 3300025904 Ga0207647_10016767 Ga0207647_100167677 110
347 3300025904 Ga0207647_10016767 Ga0207647_100167678 110
348 3300025904 Ga0207647_10047835 Ga0207647_100478353 110
349 3300025904 Ga0207647_10067163 Ga0207647_100671636 110
350 3300025904 Ga0207647_10085108 Ga0207647_100851084 110
351 3300025907 Ga0207645_10015526 Ga0207645_1001552610 110
352 3300025907 Ga0207645_10015526 Ga0207645_100155269 110
353 3300025908 Ga0207643_10125879 Ga0207643_101258792 110
354 3300025909 Ga0207705_10002347 Ga0207705_100023479 110
355 3300025909 Ga0207705_10174512 Ga0207705_101745122 110
356 3300025909 Ga0207705_10865480 Ga0207705_108654802 110
357 3300025909 Ga0207705_10914860 Ga0207705_109148602 110
358 3300025909 Ga0207705_10973361 Ga0207705_109733611 110
359 3300025911 Ga0207654_10069321 Ga0207654_100693213 110
360 3300025911 Ga0207654_10082082 Ga0207654_100820822 110
361 3300025913 Ga0207695_10600691 Ga0207695_106006912 110
362 3300025919 Ga0207657_10000126 Ga0207657_100001269 110
363 3300025919 Ga0207657_10009347 Ga0207657_100093473 110
364 3300025919 Ga0207657_10009347 Ga0207657_100093474 110
365 3300025919 Ga0207657_10128352 Ga0207657_101283526 110
366 3300025919 Ga0207657_11279539 Ga0207657_112795392 110
367 3300025920 Ga0207649_10000937 Ga0207649_100009371 110
368 3300025920 Ga0207649_10004887 Ga0207649_1000488711 110
369 3300025920 Ga0207649_10650346 Ga0207649_106503462 110
370 3300025921 Ga0207652_10405992 Ga0207652_104059923 110
371 3300025923 Ga0207681_10010000 Ga0207681_100100009 110
372 3300025923 Ga0207681_10325184 Ga0207681_103251843 110
373 3300025923 Ga0207681_10353964 Ga0207681_103539643 110
374 3300025924 Ga0207694_10200517 Ga0207694_102005173 110
375 3300025925 Ga0207650_10003655 Ga0207650_100036555 110
376 3300025925 Ga0207650_10011665 Ga0207650_100116659 110
377 3300025925 Ga0207650_10032491 Ga0207650_100324918 110
378 3300025926 Ga0207659_10469907 Ga0207659_104699072 110
379 3300025926 Ga0207659_10469907 Ga0207659_104699073 110
380 3300025926 Ga0207659_11659972 Ga0207659_116599721 110
381 3300025927 Ga0207687_10013795 Ga0207687_100137958 110
382 3300025931 Ga0207644_10012689 Ga0207644_100126896 110
383 3300025931 Ga0207644_10068554 Ga0207644_100685542 110
384 3300025931 Ga0207644_10068554 Ga0207644_100685543 110
385 3300025932 Ga0207690_10000106 Ga0207690_1000010651 110
386 3300025932 Ga0207690_10006739 Ga0207690_100067394 110
387 3300025932 Ga0207690_10006739 Ga0207690_100067395 110
388 3300025932 Ga0207690_10021928 Ga0207690_100219286 110
389 3300025932 Ga0207690_10069367 Ga0207690_100693675 110
390 3300025932 Ga0207690_10773564 Ga0207690_107735642 110
391 3300025932 Ga0207690_10825599 Ga0207690_108255992 110
392 3300025932 Ga0207690_10880787 Ga0207690_108807872 110
393 3300025933 Ga0207706_10000151 Ga0207706_1000015170 110
394 3300025933 Ga0207706_10005896 Ga0207706_1000589614 110
395 3300025933 Ga0207706_10029147 Ga0207706_100291476 110
396 3300025936 Ga0207670_10113380 Ga0207670_101133802 110
397 3300025937 Ga0207669_10009539 Ga0207669_100095395 110
398 3300025937 Ga0207669_10094289 Ga0207669_100942894 110
399 3300025937 Ga0207669_10094289 Ga0207669_100942895 110
400 3300025938 Ga0207704_10006757 Ga0207704_100067577 110
401 3300025938 Ga0207704_10006757 Ga0207704_100067578 110
402 3300025940 Ga0207691_10007770 Ga0207691_1000777015 110
403 3300025940 Ga0207691_10134197 Ga0207691_101341974 110
404 3300025941 Ga0207711_10001912 Ga0207711_1000191216 110
405 3300025941 Ga0207711_10004040 Ga0207711_1000404016 110
406 3300025941 Ga0207711_10020785 Ga0207711_100207852 110
407 3300025941 Ga0207711_10279823 Ga0207711_102798234 110
408 3300025942 Ga0207689_10000167 Ga0207689_1000016743 110
409 3300025942 Ga0207689_10000167 Ga0207689_1000016744 110
410 3300025944 Ga0207661_10006497 Ga0207661_1000649714 110
411 3300025944 Ga0207661_11169757 Ga0207661_111697571 110
412 3300025945 Ga0207679_10002382 Ga0207679_100023829 110
413 3300025945 Ga0207679_10475078 Ga0207679_104750781 110
414 3300025945 Ga0207679_10475078 Ga0207679_104750782 110
415 3300025949 Ga0207667_10002108 Ga0207667_1000210820 110
416 3300025949 Ga0207667_10042138 Ga0207667_100421381 110
417 3300025949 Ga0207667_10042138 Ga0207667_100421382 110
418 3300025949 Ga0207667_10284484 Ga0207667_102844844 110
419 3300025960 Ga0207651_10009127 Ga0207651_100091277 110
420 3300025960 Ga0207651_10009127 Ga0207651_100091278 110
421 3300025972 Ga0207668_10071748 Ga0207668_100717482 110
422 3300025981 Ga0207640_10025143 Ga0207640_100251432 110
423 3300025981 Ga0207640_10035980 Ga0207640_100359803 110
424 3300025981 Ga0207640_10077650 Ga0207640_100776504 110
425 3300025981 Ga0207640_10249811 Ga0207640_102498114 110
426 3300025986 Ga0207658_10002624 Ga0207658_1000262421 110
427 3300025986 Ga0207658_10029117 Ga0207658_100291175 110
428 3300026023 Ga0207677_10043649 Ga0207677_100436492 110
429 3300026023 Ga0207677_10043649 Ga0207677_100436493 110
430 3300026035 Ga0207703_10115143 Ga0207703_101151432 110
431 3300026035 Ga0207703_10156311 Ga0207703_101563116 110
432 3300026041 Ga0207639_10000573 Ga0207639_1000057314 110
433 3300026041 Ga0207639_10002893 Ga0207639_100028935 110
434 3300026041 Ga0207639_10002893 Ga0207639_100028936 110
435 3300026041 Ga0207639_11025388 Ga0207639_110253882 110
436 3300026067 Ga0207678_10010888 Ga0207678_100108889 110
437 3300026067 Ga0207678_10040488 Ga0207678_100404882 110
438 3300026067 Ga0207678_10044567 Ga0207678_100445676 110
439 3300026067 Ga0207678_10570384 Ga0207678_105703842 110
440 3300026078 Ga0207702_10001045 Ga0207702_1000104516 110
441 3300026078 Ga0207702_10092718 Ga0207702_100927188 110
442 3300026078 Ga0207702_10226895 Ga0207702_102268954 110
443 3300026078 Ga0207702_10647226 Ga0207702_106472262 110
444 3300026078 Ga0207702_11381153 Ga0207702_113811532 110
445 3300026088 Ga0207641_10006636 Ga0207641_1000663611 110
446 3300026088 Ga0207641_12604265 Ga0207641_126042652 110
447 3300026089 Ga0207648_10001222 Ga0207648_100012224 110
448 3300026089 Ga0207648_10001222 Ga0207648_100012225 110
449 3300026089 Ga0207648_10016014 Ga0207648_1001601410 110
450 3300026095 Ga0207676_10007892 Ga0207676_100078929 110
451 3300026095 Ga0207676_10016650 Ga0207676_100166501 110
452 3300026095 Ga0207676_10031648 Ga0207676_100316488 110
453 3300026095 Ga0207676_10107859 Ga0207676_101078595 110
454 3300026095 Ga0207676_10251030 Ga0207676_102510304 110
455 3300026095 Ga0207676_11417808 Ga0207676_114178081 110
456 3300026116 Ga0207674_10002073 Ga0207674_1000207327 110
457 3300026116 Ga0207674_10002073 Ga0207674_1000207328 110
458 3300026116 Ga0207674_10003779 Ga0207674_1000377921 110
459 3300026116 Ga0207674_10635407 Ga0207674_106354073 110
460 3300026118 Ga0207675_100045075 Ga0207675_1000450752 110
461 3300026118 Ga0207675_100045075 Ga0207675_1000450753 110
462 3300026142 Ga0207698_10002899 Ga0207698_100028996 110
463 3300026142 Ga0207698_10026332 Ga0207698_100263324 110
464 3300026142 Ga0207698_10049615 Ga0207698_100496155 110
465 3300026142 Ga0207698_10049615 Ga0207698_100496156 110
466 3300026142 Ga0207698_10530824 Ga0207698_105308242 110
467 3300028379 Ga0268266_10000950 Ga0268266_100009504 110
468 3300028379 Ga0268266_10017332 Ga0268266_100173329 110
469 3300028379 Ga0268266_10828334 Ga0268266_108283343 110
470 3300031852 Ga0307410_10426408 Ga0307410_104264084 110
471 3300035091 Ga0373951_0141259 Ga0373951_0141259_59_403 110
472 3300035114 Ga0373939_0027810 Ga0373939_0027810_684_1028 110
473 3300035170 Ga0373943_0007352 Ga0373943_0007352_1409_1753 110
474 3300035171 Ga0373946_0016959 Ga0373946_0016959_401_745 110
475 3300035207 Ga0373942_0126811 Ga0373942_0126811_421_765 110
476 3300035242 Ga0373962_0048664 Ga0373962_0048664_264_608 110
477 3300035691 Ga0373931_0308469 Ga0373931_0308469_260_604 110
478 3300035692 Ga0373935_0420357 Ga0373935_0420357_111_455 110
479 3300035695 Ga0373927_0057767 Ga0373927_0057767_441_785 110
480 3300037068 Ga0373925_0033179 Ga0373925_0033179_1120_1464 110
481 3300037312 Ga0395899_0025167 Ga0395899_0025167_1099_1443 110
482 3300037312 Ga0395899_0030099 Ga0395899_0030099_2574_2918 110
483 3300037312 Ga0395899_0410681 Ga0395899_0410681_455_799 110
484 3300037312 Ga0395899_0476198 Ga0395899_0476198_14_358 110
485 3300037418 Ga0395900_0022607 Ga0395900_0022607_1461_1805 110
486 3300037418 Ga0395900_0027275 Ga0395900_0027275_2112_2456 110
487 3300037418 Ga0395900_0033836 Ga0395900_0033836_2148_2492 110
488 3300037418 Ga0395900_0073120 Ga0395900_0073120_1407_1751 110
489 3300037418 Ga0395900_0085076 Ga0395900_0085076_1555_1899 110
490 3300037418 Ga0395900_0108524 Ga0395900_0108524_2243_2587 110
491 3300037418 Ga0395900_0131992 Ga0395900_0131992_841_1185 110
492 3300037418 Ga0395900_0196244 Ga0395900_0196244_1216_1560 110
493 3300037418 Ga0395900_0206376 Ga0395900_0206376_1482_1826 110
494 3300037418 Ga0395900_0273050 Ga0395900_0273050_1149_1493 110
495 3300037418 Ga0395900_0401685 Ga0395900_0401685_600_944 110
496 3300037418 Ga0395900_0408822 Ga0395900_0408822_793_1137 110
497 3300037418 Ga0395900_0458836 Ga0395900_0458836_871_1215 110
498 3300037418 Ga0395900_1326620 Ga0395900_1326620_202_546 110
499 3300037466 Ga0395898_0016010 Ga0395898_0016010_4387_4731 110
500 3300037466 Ga0395898_0055058 Ga0395898_0055058_2004_2348 110
501 3300037466 Ga0395898_0199573 Ga0395898_0199573_1115_1459 110
502 3300037466 Ga0395898_0251225 Ga0395898_0251225_1231_1575 110
503 3300037466 Ga0395898_0300269 Ga0395898_0300269_361_705 110
504 3300037466 Ga0395898_0588861 Ga0395898_0588861_503_847 110
505 3300037466 Ga0395898_1733103 Ga0395898_1733103_152_496 110
506 3300037471 Ga0395905_0009247 Ga0395905_0009247_8941_9285 110
507 3300037471 Ga0395905_0010012 Ga0395905_0010012_4125_4469 110
508 3300037471 Ga0395905_0014735 Ga0395905_0014735_177_521 110
509 3300037471 Ga0395905_0040657 Ga0395905_0040657_520_864 110
510 3300037471 Ga0395905_0102517 Ga0395905_0102517_142_486 110
511 3300037471 Ga0395905_0113152 Ga0395905_0113152_1048_1392 110
512 3300037471 Ga0395905_0123225 Ga0395905_0123225_1749_2093 110
513 3300037471 Ga0395905_0219643 Ga0395905_0219643_714_1058 110
514 3300037471 Ga0395905_0254464 Ga0395905_0254464_23_367 110
515 3300037471 Ga0395905_0592483 Ga0395905_0592483_15_359 110
516 3300037471 Ga0395905_1035231 Ga0395905_1035231_222_566 110
517 3300037471 Ga0395905_1147405 Ga0395905_1147405_221_565 110
518 3300037853 Ga0436364_0219673 Ga0436364_0219673_188_532 110
519 3300037853 Ga0436364_0755345 Ga0436364_0755345_6459_6803 110
520 3300038443 Ga0395901_0006189 Ga0395901_0006189_8857_9201 110
521 3300038443 Ga0395901_0007713 Ga0395901_0007713_2809_3153 110
522 3300038443 Ga0395901_0035010 Ga0395901_0035010_1586_1930 110
523 3300038443 Ga0395901_0043349 Ga0395901_0043349_1324_1668 110
524 3300038443 Ga0395901_0044592 Ga0395901_0044592_3088_3432 110
525 3300038443 Ga0395901_0048833 Ga0395901_0048833_3891_4235 110
526 3300038443 Ga0395901_0167363 Ga0395901_0167363_927_1271 110
527 3300038443 Ga0395901_0284858 Ga0395901_0284858_102_446 110
528 3300038443 Ga0395901_0428250 Ga0395901_0428250_487_831 110
529 3300038443 Ga0395901_0582015 Ga0395901_0582015_438_782 110
530 3300038443 Ga0395901_1213635 Ga0395901_1213635_56_400 110
531 3300042005 Ga0439448_0004253 Ga0439448_0004253_3250_3594 110
532 3300042012 Ga0439455_0151325 Ga0439455_0151325_173_517 110
533 3300042157 Ga0439458_0000154 Ga0439458_0000154_11963_12307 110
534 3300044656 Ga0466969_0342983 Ga0466969_0342983_272_616 110
535 3300044683 Ga0466965_0698772 Ga0466965_0698772_147_491 110
536 3300044683 Ga0466965_0823072 Ga0466965_0823072_99_443 110
537 3300044684 Ga0466966_0102477 Ga0466966_0102477_55_399 110
538 3300044694 Ga0466963_0016999 Ga0466963_0016999_3295_3639 110
539 3300044694 Ga0466963_0874574 Ga0466963_0874574_247_591 110
540 3300044694 Ga0466963_1228140 Ga0466963_1228140_131_475 110
541 3300044765 Ga0466970_0038621 Ga0466970_0038621_706_1050 110
542 3300044842 Ga0466957_0062554 Ga0466957_0062554_54_398 110
543 3300044842 Ga0466957_0103080 Ga0466957_0103080_188_532 110
544 3300044842 Ga0466957_0339745 Ga0466957_0339745_447_791 110
545 3300044842 Ga0466957_0363780 Ga0466957_0363780_354_698 110
546 3300045049 Ga0466959_0206105 Ga0466959_0206105_762_1106 110
547 3300045976 Ga0466967_0007211 Ga0466967_0007211_205_549 110
548 3300045976 Ga0466967_0186458 Ga0466967_0186458_431_775 110
549 3300045976 Ga0466967_0371621 Ga0466967_0371621_100_444 110
550 3300045976 Ga0466967_0718956 Ga0466967_0718956_244_588 110
551 3300045976 Ga0466967_1650810 Ga0466967_1650810_276_620 110
552 3300046684 Ga0495669_0085688 Ga0495669_0085688_95_439 110
553 3300048904 Ga0496101_0318541 Ga0496101_0318541_857_1201 110
554 3300048909 Ga0496106_1246089 Ga0496106_1246089_103_447 110
555 3300048910 Ga0496107_0186800 Ga0496107_0186800_227_571 110
556 3300048910 Ga0496107_0721599 Ga0496107_0721599_342_686 110
557 3300048911 Ga0496108_0145985 Ga0496108_0145985_1249_1593 110
558 3300048912 Ga0496109_0191881 Ga0496109_0191881_1523_1867 110
559 3300048912 Ga0496109_1665466 Ga0496109_1665466_67_411 110
560 3300048912 Ga0496109_1856184 Ga0496109_1856184_133_480 110
561 3300048913 Ga0496110_0102725 Ga0496110_0102725_2105_2449 110
562 3300048913 Ga0496110_0644424 Ga0496110_0644424_332_676 110
563 3300048913 Ga0496110_1649394 Ga0496110_1649394_161_505 110
564 3300048914 Ga0496111_0158133 Ga0496111_0158133_1083_1427 110
565 3300048914 Ga0496111_0362500 Ga0496111_0362500_321_668 110
566 3300048914 Ga0496111_0487054 Ga0496111_0487054_317_661 110
567 3300048915 Ga0496112_0475772 Ga0496112_0475772_741_1085 110
568 3300050489 nmdc:mga03683_185133_c1 nmdc:mga03683_185133_c1_434_778 110
569 3300050493 nmdc:mga0k408_226820_c1 nmdc:mga0k408_226820_c1_148_492 110
570 3300059477 Ga0587084_045075 Ga0587084_045075_319_663 110
571 3300061719 Ga0466962_0059360 Ga0466962_0059360_808_1152 110

Feature Viewer

pLDDT pTM Quality
68.7 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map