F464951

General Info

Members Datasets Scaffolds Average Seq Length
571 463 1140 386

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10021499|Ga0213875_100214992
Length 466
Sequence MRALSIATAALVCLAVVAGCSALPRLRAVPSQDASRVTVLGLSDVRYSGDTDSPELVSEGIASYRKELAAFHAAGRTGPLPPASFLAISGGGENGAFGAGLLVGWTAAGTRPQFKLVTGISTGALIAPFAFLGSRYDPQLQQVYTTISAKDILEHRGYIAALTDDALASTSPLRRTMARYITPAMLDEIAAEYAKGRLLLIGTTDLDQGRPVIWNIGKLAASHRPGVLRLVQDILIASAAIPGAFPPVMIDVEADGRRYQEMHVDGGTSAQVFVYPPSLQLRSLGRAAGIVRERRLYVIRNARLDPNWAETRRSTLPIVGRAISSLIQTQGVGDLYRIYVAARRDGIDFNLASIPETFTMKLEQPFDPAYMNALFKLGYDVGAHGYAWAKFPPGYNELGAGPTLSPAAAAVPADRTVPAGSRLSPHAVSAALTGHGSCTAANGLHAPAAGWSGSAPPSFDPEGHLP

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
45 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
67 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
68 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
69 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
110 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
111 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
112 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
113 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
232 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
243 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
244 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
245 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
246 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
247 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
248 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
249 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
250 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
251 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
252 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
253 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
254 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
255 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
256 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
257 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
258 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
259 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
260 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
261 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
262 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
263 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
264 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
265 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
266 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
267 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
268 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
269 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
270 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
271 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
272 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
273 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
274 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
275 2791355199
276 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
277 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
278 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
279 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
280 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
281 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
282 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
283 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
284 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
285 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
286 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
287 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
288 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
289 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
290 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
291 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
292 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
293 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
294 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
295 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
296 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
297 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
298 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
299 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
300 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
301 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
302 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
303 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
304 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
305 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
306 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
307 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
308 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
309 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
310 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
311 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
312 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
313 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
314 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
315 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
316 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
317 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
318 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
319 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
320 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
321 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
322 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
323 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
324 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
325 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
326 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
327 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
328 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
329 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
330 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
331 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
332 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
333 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
334 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
335 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
336 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
337 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
338 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
339 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
340 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
341 2904699407
342 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
343 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
344 2906610324
345 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
346 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
347 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
348 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
349 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
350 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
351 2922368715
352 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
353 2922425934
354 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
355 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
356 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
357 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
358 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
359 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
360 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
361 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
362 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
363 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
364 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
365 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
366 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
367 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
368 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
369 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
370 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
371 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
372 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
373 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
374 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
375 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
376 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
377 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
378 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
379 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
380 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
381 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
382 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
383 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
384 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
385 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
386 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
387 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
388 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
389 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
390 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
391 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
392 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
393 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
394 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
395 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
396 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
397 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
398 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
399 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
400 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
401 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
402 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
403 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
404 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
405 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
406 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
407 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
408 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
409 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
410 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
411 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
412 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
413 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
414 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
415 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
416 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
417 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
418 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
419 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
420 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
421 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
422 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
423 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
424 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
425 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
426 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
427 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
428 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
429 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
430 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
431 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
432 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
433 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
434 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
435 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
436 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
437 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
438 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
439 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
440 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
441 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
442 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
443 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
444 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
445 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
446 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
447 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
448 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
449 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
450 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
451 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
452 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
453 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
454 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
455 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
456 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
457 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
458 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
459 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
460 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
461 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
462 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
463 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.01
Metatranscriptomes 0
Isolates 37.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.38
Nodule 31
Rhizoplane 4.03
Rhizosphere 38
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10021499 3300021388 Unclassified 3090
2 JGI25153J46596_10003417 3300003215 Bacteria 8884
3 JGI25153J46596_10004038 3300003215 Bacteria 8003
4 JGI25153J46596_10004356 3300003215 Bacteria 7640
5 JGI25153J46596_10009377 3300003215 Bacteria 4559
6 JGI25153J46596_10012627 3300003215 Bacteria 3625
7 JGI25160J50197_1002157 3300003354 Bacteria 9315
8 Ga0055531_10008136 3300003794 Bacteria 5586
9 Ga0055543_1003893 3300004625 Bacteria 4220
10 Ga0065165_1001311 3300005262 Bacteria 27762
11 Ga0065165_1002706 3300005262 Bacteria 14217
12 Ga0070658_10229054 3300005327 Bacteria 1573
13 Ga0068869_100031184 3300005334 Bacteria 3749
14 Ga0068869_100045075 3300005334 Bacteria 3173
15 Ga0068869_100225699 3300005334 Bacteria 1486
16 Ga0070680_100031970 3300005336 Bacteria 4233
17 Ga0070682_100187257 3300005337 Bacteria 1451
18 Ga0068868_100139102 3300005338 Bacteria 1992
19 Ga0070689_100149561 3300005340 Bacteria 1883
20 Ga0070689_100247220 3300005340 Bacteria 1471
21 Ga0070668_100231549 3300005347 Bacteria 1527
22 Ga0070714_100026957 3300005435 Bacteria 4754
23 Ga0070713_100041586 3300005436 Bacteria 3746
24 Ga0070662_100145997 3300005457 Bacteria 1838
25 Ga0070681_10286739 3300005458 Bacteria 1557
26 Ga0070698_100137433 3300005471 Unclassified 2397
27 Ga0070699_100141699 3300005518 Bacteria 2123
28 Ga0068853_100053065 3300005539 Bacteria 3491
29 Ga0068853_100067621 3300005539 Bacteria 3105
30 Ga0068855_100068120 3300005563 Bacteria 4144
31 Ga0068855_100098414 3300005563 Bacteria 3370
32 Ga0068855_100360967 3300005563 Bacteria 1598
33 Ga0070664_100021705 3300005564 Bacteria 5295
34 Ga0068857_100119823 3300005577 Bacteria 2369
35 Ga0068854_100084419 3300005578 Bacteria 2350
36 Ga0068856_100060562 3300005614 Bacteria 3740
37 Ga0068856_100453212 3300005614 Bacteria 1304
38 Ga0068852_100036838 3300005616 Bacteria 4098
39 Ga0068852_100076463 3300005616 Bacteria 2956
40 Ga0068859_100025660 3300005617 Bacteria 5911
41 Ga0068859_100072483 3300005617 Bacteria 3481
42 Ga0068863_100363204 3300005841 Bacteria 1412
43 Ga0068862_100063058 3300005844 Bacteria 3189
44 Ga0081455_10033443 3300005937 Bacteria 4620
45 Ga0081455_10134785 3300005937 Bacteria 1926
46 Ga0081538_10001791 3300005981 Bacteria 21683
47 Ga0081538_10023589 3300005981 Bacteria 4417
48 Ga0081540_1003891 3300005983 Bacteria 11632
49 Ga0081540_1004765 3300005983 Bacteria 10240
50 Ga0081539_10016809 3300005985 Bacteria 5191
51 Ga0075365_10060742 3300006038 Bacteria 2522
52 Ga0075363_100015018 3300006048 Bacteria 3797
53 Ga0075362_10004200 3300006177 Bacteria 5142
54 Ga0075367_10068528 3300006178 Bacteria 2128
55 Ga0075369_10004328 3300006186 Bacteria 5237
56 Ga0075369_10046000 3300006186 Bacteria 1878
57 Ga0075366_10060815 3300006195 Bacteria 2244
58 Ga0075428_100079916 3300006844 Bacteria 3568
59 Ga0075433_10230100 3300006852 Bacteria 1646
60 Ga0075434_100004876 3300006871 Bacteria 12150
61 Ga0075434_100020266 3300006871 Bacteria 6447
62 Ga0097620_100025662 3300006931 Bacteria 5911
63 Ga0097620_100072484 3300006931 Bacteria 3481
64 Ga0099824_1011571 3300006942 Bacteria 9932
65 Ga0099824_1014235 3300006942 Bacteria 7974
66 Ga0099822_1003710 3300006943 Bacteria 19679
67 Ga0075435_100043873 3300007076 Bacteria 3581
68 Ga0099794_10005096 3300007265 Bacteria 5238
69 Ga0099795_10003080 3300007788 Bacteria 4071
70 Ga0105250_10028477 3300009092 Bacteria 2250
71 Ga0105240_10016366 3300009093 Bacteria 10041
72 Ga0111539_10030908 3300009094 Bacteria 6508
73 Ga0111539_10114439 3300009094 Unclassified 3164
74 Ga0111539_10293745 3300009094 Bacteria 1891
75 Ga0105247_10078312 3300009101 Bacteria 2079
76 Ga0114129_10086587 3300009147 Bacteria 4345
77 Ga0105243_10120103 3300009148 Bacteria 2214
78 Ga0105241_10054417 3300009174 Bacteria 3063
79 Ga0105241_10170007 3300009174 Bacteria 1800
80 Ga0105237_10005222 3300009545 Bacteria 14690
81 Ga0105237_10030458 3300009545 Bacteria 5480
82 Ga0105237_10141310 3300009545 Bacteria 2402
83 Ga0105237_10171870 3300009545 Bacteria 2167
84 Ga0105237_10247711 3300009545 Bacteria 1784
85 Ga0105238_10003855 3300009551 Bacteria 14893
86 Ga0105238_10222888 3300009551 Bacteria 1862
87 Ga0105239_10032458 3300010375 Bacteria 5738
88 Ga0105239_10106921 3300010375 Bacteria 3099
89 Ga0157370_10045553 3300013104 Bacteria 4207
90 Ga0157369_10018727 3300013105 Bacteria 7764
91 Ga0157369_10075427 3300013105 Bacteria 3616
92 Ga0163162_10229028 3300013306 Bacteria 1989
93 Ga0163162_10274914 3300013306 Bacteria 1816
94 Ga0157372_10054415 3300013307 Bacteria 4464
95 Ga0157375_10102123 3300013308 Bacteria 2952
96 Ga0157375_10254197 3300013308 Bacteria 1918
97 Ga0163163_10236463 3300014325 Bacteria 1876
98 Ga0157379_10195756 3300014968 Bacteria 1827
99 Ga0214544_1000051 3300021320 Bacteria 134645
100 Ga0214542_1005406 3300021321 Bacteria 24265
101 Ga0214545_1000126 3300021324 Bacteria 91489
102 Ga0214543_1003794 3300021327 Bacteria 29103
103 Ga0213875_10070509 3300021388 Bacteria 1631
104 Ga0213871_10000125 3300021441 Bacteria 7571
105 Ga0209677_100341 3300025253 Bacteria 29761
106 Ga0209677_102736 3300025253 Bacteria 6319
107 Ga0209148_1000258 3300025254 Bacteria 83390
108 Ga0209233_1000942 3300025261 Bacteria 12624
109 Ga0209233_1002291 3300025261 Bacteria 7136
110 Ga0209233_1004797 3300025261 Bacteria 4555
111 Ga0209455_1003005 3300025272 Bacteria 6189
112 Ga0209564_1002317 3300025295 Bacteria 15442
113 Ga0209564_1022731 3300025295 Bacteria 2203
114 Ga0209758_1000021 3300025297 Bacteria 697691
115 Ga0209758_1001783 3300025297 Bacteria 23819
116 Ga0209758_1001804 3300025297 Bacteria 23643
117 Ga0209758_1003532 3300025297 Bacteria 14090
118 Ga0209758_1012123 3300025297 Bacteria 4871
119 Ga0209758_1020609 3300025297 Bacteria 3110
120 Ga0209256_1009096 3300025299 Bacteria 4428
121 Ga0207426_1000229 3300025302 Bacteria 128596
122 Ga0207426_1000684 3300025302 Bacteria 40862
123 Ga0207426_1008429 3300025302 Bacteria 4164
124 Ga0207426_1023657 3300025302 Bacteria 2095
125 Ga0209257_1001917 3300025304 Bacteria 22464
126 Ga0209257_1013194 3300025304 Bacteria 3710
127 Ga0209257_1016739 3300025304 Bacteria 2943
128 Ga0207647_10040849 3300025904 Bacteria 2919
129 Ga0207645_10035962 3300025907 Bacteria 3179
130 Ga0207654_10030121 3300025911 Bacteria 2976
131 Ga0207707_10194005 3300025912 Bacteria 1772
132 Ga0207695_10000015 3300025913 Bacteria 803205
133 Ga0207671_10004241 3300025914 Bacteria 13810
134 Ga0207660_10062542 3300025917 Bacteria 2682
135 Ga0207657_10177033 3300025919 Bacteria 1726
136 Ga0207657_10249490 3300025919 Bacteria 1415
137 Ga0207694_10024770 3300025924 Bacteria 4558
138 Ga0207694_10053992 3300025924 Bacteria 3117
139 Ga0207694_10113371 3300025924 Bacteria 2158
140 Ga0207700_10019042 3300025928 Bacteria 4629
141 Ga0207706_10140434 3300025933 Bacteria 2125
142 Ga0207709_10017548 3300025935 Bacteria 3995
143 Ga0207709_10129258 3300025935 Bacteria 1719
144 Ga0207669_10108560 3300025937 Bacteria 1854
145 Ga0207691_10176320 3300025940 Bacteria 1869
146 Ga0207689_10025760 3300025942 Bacteria 4928
147 Ga0207661_10052130 3300025944 Bacteria 3267
148 Ga0207679_10027820 3300025945 Bacteria 3915
149 Ga0207667_10182686 3300025949 Bacteria 2153
150 Ga0207651_10086981 3300025960 Bacteria 2274
151 Ga0207668_10005217 3300025972 Bacteria 7645
152 Ga0207658_10087699 3300025986 Bacteria 2404
153 Ga0207677_10127119 3300026023 Bacteria 1928
154 Ga0207639_10118374 3300026041 Bacteria 2172
155 Ga0207639_10242974 3300026041 Bacteria 1566
156 Ga0207678_10022033 3300026067 Bacteria 5582
157 Ga0207678_10042888 3300026067 Bacteria 3916
158 Ga0207678_10056351 3300026067 Bacteria 3383
159 Ga0207702_10014025 3300026078 Bacteria 6656
160 Ga0207674_10030317 3300026116 Bacteria 5688
161 Ga0207674_10057364 3300026116 Bacteria 3947
162 Ga0207675_100064363 3300026118 Bacteria 3427
163 Ga0207683_10042974 3300026121 Bacteria 3947
164 Ga0207683_10047356 3300026121 Bacteria 3765
165 Ga0207698_10020129 3300026142 Bacteria 4587
166 Ga0209389_1000041 3300027296 Bacteria 123983
167 Ga0209389_1000174 3300027296 Bacteria 51376
168 Ga0209589_1000003 3300027357 Bacteria 629130
169 Ga0209589_1000621 3300027357 Bacteria 51376
170 Ga0209489_100003 3300027361 Bacteria 663105
171 Ga0209489_100178 3300027361 Bacteria 99953
172 Ga0209489_101570 3300027361 Bacteria 47095
173 Ga0209700_100003 3300027363 Bacteria 663105
174 Ga0209179_1000569 3300027512 Bacteria 3868
175 Ga0209588_1015769 3300027671 Bacteria 2326
176 Ga0268266_10104738 3300028379 Bacteria 2498
177 Ga0265328_10000072 3300031239 Bacteria 53873
178 Ga0265328_10024103 3300031239 Bacteria 2301
179 Ga0265331_10000297 3300031250 Bacteria 54201
180 Ga0265331_10069366 3300031250 Bacteria 1651
181 Ga0265327_10019119 3300031251 Unclassified 4224
182 Ga0265327_10020401 3300031251 Bacteria 4039
183 Ga0265316_10013642 3300031344 Bacteria 7208
184 Ga0307513_10033230 3300031456 Bacteria 5800
185 Ga0307513_10039713 3300031456 Bacteria 5214
186 Ga0316576_10169761 3300031727 Bacteria 1646
187 Ga0316578_10005672 3300031728 Bacteria 6077
188 Ga0316578_10056282 3300031728 Unclassified 2309
189 Ga0307405_10164336 3300031731 Bacteria 1576
190 Ga0307409_100167882 3300031995 Bacteria 1928
191 Ga0307510_10009854 3300033180 Bacteria 11367
192 Ga0307510_10031390 3300033180 Bacteria 6003
193 Ga0307510_10148618 3300033180 Bacteria 1968
194 Ga0315911_1000001 3300033442 Bacteria 1088602
195 Ga0316582_0022095 3300036647 Bacteria 3771
196 Ga0316582_0052835 3300036647 Bacteria 2583
197 Ga0316584_0027431 3300036712 Bacteria 4191
198 Ga0395899_0021929 3300037312 Bacteria 4844
199 Ga0395900_0015298 3300037418 Bacteria 7822
200 Ga0395898_0030123 3300037466 Bacteria 5432
201 Ga0395905_0008458 3300037471 Bacteria 10149
202 Ga0316581_0021340 3300037588 Unclassified 1902
203 Ga0436364_0090448 3300037853 Bacteria 4154
204 Ga0436364_0107227 3300037853 Bacteria 3334
205 Ga0436364_1224575 3300037853 Bacteria 3191
206 Ga0395901_0009336 3300038443 Bacteria 9945
207 Ga0395901_0025373 3300038443 Bacteria 6084
208 Ga0395901_0419635 3300038443 Bacteria 1372
209 Ga0400483_235465 3300039062 Bacteria 1842
210 Ga0436365_0585577 3300039437 Bacteria 67545
211 Ga0436365_0676905 3300039437 Bacteria 2233
212 Ga0436365_0832468 3300039437 Bacteria 3509
213 Ga0436365_1594749 3300039437 Bacteria 1825
214 Ga0436360_0238664 3300039438 Bacteria 1515
215 Ga0436361_0291306 3300039447 Bacteria 3073
216 Ga0436363_1355399 3300039450 Bacteria 2365
217 Ga0436362_1034261 3300039453 Bacteria 1829
218 Ga0451833_1180783 3300041491 Bacteria 1757
219 Ga0439459_0004285 3300042438 Bacteria 2291
220 Ga0466969_0024910 3300044656 Bacteria 3077
221 Ga0466966_0001011 3300044684 Bacteria 17949
222 Ga0466961_0000007 3300044693 Bacteria 146374
223 Ga0466957_0014749 3300044842 Bacteria 4552
224 Ga0466960_0105451 3300044901 Bacteria 1457
225 Ga0466959_0003081 3300045049 Bacteria 10797
226 Ga0495592_0057102 3300046454 Bacteria 2882
227 Ga0495603_0039850 3300046455 Bacteria 2813
228 Ga0495590_0075042 3300046457 Bacteria 1189
229 Ga0495629_0005334 3300046459 Bacteria 9603
230 Ga0495651_0064361 3300046462 Bacteria 2802
231 Ga0495605_0047225 3300046474 Bacteria 2112
232 Ga0495664_0046153 3300046477 Bacteria 2585
233 Ga0495585_0050095 3300046492 Bacteria 2317
234 Ga0495596_0042630 3300046500 Bacteria 1788
235 Ga0495606_0033912 3300046507 Bacteria 3512
236 Ga0495608_0087486 3300046511 Bacteria 2018
237 Ga0495616_0077721 3300046513 Bacteria 1593
238 Ga0495628_0025276 3300046516 Bacteria 4852
239 Ga0495631_0022334 3300046518 Bacteria 2942
240 Ga0495632_0079570 3300046519 Bacteria 1564
241 Ga0495643_0011624 3300046522 Bacteria 5351
242 Ga0495648_0086506 3300046524 Bacteria 1768
243 Ga0495652_0030007 3300046529 Bacteria 4771
244 Ga0495652_0061784 3300046529 Bacteria 3161
245 Ga0495609_0029557 3300046538 Bacteria 2495
246 Ga0495667_0069439 3300046559 Bacteria 2299
247 Ga0495668_0014916 3300046616 Bacteria 4546
248 Ga0495635_0001092 3300046663 Bacteria 18016
249 Ga0495635_0067084 3300046663 Bacteria 2461
250 Ga0495657_0006324 3300046675 Bacteria 9281
251 Ga0495623_0013694 3300046679 Bacteria 5258
252 Ga0495669_0000020 3300046684 Bacteria 122868
253 Ga0495613_0001020 3300046689 Bacteria 21309
254 Ga0495613_0028230 3300046689 Bacteria 4174
255 Ga0495624_0045786 3300046690 Bacteria 2783
256 Ga0495600_0041360 3300046809 Bacteria 3003
257 Ga0495660_0115348 3300046810 Bacteria 1366
258 Ga0495604_0003484 3300047317 Bacteria 12541
259 Ga0495674_0094597 3300047319 Bacteria 2549
260 Ga0495680_0004797 3300047322 Bacteria 12835
261 Ga0495675_0036579 3300047444 Bacteria 3130
262 Ga0495684_0232814 3300047471 Bacteria 1347
263 Ga0495593_0039046 3300047673 Bacteria 2562
264 Ga0496100_0034454 3300048903 Bacteria 3178
265 Ga0496100_0219912 3300048903 Bacteria 1393
266 Ga0496102_0109847 3300048905 Bacteria 2570
267 Ga0496102_0151571 3300048905 Bacteria 2179
268 Ga0496103_0002568 3300048906 Bacteria 11381
269 Ga0496104_0044758 3300048907 Bacteria 4159
270 Ga0496104_0115147 3300048907 Bacteria 2579
271 Ga0496105_0079576 3300048908 Bacteria 2706
272 Ga0496105_0098942 3300048908 Bacteria 2408
273 Ga0496105_0343429 3300048908 Bacteria 1193
274 Ga0496107_0062494 3300048910 Bacteria 2698
275 Ga0496108_0094278 3300048911 Bacteria 2548
276 Ga0496108_0337181 3300048911 Bacteria 1315
277 Ga0496109_0330026 3300048912 Bacteria 1440
278 Ga0496110_0190356 3300048913 Bacteria 1863
279 Ga0496110_0220395 3300048913 Bacteria 1725
280 Ga0496111_0056505 3300048914 Bacteria 2840
281 Ga0496112_0048493 3300048915 Bacteria 4164
282 Ga0496112_0067794 3300048915 Bacteria 3522
283 Ga0496114_0079010 3300048917 Bacteria 2776
284 Ga0496114_0258804 3300048917 Bacteria 1532
285 Ga0496115_0113779 3300048918 Bacteria 2224
286 Ga0496117_0096886 3300048920 Bacteria 1881
287 Ga0496118_0030045 3300048921 Bacteria 4545
288 Ga0496119_0022959 3300048922 Bacteria 4443
289 Ga0496119_0040249 3300048922 Bacteria 2992
290 Ga0496120_0018799 3300048923 Bacteria 4440
291 Ga0496121_0012067 3300048924 Bacteria 9493
292 Ga0496121_0024633 3300048924 Bacteria 5746
293 Ga0496121_0033175 3300048924 Bacteria 4678
294 Ga0496121_0120219 3300048924 Bacteria 1985
295 Ga0496121_0136303 3300048924 Bacteria 1828
296 Ga0496125_0023119 3300048928 Bacteria 5749
297 Ga0496125_0076380 3300048928 Bacteria 2587
298 Ga0496125_0149921 3300048928 Bacteria 1604
299 Ga0496126_0035626 3300048929 Bacteria 4662
300 Ga0496126_0046598 3300048929 Bacteria 3974
301 Ga0501032_0000471 3300049569 Bacteria 32492
302 Ga0501034_0003048 3300049571 Bacteria 19368
303 Ga0501034_0125585 3300049571 Bacteria 2551
304 Ga0501034_0126525 3300049571 Bacteria 2540
305 Ga0501043_0246638 3300049579 Bacteria 1376
306 Ga0501067_0000015 3300049583 Bacteria 108743
307 Ga0501068_0032996 3300049584 Bacteria 3081
308 Ga0501070_0151989 3300049586 Bacteria 1910
309 Ga0501070_0188516 3300049586 Bacteria 1696
310 Ga0501072_0128882 3300049588 Bacteria 2016
311 Ga0501073_0000017 3300049589 Bacteria 155747
312 Ga0501077_0000009 3300049593 Bacteria 98991
313 Ga0501080_0001399 3300049742 Bacteria 20201
314 Ga0501035_0000418 3300049822 Bacteria 47993
315 Ga0501035_0117803 3300049822 Bacteria 2324
316 Ga0501044_0003364 3300049823 Bacteria 18031
317 Ga0501044_0013632 3300049823 Bacteria 8785
318 Ga0501045_0019016 3300049824 Bacteria 4893
319 nmdc:mga0yw44_7166_c1 3300050492 Bacteria 5461
320 nmdc:mga0k408_50338_c1 3300050493 Bacteria 1695
321 nmdc:mga06z11_17070_c1 3300050494 Bacteria 3285
322 nmdc:mga05p37_2749_c1 3300050507 Bacteria 20445
323 nmdc:mga08y16_357561_c1 3300050511 Bacteria 1499
324 nmdc:mga0n895_104031_c1 3300050512 Bacteria 2851
325 nmdc:mga0n895_1953_c1 3300050512 Bacteria 15813
326 nmdc:mga0n895_221829_c1 3300050512 Bacteria 1919
327 nmdc:mga0rr50_2282_c1 3300050513 Bacteria 10753
328 nmdc:mga0sz30_10839_c1 3300050516 Bacteria 3503
329 nmdc:mga0sz30_3178_c1 3300050516 Bacteria 5889
330 Ga0495619_0133892 3300053085 Bacteria 1704
331 Ga0500643_000056 3300053087 Bacteria 134839
332 Ga0500583_0078249 3300053092 Bacteria 1593
333 Ga0500566_0002386 3300053094 Bacteria 11113
334 Ga0500641_0001339 3300053096 Bacteria 8758
335 Ga0500641_0096440 3300053096 Bacteria 1265
336 Ga0500557_000042 3300053105 Bacteria 64422
337 Ga0500569_038462 3300053109 Bacteria 1388
338 Ga0500595_005447 3300053119 Bacteria 5552
339 Ga0500595_009722 3300053119 Bacteria 3868
340 Ga0500607_014254 3300053121 Bacteria 4614
341 Ga0500642_0000750 3300053130 Bacteria 9528
342 Ga0500652_068771 3300053131 Bacteria 1465
343 Ga0500616_0026469 3300053153 Bacteria 3210
344 Ga0500620_000969 3300053155 Bacteria 5007
345 Ga0500636_0001049 3300053177 Bacteria 14828
346 Ga0500625_007167 3300053729 Bacteria 4818
347 Ga0500645_012783 3300053730 Bacteria 2709
348 Ga0500645_017676 3300053730 Bacteria 2233
349 Ga0500601_000365 3300053737 Bacteria 8202
350 Ga0500661_003540 3300055283 Bacteria 2930
351 2507509143 2507262055 Bacteria 8048963
352 2508543208 2508501009 Bacteria 7784016
353 2508691047 2508501042 Bacteria 8719808
354 2509148023 2508501128 Bacteria 8613869
355 2511394133 2511231028 Bacteria 8046582
356 2513626887 2513237092 Bacteria 8341956
357 2513643717 2513237094 Bacteria 8789602
358 2513646897 2513237095 Bacteria 8976980
359 2513654485 2513237096 Bacteria 8722461
360 2513692037 2513237101 Bacteria 7952346
361 2513704138 2513237102 Bacteria 7703324
362 2513722549 2513237104 Bacteria 10034502
363 2513859287 2513237137 Bacteria 9558895
364 2513872302 2513237139 Bacteria 8737671
365 2513892292 2513237141 Bacteria 8496279
366 2513915336 2513237145 Bacteria 8979722
367 2514014030 2513237161 Bacteria 8871253
368 2515626549 2515154112 Bacteria 8294334
369 2517101767 2517093001 Bacteria 9002274
370 2517892637 2517572143 Bacteria 9484767
371 2524436810 2524023205 Bacteria 8918781
372 2524539008 2524023228 Bacteria 10118060
373 2528855302 2528768022 Bacteria 10457665
374 2617351346 2617270735 Bacteria 9163226
375 2617376241 2617270741 Bacteria 8201522
376 2671117363 2667528175 Bacteria 7532676
377 2723845565 2721755755 Bacteria 8322773
378 2728750547 2728368998 Bacteria 8720350
379 2745080254 2744054633 Bacteria 8678936
380 2793063833 2791355196 Bacteria 7323613
381 2793068527 2791355197 Bacteria 8420563
382 2793080781
383 2805918094 2802429603 Bacteria 8777136
384 2818242735 2816332527 Bacteria 8933356
385 2824605049 2824600985 Bacteria 8488197
386 2824613925 2824609381 Bacteria 8672835
387 2824623471 2824617872 Bacteria 8814715
388 2824631376 2824626560 Bacteria 8813858
389 2824639662 2824635225 Bacteria 8785348
390 2824646648 2824644064 Bacteria 8743947
391 2824657084 2824653114 Bacteria 8493680
392 2824665078 2824661429 Bacteria 9877870
393 2824679041 2824671348 Bacteria 8369588
394 2824681257 2824679649 Bacteria 8248951
395 2824695643 2824687955 Bacteria 8360029
396 2824701642 2824696289 Bacteria 8335049
397 2824709568 2824704595 Bacteria 9667483
398 2824719666 2824714736 Bacteria 8717648
399 2824726455 2824723954 Bacteria 8758240
400 2824735441 2824732956 Bacteria 7810675
401 2824750045 2824746037 Bacteria 7911610
402 2824760067 2824753945 Bacteria 9787441
403 2824770498 2824763712 Bacteria 9792355
404 2824779234 2824773399 Bacteria 8360218
405 2838126296 2838122688 Bacteria 8803140
406 2841943628 2841941048 Bacteria 8688029
407 2841950425 2841949485 Bacteria 8680857
408 2841958214 2841957949 Bacteria 8652217
409 2841966738 2841966195 Bacteria 8673214
410 2841975494 2841974524 Bacteria 8931498
411 2841988366 2841983080 Bacteria 8395090
412 2842039545 2842038055 Bacteria 8002051
413 2842047509 2842045827 Bacteria 8006841
414 2844318585 2844315083 Bacteria 8138177
415 2847935531 2847930680 Bacteria 9342022
416 2847946084 2847939898 Bacteria 8606328
417 2849079798 2849076700 Bacteria 7039503
418 2857513809 2857509624 Bacteria 7472071
419 2874597257 2874590934 Bacteria 8299676
420 2874609816 2874604998 Bacteria 7834745
421 2874616292 2874612657 Bacteria 8252029
422 2874626851 2874620515 Bacteria 8290088
423 2874631266 2874628541 Bacteria 8630250
424 2874649410 2874645413 Bacteria 8214782
425 2876770486 2876761206 Bacteria 10111113
426 2876777946 2876771140 Bacteria 8287509
427 2876812350 2876808645 Bacteria 8824342
428 2876823033 2876818435 Bacteria 8274608
429 2879078703 2879074833 Bacteria 8279565
430 2879090741 2879083081 Bacteria 8587928
431 2879108216 2879099564 Bacteria 10442239
432 2879118304 2879110137 Bacteria 8907982
433 2879132819 2879127579 Bacteria 8294491
434 2879148619 2879142872 Bacteria 8267021
435 2881366898 2881364244 Bacteria 7710352
436 2881666307 2881665667 Bacteria 8175609
437 2885372017 2885366525 Bacteria 8326213
438 2885382113 2885374607 Bacteria 8927485
439 2885411041 2885409591 Bacteria 9235467
440 2888383565 2888378607 Bacteria 9652610
441 2888394394 2888388044 Bacteria 7304136
442 2888423987 2888419890 Bacteria 7857137
443 2889040358 2889033259 Bacteria 9099371
444 2903730048 2903727486 Bacteria 8281579
445 2903759041 2903748898 Bacteria 9972761
446 2904668429 2904666416 Bacteria 8226587
447 2904695999 2904690495 Bacteria 9412302
448 2904702752
449 2904717397 2904711408 Bacteria 9771557
450 2906603434 2906602504 Bacteria 8295279
451 2906618360
452 2906632175 2906626472 Bacteria 8826946
453 2906644754 2906643746 Bacteria 8722424
454 2906664068 2906660503 Bacteria 8595048
455 2908742970 2908739725 Bacteria 8628932
456 2908779635 2908775508 Bacteria 8092255
457 2922368244 2922361189 Bacteria 7436256
458 2922373783
459 2922395862 2922393267 Bacteria 8285685
460 2922429738
461 2929617493 2929615660 Bacteria 9193770
462 2929627198 2929624759 Bacteria 9339455
463 2932787463 2932784394 Bacteria 9704911
464 2932798412 2932794094 Bacteria 7915132
465 2932803285 2932801729 Bacteria 7987968
466 2932815081 2932809354 Bacteria 9135765
467 2932820722 2932818245 Bacteria 9955613
468 2932831770 2932828146 Bacteria 9745859
469 2933579449 2933577622 Bacteria 9116884
470 2935611974 2935608549 Bacteria 8203142
471 2935621868 2935616580 Bacteria 9032984
472 2935633372 2935630451 Bacteria 8169952
473 2935642813 2935638405 Bacteria 10015038
474 2935649597 2935648319 Bacteria 8801166
475 2935658888 2935656913 Bacteria 8965014
476 2935667915 2935665750 Bacteria 9571747
477 2935679035 2935675223 Bacteria 9928132
478 2935688665 2935684952 Bacteria 9590419
479 2935696018 2935694250 Bacteria 9291695
480 2935706756 2935703347 Bacteria 10242284
481 2935715684 2935713505 Bacteria 9608509
482 2935725752 2935722832 Bacteria 9608746
483 2935737969 2935732158 Bacteria 9706831
484 2935747344 2935741537 Bacteria 9707219
485 2935754081 2935750917 Bacteria 9590372
486 2935763118 2935760218 Bacteria 9817913
487 2935772552 2935769743 Bacteria 7878163
488 2935783104 2935777560 Bacteria 8077691
489 2935793368 2935785616 Bacteria 7962367
490 2935799455 2935793552 Bacteria 8012592
491 2935808435 2935801545 Bacteria 9301974
492 2935812870 2935810662 Bacteria 9401221
493 2935821454 2935819856 Bacteria 8261050
494 2935830522 2935827899 Bacteria 10038562
495 2935840551 2935837841 Bacteria 9454360
496 2935850287 2935847175 Bacteria 8228321
497 2935860115 2935855204 Bacteria 9035059
498 2935869234 2935864058 Bacteria 9784707
499 2935880589 2935873716 Bacteria 9632195
500 2935888063 2935883170 Bacteria 7964738
501 2935914333 2935908558 Bacteria 8568796
502 2935921047 2935916978 Bacteria 9113783
503 2935931989 2935926038 Bacteria 8601059
504 2935940586 2935934488 Bacteria 8602579
505 2935948529 2935942939 Bacteria 8599779
506 2935957000 2935951376 Bacteria 8602333
507 2935960222 2935959822 Bacteria 7869783
508 2935973598 2935967501 Bacteria 8603075
509 2935977452 2935975950 Bacteria 8347125
510 2935989949 2935984226 Bacteria 8302647
511 2935996243 2935992306 Bacteria 9802711
512 2936006377 2936002035 Bacteria 9362176
513 2936012921 2936011229 Bacteria 8801034
514 2936021485 2936019824 Bacteria 8804134
515 2936030214 2936028420 Bacteria 8965941
516 2936041458 2936037263 Bacteria 9446081
517 2936047679 2936046547 Bacteria 8903709
518 2936057163 2936055302 Bacteria 8785755
519 2940560543 2940556831 Bacteria 9590747
520 2941510263 2941507105 Bacteria 8166816
521 2941518000 2941515067 Bacteria 8166720
522 2941526016 2941523033 Bacteria 8169134
523 2941534339 2941531003 Bacteria 7653939
524 2941541318 2941538514 Bacteria 9402094
525 3005479956 3005474847 Bacteria 9259049
526 3005489668 3005483717 Bacteria 7877331
527 3005509887 3005506211 Bacteria 6943378
528 3005590001 3005587118 Bacteria 7794411
529 3005598706 3005594810 Bacteria 8716512
530 3005714359 3005710791 Bacteria 7622528
531 3005721866 3005718088 Bacteria 8283608
532 8006941146 8006933436 Bacteria 10410654
533 8006971723 8006964411 Bacteria 8966052
534 8006980648 8006973647 Bacteria 10679141
535 8006985754 8006984368 Bacteria 9651211
536 8006997434 8006994254 Bacteria 8309700
537 8016513903 8016511872 Bacteria 9921665
538 8016530151 8016522445 Bacteria 8156687
539 8016535398 8016530956 Bacteria 8155261
540 8016548601 8016539877 Bacteria 8155419
541 8016553528 8016548790 Bacteria 8155074
542 8016561911 8016557553 Bacteria 8154380
543 8016573732 8016566248 Bacteria 8158151
544 8016577857 8016575299 Bacteria 8154085
545 8016599738 8016595262 Bacteria 8149947
546 8016611103 8016603502 Bacteria 8731218
547 8016622531 8016613128 Bacteria 8794220
548 8016627257 8016622563 Bacteria 7999408
549 8016631545 8016630954 Bacteria 9217207
550 8017062572 8017057580 Bacteria 10023680
551 8019535140 8019530166 Bacteria 8155624
552 8019554357 8019547302 Bacteria 7996444
553 8019557058 8019555841 Bacteria 9642137
554 8019568242 8019565922 Bacteria 9639779
555 8019581967 8019576017 Bacteria 10049540
556 8019589649 8019586578 Bacteria 10212056
557 8019601621 8019597564 Bacteria 10041141
558 8019616931 8019608314 Bacteria 10042931
559 8019627569 8019619141 Bacteria 9218857
560 8019635006 8019629233 Bacteria 8687553
561 8019644721 8019638758 Bacteria 9062356
562 8019657764 8019648815 Bacteria 10014479
563 8019662839 8019659431 Bacteria 8577854
564 8019672448 8019668869 Bacteria 8791617
565 8019683709 8019678201 Bacteria 8863603
566 8019689461 8019687851 Bacteria 8712826
567 8055746892 8055742211 Bacteria 9226248
568 8056674304 8056673599 Bacteria 7871253
569 8056689989 8056689827 Bacteria 6712655
570 8056972954 8056967851 Bacteria 9038162
571 Ga0213875_10021499
572 JGI25153J46596_10003417
573 JGI25153J46596_10004038
574 JGI25153J46596_10004356
575 JGI25153J46596_10009377
576 JGI25153J46596_10012627
577 JGI25160J50197_1002157
578 Ga0055531_10008136
579 Ga0055543_1003893
580 Ga0065165_1001311
581 Ga0065165_1002706
582 Ga0070658_10229054
583 Ga0068869_100031184
584 Ga0068869_100045075
585 Ga0068869_100225699
586 Ga0070680_100031970
587 Ga0070682_100187257
588 Ga0068868_100139102
589 Ga0070689_100149561
590 Ga0070689_100247220
591 Ga0070668_100231549
592 Ga0070714_100026957
593 Ga0070713_100041586
594 Ga0070662_100145997
595 Ga0070681_10286739
596 Ga0070698_100137433
597 Ga0070699_100141699
598 Ga0068853_100053065
599 Ga0068853_100067621
600 Ga0068855_100068120
601 Ga0068855_100098414
602 Ga0068855_100360967
603 Ga0070664_100021705
604 Ga0068857_100119823
605 Ga0068854_100084419
606 Ga0068856_100060562
607 Ga0068856_100453212
608 Ga0068852_100036838
609 Ga0068852_100076463
610 Ga0068859_100025660
611 Ga0068859_100072483
612 Ga0068863_100363204
613 Ga0068862_100063058
614 Ga0081455_10033443
615 Ga0081455_10134785
616 Ga0081538_10001791
617 Ga0081538_10023589
618 Ga0081540_1003891
619 Ga0081540_1004765
620 Ga0081539_10016809
621 Ga0075365_10060742
622 Ga0075363_100015018
623 Ga0075362_10004200
624 Ga0075367_10068528
625 Ga0075369_10004328
626 Ga0075369_10046000
627 Ga0075366_10060815
628 Ga0075428_100079916
629 Ga0075433_10230100
630 Ga0075434_100004876
631 Ga0075434_100020266
632 Ga0097620_100025662
633 Ga0097620_100072484
634 Ga0099824_1011571
635 Ga0099824_1014235
636 Ga0099822_1003710
637 Ga0075435_100043873
638 Ga0099794_10005096
639 Ga0099795_10003080
640 Ga0105250_10028477
641 Ga0105240_10016366
642 Ga0111539_10030908
643 Ga0111539_10114439
644 Ga0111539_10293745
645 Ga0105247_10078312
646 Ga0114129_10086587
647 Ga0105243_10120103
648 Ga0105241_10054417
649 Ga0105241_10170007
650 Ga0105237_10005222
651 Ga0105237_10030458
652 Ga0105237_10141310
653 Ga0105237_10171870
654 Ga0105237_10247711
655 Ga0105238_10003855
656 Ga0105238_10222888
657 Ga0105239_10032458
658 Ga0105239_10106921
659 Ga0157370_10045553
660 Ga0157369_10018727
661 Ga0157369_10075427
662 Ga0163162_10229028
663 Ga0163162_10274914
664 Ga0157372_10054415
665 Ga0157375_10102123
666 Ga0157375_10254197
667 Ga0163163_10236463
668 Ga0157379_10195756
669 Ga0214544_1000051
670 Ga0214542_1005406
671 Ga0214545_1000126
672 Ga0214543_1003794
673 Ga0213875_10070509
674 Ga0213871_10000125
675 Ga0209677_100341
676 Ga0209677_102736
677 Ga0209148_1000258
678 Ga0209233_1000942
679 Ga0209233_1002291
680 Ga0209233_1004797
681 Ga0209455_1003005
682 Ga0209564_1002317
683 Ga0209564_1022731
684 Ga0209758_1000021
685 Ga0209758_1001783
686 Ga0209758_1001804
687 Ga0209758_1003532
688 Ga0209758_1012123
689 Ga0209758_1020609
690 Ga0209256_1009096
691 Ga0207426_1000229
692 Ga0207426_1000684
693 Ga0207426_1008429
694 Ga0207426_1023657
695 Ga0209257_1001917
696 Ga0209257_1013194
697 Ga0209257_1016739
698 Ga0207647_10040849
699 Ga0207645_10035962
700 Ga0207654_10030121
701 Ga0207707_10194005
702 Ga0207695_10000015
703 Ga0207671_10004241
704 Ga0207660_10062542
705 Ga0207657_10177033
706 Ga0207657_10249490
707 Ga0207694_10024770
708 Ga0207694_10053992
709 Ga0207694_10113371
710 Ga0207700_10019042
711 Ga0207706_10140434
712 Ga0207709_10017548
713 Ga0207709_10129258
714 Ga0207669_10108560
715 Ga0207691_10176320
716 Ga0207689_10025760
717 Ga0207661_10052130
718 Ga0207679_10027820
719 Ga0207667_10182686
720 Ga0207651_10086981
721 Ga0207668_10005217
722 Ga0207658_10087699
723 Ga0207677_10127119
724 Ga0207639_10118374
725 Ga0207639_10242974
726 Ga0207678_10022033
727 Ga0207678_10042888
728 Ga0207678_10056351
729 Ga0207702_10014025
730 Ga0207674_10030317
731 Ga0207674_10057364
732 Ga0207675_100064363
733 Ga0207683_10042974
734 Ga0207683_10047356
735 Ga0207698_10020129
736 Ga0209389_1000041
737 Ga0209389_1000174
738 Ga0209589_1000003
739 Ga0209589_1000621
740 Ga0209489_100003
741 Ga0209489_100178
742 Ga0209489_101570
743 Ga0209700_100003
744 Ga0209179_1000569
745 Ga0209588_1015769
746 Ga0268266_10104738
747 Ga0265328_10000072
748 Ga0265328_10024103
749 Ga0265331_10000297
750 Ga0265331_10069366
751 Ga0265327_10019119
752 Ga0265327_10020401
753 Ga0265316_10013642
754 Ga0307513_10033230
755 Ga0307513_10039713
756 Ga0316576_10169761
757 Ga0316578_10005672
758 Ga0316578_10056282
759 Ga0307405_10164336
760 Ga0307409_100167882
761 Ga0307510_10009854
762 Ga0307510_10031390
763 Ga0307510_10148618
764 Ga0315911_1000001
765 Ga0316582_0022095
766 Ga0316582_0052835
767 Ga0316584_0027431
768 Ga0395899_0021929
769 Ga0395900_0015298
770 Ga0395898_0030123
771 Ga0395905_0008458
772 Ga0316581_0021340
773 Ga0436364_0090448
774 Ga0436364_0107227
775 Ga0436364_1224575
776 Ga0395901_0009336
777 Ga0395901_0025373
778 Ga0395901_0419635
779 Ga0400483_235465
780 Ga0436365_0585577
781 Ga0436365_0676905
782 Ga0436365_0832468
783 Ga0436365_1594749
784 Ga0436360_0238664
785 Ga0436361_0291306
786 Ga0436363_1355399
787 Ga0436362_1034261
788 Ga0451833_1180783
789 Ga0439459_0004285
790 Ga0466969_0024910
791 Ga0466966_0001011
792 Ga0466961_0000007
793 Ga0466957_0014749
794 Ga0466960_0105451
795 Ga0466959_0003081
796 Ga0495592_0057102
797 Ga0495603_0039850
798 Ga0495590_0075042
799 Ga0495629_0005334
800 Ga0495651_0064361
801 Ga0495605_0047225
802 Ga0495664_0046153
803 Ga0495585_0050095
804 Ga0495596_0042630
805 Ga0495606_0033912
806 Ga0495608_0087486
807 Ga0495616_0077721
808 Ga0495628_0025276
809 Ga0495631_0022334
810 Ga0495632_0079570
811 Ga0495643_0011624
812 Ga0495648_0086506
813 Ga0495652_0030007
814 Ga0495652_0061784
815 Ga0495609_0029557
816 Ga0495667_0069439
817 Ga0495668_0014916
818 Ga0495635_0001092
819 Ga0495635_0067084
820 Ga0495657_0006324
821 Ga0495623_0013694
822 Ga0495669_0000020
823 Ga0495613_0001020
824 Ga0495613_0028230
825 Ga0495624_0045786
826 Ga0495600_0041360
827 Ga0495660_0115348
828 Ga0495604_0003484
829 Ga0495674_0094597
830 Ga0495680_0004797
831 Ga0495675_0036579
832 Ga0495684_0232814
833 Ga0495593_0039046
834 Ga0496100_0034454
835 Ga0496100_0219912
836 Ga0496102_0109847
837 Ga0496102_0151571
838 Ga0496103_0002568
839 Ga0496104_0044758
840 Ga0496104_0115147
841 Ga0496105_0079576
842 Ga0496105_0098942
843 Ga0496105_0343429
844 Ga0496107_0062494
845 Ga0496108_0094278
846 Ga0496108_0337181
847 Ga0496109_0330026
848 Ga0496110_0190356
849 Ga0496110_0220395
850 Ga0496111_0056505
851 Ga0496112_0048493
852 Ga0496112_0067794
853 Ga0496114_0079010
854 Ga0496114_0258804
855 Ga0496115_0113779
856 Ga0496117_0096886
857 Ga0496118_0030045
858 Ga0496119_0022959
859 Ga0496119_0040249
860 Ga0496120_0018799
861 Ga0496121_0012067
862 Ga0496121_0024633
863 Ga0496121_0033175
864 Ga0496121_0120219
865 Ga0496121_0136303
866 Ga0496125_0023119
867 Ga0496125_0076380
868 Ga0496125_0149921
869 Ga0496126_0035626
870 Ga0496126_0046598
871 Ga0501032_0000471
872 Ga0501034_0003048
873 Ga0501034_0125585
874 Ga0501034_0126525
875 Ga0501043_0246638
876 Ga0501067_0000015
877 Ga0501068_0032996
878 Ga0501070_0151989
879 Ga0501070_0188516
880 Ga0501072_0128882
881 Ga0501073_0000017
882 Ga0501077_0000009
883 Ga0501080_0001399
884 Ga0501035_0000418
885 Ga0501035_0117803
886 Ga0501044_0003364
887 Ga0501044_0013632
888 Ga0501045_0019016
889 nmdc:mga0yw44_7166_c1
890 nmdc:mga0k408_50338_c1
891 nmdc:mga06z11_17070_c1
892 nmdc:mga05p37_2749_c1
893 nmdc:mga08y16_357561_c1
894 nmdc:mga0n895_104031_c1
895 nmdc:mga0n895_1953_c1
896 nmdc:mga0n895_221829_c1
897 nmdc:mga0rr50_2282_c1
898 nmdc:mga0sz30_10839_c1
899 nmdc:mga0sz30_3178_c1
900 Ga0495619_0133892
901 Ga0500643_000056
902 Ga0500583_0078249
903 Ga0500566_0002386
904 Ga0500641_0001339
905 Ga0500641_0096440
906 Ga0500557_000042
907 Ga0500569_038462
908 Ga0500595_005447
909 Ga0500595_009722
910 Ga0500607_014254
911 Ga0500642_0000750
912 Ga0500652_068771
913 Ga0500616_0026469
914 Ga0500620_000969
915 Ga0500636_0001049
916 Ga0500625_007167
917 Ga0500645_012783
918 Ga0500645_017676
919 Ga0500601_000365
920 Ga0500661_003540
921 2507509143
922 2508543208
923 2508691047
924 2509148023
925 2511394133
926 2513626887
927 2513643717
928 2513646897
929 2513654485
930 2513692037
931 2513704138
932 2513722549
933 2513859287
934 2513872302
935 2513892292
936 2513915336
937 2514014030
938 2515626549
939 2517101767
940 2517892637
941 2524436810
942 2524539008
943 2528855302
944 2617351346
945 2617376241
946 2671117363
947 2723845565
948 2728750547
949 2745080254
950 2793063833
951 2793068527
952 2793080781
953 2805918094
954 2818242735
955 2824605049
956 2824613925
957 2824623471
958 2824631376
959 2824639662
960 2824646648
961 2824657084
962 2824665078
963 2824679041
964 2824681257
965 2824695643
966 2824701642
967 2824709568
968 2824719666
969 2824726455
970 2824735441
971 2824750045
972 2824760067
973 2824770498
974 2824779234
975 2838126296
976 2841943628
977 2841950425
978 2841958214
979 2841966738
980 2841975494
981 2841988366
982 2842039545
983 2842047509
984 2844318585
985 2847935531
986 2847946084
987 2849079798
988 2857513809
989 2874597257
990 2874609816
991 2874616292
992 2874626851
993 2874631266
994 2874649410
995 2876770486
996 2876777946
997 2876812350
998 2876823033
999 2879078703
1000 2879090741
1001 2879108216
1002 2879118304
1003 2879132819
1004 2879148619
1005 2881366898
1006 2881666307
1007 2885372017
1008 2885382113
1009 2885411041
1010 2888383565
1011 2888394394
1012 2888423987
1013 2889040358
1014 2903730048
1015 2903759041
1016 2904668429
1017 2904695999
1018 2904702752
1019 2904717397
1020 2906603434
1021 2906618360
1022 2906632175
1023 2906644754
1024 2906664068
1025 2908742970
1026 2908779635
1027 2922368244
1028 2922373783
1029 2922395862
1030 2922429738
1031 2929617493
1032 2929627198
1033 2932787463
1034 2932798412
1035 2932803285
1036 2932815081
1037 2932820722
1038 2932831770
1039 2933579449
1040 2935611974
1041 2935621868
1042 2935633372
1043 2935642813
1044 2935649597
1045 2935658888
1046 2935667915
1047 2935679035
1048 2935688665
1049 2935696018
1050 2935706756
1051 2935715684
1052 2935725752
1053 2935737969
1054 2935747344
1055 2935754081
1056 2935763118
1057 2935772552
1058 2935783104
1059 2935793368
1060 2935799455
1061 2935808435
1062 2935812870
1063 2935821454
1064 2935830522
1065 2935840551
1066 2935850287
1067 2935860115
1068 2935869234
1069 2935880589
1070 2935888063
1071 2935914333
1072 2935921047
1073 2935931989
1074 2935940586
1075 2935948529
1076 2935957000
1077 2935960222
1078 2935973598
1079 2935977452
1080 2935989949
1081 2935996243
1082 2936006377
1083 2936012921
1084 2936021485
1085 2936030214
1086 2936041458
1087 2936047679
1088 2936057163
1089 2940560543
1090 2941510263
1091 2941518000
1092 2941526016
1093 2941534339
1094 2941541318
1095 3005479956
1096 3005489668
1097 3005509887
1098 3005590001
1099 3005598706
1100 3005714359
1101 3005721866
1102 8006941146
1103 8006971723
1104 8006980648
1105 8006985754
1106 8006997434
1107 8016513903
1108 8016530151
1109 8016535398
1110 8016548601
1111 8016553528
1112 8016561911
1113 8016573732
1114 8016577857
1115 8016599738
1116 8016611103
1117 8016622531
1118 8016627257
1119 8016631545
1120 8017062572
1121 8019535140
1122 8019554357
1123 8019557058
1124 8019568242
1125 8019581967
1126 8019589649
1127 8019601621
1128 8019616931
1129 8019627569
1130 8019635006
1131 8019644721
1132 8019657764
1133 8019662839
1134 8019672448
1135 8019683709
1136 8019689461
1137 8055746892
1138 8056674304
1139 8056689989
1140 8056972954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

86

276

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pk9-assembly1.cif.gz_A the crystal structure of native patatin 0.6828 85 381
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.6767 86 388
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.6604 86 388
4pka-assembly1.cif.gz_X crystal structure of patatin aged with diisopropylphosphorofluoridate 0.6499 82 381
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.6369 84 388
ID Description Score Start End Superfamily
af_Q18948_13_218_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7584 84 279 3.40.1090.10
af_Q54JJ8_18_280_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.725 82 358 3.40.1090.10
af_Q54JJ8_18_280_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7104 82 358 3.40.1090.10
af_Q9N5Z7_84_319_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6672 84 317 3.40.1090.10
af_Q54HM9_139_467_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6629 88 380 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A2S6MCU6-F1-model_v4 Alpha/beta hydrolase 0.9738 82 394 GO:0016042
GO:0016787
AF-I2Q867-F1-model_v4 Putative esterase of the alpha-beta hydrolase superfamily 0.9704 40 394 GO:0016042
GO:0016787
AF-A0A2S6MCU6-F1-model_v4 Alpha/beta hydrolase 0.9677 82 394 GO:0016042
GO:0016787
AF-A0A4Y3ZI11-F1-model_v4 deleted 0.9663 46 394
AF-A0A1I5F4T5-F1-model_v4 Patatin-like phospholipase 0.964 33 394 GO:0016042
GO:0016787

Map