F464982

General Info

Members Datasets Scaffolds Average Seq Length
571 469 1142 324

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0053643|Ga0466972_0053643_515_1657
Length 380
Sequence LLFVLTQFRTENRWALFLELLKKQRNGDLRSLFAFGEKRIKKRLQPSIRAEPVMTEILQTPKLVVVFGGSGFVGRHVVRALAKRGYRIRVACRRPDLAGHVQPLGNVGQIQPVQANVRVRWSVDRAVQGADHVVNLVAILHETGRQKFGAVHDFGARAVAEAARSVGAGLTQISALGADLNSPSDYARTKALGEKAVFETIQDAVIFRPSINFGPEDRFFNRFAGMARLSPVLPLIGGGLNKLQPVYVGDVAEAIARSVDGNVKGGQIYELGGPQVLTFKECMEELLAVIDRRRMLVPVPWWLANIQASILQLLPNPLLTRDQVLQLREHNIVSDEAAKTGRTLAGLGIQPQAIATILPSYLWRFRAAGQFQQRRPIADR

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
152 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
153 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
158 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
159 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
160 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
161 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
162 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
163 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
164 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
165 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
166 2512875024
167 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
168 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
169 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
170 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
171 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
172 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
173 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
174 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
175 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
176 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
177 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
178 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
179 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
180 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
181 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
182 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
183 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
184 2643221568 Rhizobium sp. Root564 Isolate Unclassified
185 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
186 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
187 2643221723 Ensifer sp. Root278 Isolate Unclassified
188 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
189 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
190 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
191 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
192 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
193 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
194 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
195 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
196 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
197 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
198 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
199 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
200 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
201 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
202 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
203 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
204 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
205 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
206 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
207 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
208 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
209 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
210 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
211 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
212 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
213 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
214 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
215 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
216 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
217 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
218 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
219 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
220 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
221 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
222 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
223 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
224 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
225 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
226 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
227 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
228 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
229 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
230 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
231 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
232 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
233 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
234 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
235 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
236 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
237 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
238 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
239 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
240 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
241 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
242 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
243 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
244 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
245 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
246 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
247 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
248 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
249 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
250 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
251 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
252 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
253 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
254 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
255 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
256 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
257 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
258 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
259 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
260 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
261 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
262 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
263 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
264 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
265 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
266 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
267 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
268 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
269 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
270 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
271 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
272 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
273 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
274 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
275 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
276 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
277 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
278 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
279 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
280 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
281 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
282 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
283 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
284 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
285 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
286 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
287 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
288 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
289 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
290 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
291 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
292 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
293 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
294 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
295 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
296 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
297 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
298 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
299 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
300 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
301 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
302 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
303 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
304 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
305 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
306 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
307 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
308 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
309 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
310 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
311 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
312 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
313 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
314 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
315 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
316 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
317 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
318 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
319 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
320 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
321 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
322 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
323 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
324 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
325 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
326 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
327 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
328 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
329 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
330 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
331 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
332 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
333 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
334 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
335 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
336 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
337 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
338 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
339 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
340 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
341 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
342 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
343 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
344 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
345 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
346 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
347 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
348 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
349 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
350 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
351 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
352 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
353 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
354 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
355 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
356 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
357 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
358 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
359 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
360 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
361 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
362 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
363 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
364 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
365 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
366 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
367 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
368 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
369 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
370 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
371 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
372 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
373 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
374 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
375 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
376 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
377 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
378 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
379 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
380 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
381 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
382 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
383 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
384 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
385 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
386 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
387 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
388 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
389 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
390 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
391 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
392 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
393 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
394 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
395 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
396 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
397 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
398 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
399 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
400 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
401 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
402 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
403 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
404 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
405 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
406 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
407 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
408 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
409 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
410 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
411 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
412 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
413 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
414 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
415 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
416 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
417 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
418 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
419 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
420 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
421 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
422 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
423 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
424 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
425 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
426 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
427 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
428 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
429 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
430 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
431 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
432 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
433 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
434 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
435 3004167301 Mesorhizobium loti 582 Isolate Unclassified
436 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
437 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
438 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
439 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
440 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
441 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
442 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
443 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
444 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
445 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
446 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
447 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
448 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
449 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
450 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
451 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
452 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
453 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
454 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
455 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
456 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
457 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
458 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
459 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
460 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
461 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
462 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
463 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
464 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
465 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
466 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
467 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
468 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
469 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.01
Metatranscriptomes 0
Isolates 54.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 9.28
Nodule 43.96
Rhizoplane 1.05
Rhizosphere 32.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0053643 3300044658 Bacteria 1941
2 JGI25155J39150_1000054 3300002704 Bacteria 74407
3 JGI25156J39149_1000258 3300002705 Bacteria 36521
4 JGI25154J39366_1000104 3300002738 Bacteria 74407
5 JGI25157J39369_1000291 3300002741 Bacteria 36531
6 JGI25157J39369_1000462 3300002741 Bacteria 25566
7 JGI25157J39369_1002897 3300002741 Bacteria 3825
8 JGI25159J45721_1000015 3300002987 Bacteria 142431
9 JGI25165J46597_1000206 3300003214 Bacteria 84821
10 JGI25165J46597_1002956 3300003214 Bacteria 4740
11 JGI25153J46596_10002351 3300003215 Bacteria 10954
12 JGI25153J46596_10006813 3300003215 Bacteria 5720
13 rootH2_10294441 3300003320 Bacteria 1231
14 JGI25160J50197_1000003 3300003354 Bacteria 482719
15 JGI25161J50226_1000219 3300003374 Bacteria 35426
16 Ga0055542_1000256 3300003762 Bacteria 60110
17 Ga0055526_1003824 3300003771 Bacteria 9358
18 Ga0055524_1030662 3300003775 Bacteria 1563
19 Ga0055524_1032134 3300003775 Bacteria 1494
20 Ga0055536_1005156 3300003781 Bacteria 6460
21 Ga0055528_1001254 3300003790 Bacteria 16112
22 Ga0055530_10014105 3300003791 Bacteria 2683
23 Ga0055531_10026358 3300003794 Bacteria 2076
24 Ga0055543_1000034 3300004625 Bacteria 128668
25 Ga0065165_1000025 3300005262 Bacteria 246909
26 Ga0070658_10198396 3300005327 Bacteria 1693
27 Ga0070661_100169012 3300005344 Bacteria 1660
28 Ga0070659_100236504 3300005366 Bacteria 1510
29 Ga0070667_100082791 3300005367 Bacteria 2748
30 Ga0070714_100074985 3300005435 Bacteria 2934
31 Ga0070713_100211505 3300005436 Bacteria 1756
32 Ga0070663_100118199 3300005455 Bacteria 1999
33 Ga0070678_100336563 3300005456 Bacteria 1293
34 Ga0068853_100022594 3300005539 Bacteria 5255
35 Ga0070672_100140433 3300005543 Bacteria 1992
36 Ga0070665_100029417 3300005548 Bacteria 5529
37 Ga0070665_100215386 3300005548 Bacteria 1921
38 Ga0068855_100207076 3300005563 Bacteria 2206
39 Ga0068857_100144397 3300005577 Bacteria 2153
40 Ga0081455_10005744 3300005937 Bacteria 13527
41 Ga0075365_10005367 3300006038 Bacteria 6908
42 Ga0075365_10023830 3300006038 Bacteria 3853
43 Ga0075365_10054407 3300006038 Bacteria 2654
44 Ga0075368_10008944 3300006042 Bacteria 3591
45 Ga0075369_10005264 3300006186 Bacteria 4824
46 Ga0075431_100197086 3300006847 Bacteria 2062
47 Ga0105240_10166244 3300009093 Bacteria 2616
48 Ga0105247_10024305 3300009101 Bacteria 3650
49 Ga0105243_10414130 3300009148 Bacteria 1255
50 Ga0105237_10000538 3300009545 Bacteria 53474
51 Ga0105237_10064036 3300009545 Bacteria 3674
52 Ga0105237_10304322 3300009545 Bacteria 1597
53 Ga0105238_10009675 3300009551 Bacteria 9649
54 Ga0105238_10114258 3300009551 Bacteria 2679
55 Ga0105239_10076398 3300010375 Bacteria 3684
56 Ga0182008_10047250 3300014497 Bacteria 2139
57 Ga0182005_1004758 3300015265 Bacteria 4331
58 Ga0182005_1007445 3300015265 Bacteria 3283
59 Ga0209435_100065 3300025206 Bacteria 74485
60 Ga0209436_100767 3300025208 Bacteria 13307
61 Ga0209437_108788 3300025233 Bacteria 1601
62 Ga0209646_1000195 3300025246 Bacteria 74485
63 Ga0209026_1000050 3300025250 Bacteria 254994
64 Ga0209026_1000235 3300025250 Bacteria 74485
65 Ga0209677_102979 3300025253 Bacteria 5879
66 Ga0209148_1000032 3300025254 Bacteria 557660
67 Ga0209759_1000268 3300025256 Bacteria 74485
68 Ga0209233_1000034 3300025261 Bacteria 578898
69 Ga0209233_1000236 3300025261 Bacteria 92446
70 Ga0209233_1025452 3300025261 Bacteria 1463
71 Ga0209455_1000235 3300025272 Bacteria 69582
72 Ga0209673_1000024 3300025273 Bacteria 409632
73 Ga0209130_1000005 3300025284 Bacteria 599620
74 Ga0209676_1003201 3300025292 Bacteria 10368
75 Ga0209676_1020378 3300025292 Bacteria 2253
76 Ga0209025_1000105 3300025294 Bacteria 224157
77 Ga0209564_1000113 3300025295 Bacteria 211564
78 Ga0209564_1004918 3300025295 Bacteria 7912
79 Ga0209758_1005874 3300025297 Bacteria 9161
80 Ga0209050_1000773 3300025298 Bacteria 45942
81 Ga0209256_1001386 3300025299 Bacteria 25312
82 Ga0209256_1004283 3300025299 Bacteria 9094
83 Ga0207426_1000015 3300025302 Bacteria 599316
84 Ga0209051_1010555 3300025303 Bacteria 4648
85 Ga0209257_1002062 3300025304 Bacteria 21252
86 Ga0207645_10104683 3300025907 Bacteria 1828
87 Ga0207705_10191040 3300025909 Bacteria 1548
88 Ga0207657_10054645 3300025919 Bacteria 3452
89 Ga0207694_10003257 3300025924 Bacteria 12933
90 Ga0207694_10248683 3300025924 Bacteria 1454
91 Ga0207664_10058602 3300025929 Bacteria 3064
92 Ga0207711_10396382 3300025941 Bacteria 1282
93 Ga0207640_10143600 3300025981 Bacteria 1743
94 Ga0207658_10092273 3300025986 Bacteria 2352
95 Ga0207639_10003680 3300026041 Bacteria 10305
96 Ga0207639_10304003 3300026041 Bacteria 1411
97 Ga0207678_10082759 3300026067 Bacteria 2746
98 Ga0207648_10261813 3300026089 Bacteria 1543
99 Ga0207674_10214350 3300026116 Bacteria 1874
100 Ga0207683_10591470 3300026121 Bacteria 1027
101 Ga0268266_10007221 3300028379 Bacteria 10047
102 Ga0268266_10107807 3300028379 Bacteria 2464
103 Ga0268266_10202198 3300028379 Bacteria 1818
104 Ga0307515_10085397 3300028794 Bacteria 4039
105 Ga0307513_10010669 3300031456 Bacteria 11495
106 Ga0307406_10068301 3300031901 Bacteria 2320
107 Ga0307416_100429696 3300032002 Bacteria 1368
108 Ga0307414_10260148 3300032004 Bacteria 1448
109 Ga0316582_0014924 3300036647 Bacteria 4425
110 Ga0373925_0382353 3300037068 Bacteria 1146
111 Ga0395899_0000014 3300037312 Bacteria 488813
112 Ga0395900_0000007 3300037418 Bacteria 488860
113 Ga0395900_0084598 3300037418 Bacteria 3260
114 Ga0395898_0000011 3300037466 Bacteria 488860
115 Ga0395898_0113118 3300037466 Bacteria 2602
116 Ga0395905_0000008 3300037471 Bacteria 488860
117 Ga0395905_0166850 3300037471 Bacteria 2069
118 Ga0395905_0233299 3300037471 Bacteria 1720
119 Ga0395901_0000020 3300038443 Bacteria 314918
120 Ga0395901_0046061 3300038443 Bacteria 4529
121 Ga0395901_0081739 3300038443 Bacteria 3375
122 Ga0395901_0165499 3300038443 Bacteria 2322
123 Ga0436365_0825675 3300039437 Bacteria 1292
124 Ga0436363_1383630 3300039450 Bacteria 4547
125 Ga0451837_1052623 3300041494 Bacteria 1622
126 Ga0466970_0032066 3300044765 Bacteria 2776
127 Ga0451576_0021846 3300045051 Bacteria 6948
128 Ga0495590_0049609 3300046457 Bacteria 1465
129 Ga0495584_0048368 3300046491 Bacteria 2144
130 Ga0495606_0060035 3300046507 Bacteria 2437
131 Ga0495610_0054674 3300046512 Bacteria 1927
132 Ga0495631_0078064 3300046518 Bacteria 1429
133 Ga0495643_0001807 3300046522 Bacteria 18306
134 Ga0495668_0087035 3300046616 Bacteria 1713
135 Ga0495625_0027790 3300046660 Bacteria 4251
136 Ga0495683_0044783 3300047323 Bacteria 2225
137 Ga0496112_0109985 3300048915 Bacteria 2726
138 Ga0496113_0080040 3300048916 Bacteria 2502
139 Ga0496117_0004320 3300048920 Bacteria 15810
140 Ga0496119_0035172 3300048922 Bacteria 3286
141 Ga0496120_0005277 3300048923 Bacteria 10370
142 Ga0496122_0000309 3300048925 Bacteria 107844
143 Ga0496122_0016789 3300048925 Bacteria 6895
144 Ga0496123_0002465 3300048926 Bacteria 22901
145 Ga0496123_0003792 3300048926 Bacteria 16553
146 Ga0496123_0033371 3300048926 Bacteria 3706
147 Ga0496124_0027087 3300048927 Bacteria 5155
148 Ga0496125_0007910 3300048928 Bacteria 11225
149 Ga0496125_0028346 3300048928 Bacteria 5061
150 Ga0496126_0000069 3300048929 Bacteria 246935
151 Ga0496126_0002943 3300048929 Bacteria 22129
152 Ga0495678_049933 3300049459 Bacteria 1624
153 Ga0501031_0000243 3300049568 Bacteria 30699
154 Ga0501031_0018388 3300049568 Bacteria 4548
155 Ga0501031_0018626 3300049568 Bacteria 4522
156 Ga0501032_0000004 3300049569 Bacteria 310855
157 Ga0501032_0002337 3300049569 Bacteria 14871
158 Ga0501032_0016853 3300049569 Bacteria 5134
159 Ga0501033_0000806 3300049570 Bacteria 28698
160 Ga0501033_0004831 3300049570 Bacteria 10754
161 Ga0501033_0016295 3300049570 Bacteria 5630
162 Ga0501033_0031582 3300049570 Bacteria 3978
163 Ga0501033_0038662 3300049570 Bacteria 3565
164 Ga0501034_0000011 3300049571 Bacteria 310855
165 Ga0501034_0034612 3300049571 Bacteria 5121
166 Ga0501034_0101541 3300049571 Bacteria 2870
167 Ga0501034_0250854 3300049571 Bacteria 1714
168 Ga0501034_0334012 3300049571 Bacteria 1447
169 Ga0501034_0407646 3300049571 Bacteria 1281
170 Ga0501036_0000001 3300049572 Bacteria 310855
171 Ga0501036_0008143 3300049572 Bacteria 8591
172 Ga0501037_0000064 3300049573 Bacteria 97087
173 Ga0501037_0000236 3300049573 Bacteria 47586
174 Ga0501037_0024117 3300049573 Bacteria 4497
175 Ga0501037_0064777 3300049573 Bacteria 2663
176 Ga0501038_0000003 3300049574 Bacteria 310855
177 Ga0501038_0061518 3300049574 Bacteria 3211
178 Ga0501038_0168357 3300049574 Bacteria 1776
179 Ga0501038_0241663 3300049574 Bacteria 1433
180 Ga0501038_0409671 3300049574 Bacteria 1047
181 Ga0501039_0000004 3300049575 Bacteria 310855
182 Ga0501040_0004730 3300049576 Bacteria 8838
183 Ga0501043_0000065 3300049579 Bacteria 93521
184 Ga0501043_0000747 3300049579 Bacteria 28846
185 Ga0501043_0011089 3300049579 Bacteria 7058
186 Ga0501043_0063885 3300049579 Bacteria 2891
187 Ga0501043_0256523 3300049579 Bacteria 1346
188 Ga0501043_0296639 3300049579 Bacteria 1236
189 Ga0501046_0143260 3300049580 Bacteria 1807
190 Ga0501046_0220374 3300049580 Bacteria 1405
191 Ga0501047_0000988 3300049581 Bacteria 28672
192 Ga0501047_0004472 3300049581 Bacteria 13153
193 Ga0501047_0024316 3300049581 Bacteria 5815
194 Ga0501047_0286519 3300049581 Bacteria 1491
195 Ga0501047_0288906 3300049581 Bacteria 1483
196 Ga0501047_0409933 3300049581 Bacteria 1187
197 Ga0501048_0020521 3300049582 Bacteria 4842
198 Ga0501067_0031393 3300049583 Bacteria 2948
199 Ga0501068_0050887 3300049584 Bacteria 2505
200 Ga0501069_0000002 3300049585 Bacteria 269636
201 Ga0501069_0047325 3300049585 Bacteria 2387
202 Ga0501069_0054269 3300049585 Bacteria 2232
203 Ga0501069_0062970 3300049585 Bacteria 2071
204 Ga0501070_0000339 3300049586 Bacteria 42523
205 Ga0501070_0002288 3300049586 Bacteria 16831
206 Ga0501070_0005978 3300049586 Bacteria 10367
207 Ga0501070_0024663 3300049586 Bacteria 5043
208 Ga0501070_0027159 3300049586 Bacteria 4801
209 Ga0501070_0034632 3300049586 Bacteria 4220
210 Ga0501070_0052966 3300049586 Bacteria 3367
211 Ga0501070_0231084 3300049586 Bacteria 1515
212 Ga0501071_0111010 3300049587 Bacteria 2026
213 Ga0501071_0132625 3300049587 Bacteria 1851
214 Ga0501072_0233205 3300049588 Bacteria 1466
215 Ga0501073_0059834 3300049589 Bacteria 2659
216 Ga0501073_0108414 3300049589 Bacteria 1927
217 Ga0501073_0141656 3300049589 Bacteria 1666
218 Ga0501074_0000009 3300049590 Bacteria 100578
219 Ga0501074_0036603 3300049590 Bacteria 3555
220 Ga0501074_0082925 3300049590 Bacteria 2299
221 Ga0501074_0196329 3300049590 Bacteria 1438
222 Ga0501075_0014517 3300049591 Bacteria 5645
223 Ga0501076_0040667 3300049592 Bacteria 3654
224 Ga0501080_0000617 3300049742 Bacteria 28211
225 Ga0501080_0292283 3300049742 Bacteria 1479
226 Ga0501081_0003273 3300049743 Bacteria 10292
227 Ga0501083_0007081 3300049744 Bacteria 7961
228 Ga0501035_0000009 3300049822 Bacteria 310827
229 Ga0501035_0000124 3300049822 Bacteria 93561
230 Ga0501035_0004856 3300049822 Bacteria 12747
231 Ga0501035_0005548 3300049822 Bacteria 11918
232 Ga0501035_0016799 3300049822 Bacteria 6748
233 Ga0501035_0020045 3300049822 Bacteria 6142
234 Ga0501035_0041294 3300049822 Bacteria 4165
235 Ga0501035_0197371 3300049822 Bacteria 1728
236 Ga0501044_0000005 3300049823 Bacteria 310855
237 Ga0501044_0000087 3300049823 Bacteria 112979
238 Ga0501044_0023118 3300049823 Bacteria 6617
239 Ga0501044_0026109 3300049823 Bacteria 6185
240 Ga0501044_0034261 3300049823 Bacteria 5327
241 Ga0501044_0050032 3300049823 Bacteria 4314
242 Ga0501044_0071573 3300049823 Bacteria 3525
243 Ga0501044_0542202 3300049823 Bacteria 1061
244 nmdc:mga0yw44_1171_c2 3300050492 Bacteria 7641
245 nmdc:mga0yw44_2346_c1 3300050492 Bacteria 8022
246 nmdc:mga0yw44_476_c2 3300050492 Bacteria 8764
247 nmdc:mga04h51_32992_c1 3300050495 Bacteria 1646
248 nmdc:mga0sz30_4669_c3 3300050516 Bacteria 3920
249 Ga0500578_0018428 3300053086 Bacteria 4484
250 Ga0500643_035341 3300053087 Bacteria 1499
251 Ga0500658_0001070 3300053134 Bacteria 11208
252 Ga0500568_0000010 3300053139 Bacteria 249043
253 Ga0501084_0003823 3300054114 Bacteria 12247
254 Ga0501082_0009777 3300060353 Bacteria 8262
255 Ga0501082_0024440 3300060353 Bacteria 5209
256 Ga0501082_0195136 3300060353 Bacteria 1761
257 Ga0530510_0127359 3300061734 Bacteria 1872
258 2503198307 2503198000 Bacteria 6884444
259 2509114467 2508501123 Bacteria 6283661
260 2509140074 2508501127 Bacteria 7037543
261 2509368376 2509276018 Bacteria 6910194
262 2509393220 2509276022 Bacteria 6200534
263 2510314657 2510065059 Bacteria 6847884
264 2510843260 2510461069 Bacteria 5505000
265 2511392025 2511231027 Bacteria 5013807
266 2512934217 2512875016 Bacteria 6529530
267 2512962519 2512875024 Bacteria 7195110
268 2513609783 2513237090 Bacteria 7096802
269 2514038649 2513237164 Bacteria 7563725
270 2514419048 2513237305 Bacteria 7293571
271 2514585992 2513237351 Bacteria 6968952
272 2515741067 2515154134 Bacteria 7220242
273 2517078842 2516653085 Bacteria 7346596
274 2523470581 2523231067 Bacteria 5230452
275 2561466618 2558860983 Bacteria 4133860
276 2585523825 2585427526 Bacteria 7258840
277 2588520370 2588253730 Bacteria 6881675
278 2597810555 2597489875 Bacteria 7010078
279 2599935484 2599185301 Bacteria 6161860
280 2600197548 2599185352 Bacteria 7228948
281 2643772086 2643221550 Bacteria 4619371
282 2643777377 2643221551 Bacteria 3750538
283 2643795825 2643221555 Bacteria 3749717
284 2643836663 2643221564 Bacteria 4193379
285 2643853784 2643221568 Bacteria 5187270
286 2643983943 2643221595 Bacteria 6565519
287 2644156073 2643221627 Bacteria 6761570
288 2644671577 2643221723 Bacteria 7095460
289 2688595631 2687453392 Bacteria 6880454
290 2694628204 2693429783 Bacteria 7019804
291 2694640939 2693429784 Bacteria 7241525
292 2723572830 2721755686 Bacteria 7343952
293 2739349673 2738543031 Bacteria 5769731
294 2756674286 2756170246 Bacteria 7451806
295 2770196505 2767802442 Bacteria 5747986
296 2776283491 2775506904 Bacteria 5954060
297 2792746816 2791355123 Bacteria 8049106
298 2837651466 2837651117 Bacteria 3772164
299 2838689726 2838686498 Bacteria 7807632
300 2838731578 2838729681 Bacteria 7400765
301 2838744519 2838742623 Bacteria 7396178
302 2839993518 2839993093 Bacteria 5512535
303 2840766529 2840764183 Bacteria 6358399
304 2841736056 2841734538 Bacteria 6784580
305 2841853059 2841851746 Bacteria 7532261
306 2842160386 2842156927 Bacteria 6894975
307 2842165636 2842163707 Bacteria 6916235
308 2842183948 2842180545 Bacteria 6888678
309 2842231529 2842229732 Bacteria 7475766
310 2842246001 2842243621 Bacteria 7421798
311 2842260379 2842257432 Bacteria 7401195
312 2842273790 2842271015 Bacteria 7807131
313 2842875015 2842871566 Bacteria 4827117
314 2844003840 2844002411 Bacteria 7168230
315 2844010430 2844009547 Bacteria 6728125
316 2844456474 2844454524 Bacteria 7952546
317 2847673160 2847670302 Bacteria 6165597
318 2847689676 2847686936 Bacteria 6278406
319 2856319807 2856314179 Bacteria 6477897
320 2856321941 2856320880 Bacteria 7263508
321 2856332887 2856328259 Bacteria 6528202
322 2856340268 2856334872 Bacteria 7037011
323 2856345770 2856342000 Bacteria 7176905
324 2856354645 2856349417 Bacteria 6230045
325 2856360424 2856356410 Bacteria 6297484
326 2856366138 2856364286 Bacteria 6939991
327 2857352603 2857349434 Bacteria 7926032
328 2857373455 2857367948 Bacteria 6965560
329 2869165894 2869162929 Bacteria 6399702
330 2869176062 2869169390 Bacteria 6659796
331 2869238746 2869234852 Bacteria 6654993
332 2869246206 2869242130 Bacteria 6609239
333 2869254180 2869249662 Bacteria 6868783
334 2869260671 2869256925 Bacteria 6981691
335 2869267183 2869264136 Bacteria 6880765
336 2869275486 2869271264 Bacteria 6908218
337 2869280118 2869278585 Bacteria 7077053
338 2869291007 2869285874 Bacteria 6901219
339 2871433289 2871429161 Bacteria 6547891
340 2871446869 2871444079 Bacteria 6423508
341 2871458088 2871451962 Bacteria 7336357
342 2871465494 2871459585 Bacteria 6866887
343 2871470623 2871466892 Bacteria 6923287
344 2871475019 2871474448 Bacteria 6806570
345 2871485677 2871481445 Bacteria 6700002
346 2871491057 2871488783 Bacteria 6929816
347 2871498897 2871495908 Bacteria 6935695
348 2874103091 2874102143 Bacteria 6342645
349 2874115333 2874109183 Bacteria 6517025
350 2874118342 2874116593 Bacteria 6674494
351 2874131406 2874123672 Bacteria 7238285
352 2874133469 2874131515 Bacteria 6820270
353 2874143330 2874139085 Bacteria 7021506
354 2874148769 2874146452 Bacteria 7533118
355 2874160815 2874155637 Bacteria 6724144
356 2874164804 2874162495 Bacteria 6174670
357 2874172021 2874168670 Bacteria 8062617
358 2876363521 2876363079 Bacteria 6544991
359 2876385864 2876377896 Bacteria 6565995
360 2876387533 2876386047 Bacteria 6698674
361 2876397359 2876392853 Bacteria 6660880
362 2876403905 2876399893 Bacteria 6927900
363 2876413066 2876406927 Bacteria 6191900
364 2876418855 2876413966 Bacteria 6831344
365 2876424975 2876420981 Bacteria 6687741
366 2878035764 2878035449 Bacteria 6555736
367 2878734977 2878730984 Bacteria 6380721
368 2878740603 2878738818 Bacteria 7136951
369 2878750902 2878745973 Bacteria 6867388
370 2878755467 2878753008 Bacteria 6922523
371 2878763110 2878760144 Bacteria 6823465
372 2878770085 2878767105 Bacteria 6898628
373 2878775719 2878774303 Bacteria 6108671
374 2878781321 2878781027 Bacteria 6834456
375 2878789319 2878788777 Bacteria 6567085
376 2881147880 2881147464 Bacteria 7779814
377 2881158958 2881155292 Bacteria 6461656
378 2881164660 2881161766 Bacteria 7127907
379 2881855807 2881853255 Bacteria 6698367
380 2881861595 2881861095 Bacteria 7128710
381 2882915121 2882912400 Bacteria 6801539
382 2885306500 2885305155 Bacteria 7348390
383 2885314487 2885312484 Bacteria 6415165
384 2885324252 2885318864 Bacteria 6729568
385 2885328475 2885326080 Bacteria 7134805
386 2885340576 2885334103 Bacteria 7216818
387 2885346224 2885342637 Bacteria 7011821
388 2885351339 2885350715 Bacteria 6787678
389 2888342974 2888337043 Bacteria 6629336
390 2888344025 2888343758 Bacteria 6611049
391 2889014562 2889010040 Bacteria 6749192
392 2889020456 2889016732 Bacteria 6700763
393 2891375339 2891373044 Bacteria 5202277
394 2903454396 2903448605 Bacteria 7357801
395 2903499058 2903492973 Bacteria 13473544
396 2903506246 2903492973 Bacteria 13473544
397 2903516292 2903513507 Bacteria 6344008
398 2903525471 2903521522 Bacteria 6525694
399 2903531784 2903528002 Bacteria 6586099
400 2903543696 2903540706 Bacteria 7062119
401 2904664113 2904659560 Bacteria 6685615
402 2906313827 2906308376 Bacteria 6841989
403 2906326536 2906321335 Bacteria 6579571
404 2906334870 2906328253 Bacteria 6585166
405 2906369603 2906363423 Bacteria 6856682
406 2906375548 2906370794 Bacteria 6881062
407 2906378053 2906378014 Bacteria 6911440
408 2906398529 2906393657 Bacteria 6790866
409 2906403045 2906401398 Bacteria 6693206
410 2906413706 2906408224 Bacteria 6162342
411 2906420583 2906414383 Bacteria 6580790
412 2906429864 2906427513 Bacteria 6375796
413 2917558648 2917554339 Bacteria 4987857
414 2919120512 2919119836 Bacteria 5208557
415 2919168256 2919166419 Bacteria 4952238
416 2922136141 2922130491 Bacteria 7173936
417 2922155107 2922151315 Bacteria 6902399
418 2922161024 2922158528 Bacteria 6573167
419 2922177870 2922172374 Bacteria 6167644
420 2922185429 2922178524 Bacteria 6025201
421 2922193382 2922185730 Bacteria 7113964
422 2924715974 2924710171 Bacteria 6752351
423 2924724678 2924718760 Bacteria 6331356
424 2924727217 2924726620 Bacteria 6271473
425 2924736686 2924733363 Bacteria 7574837
426 2924744760 2924741084 Bacteria 6661321
427 2924753866 2924748358 Bacteria 6154725
428 2924756787 2924754689 Bacteria 6774424
429 2924764035 2924762789 Bacteria 6561353
430 2924778204 2924776078 Bacteria 7492003
431 2924791561 2924784321 Bacteria 7416538
432 2928522586 2928521798 Bacteria 4960112
433 2935902443 2935901341 Bacteria 7341747
434 2937819868 2937813078 Bacteria 7783518
435 2937826353 2937822353 Bacteria 7290551
436 2937836710 2937836603 Bacteria 6811263
437 2937843609 2937843397 Bacteria 5256375
438 2937854702 2937848649 Bacteria 6983481
439 2937866810 2937861824 Bacteria 6660327
440 2937878000 2937877337 Bacteria 7246526
441 2937897733 2937891427 Bacteria 6357007
442 2937973987 2937972304 Bacteria 7532020
443 2937983716 2937980651 Bacteria 6517427
444 2937997545 2937994558 Bacteria 7036190
445 2938016362 2938014810 Bacteria 6700592
446 2939673315 2939669807 Bacteria 5028511
447 2954014033 2954011201 Bacteria 4762601
448 2958035984 2958034702 Bacteria 6989922
449 2958045290 2958041894 Bacteria 13082850
450 2958076078 2958071322 Bacteria 6815895
451 2958085111 2958084443 Bacteria 7312792
452 2958101718 2958100919 Bacteria 6800575
453 2958110379 2958108152 Bacteria 6681128
454 2958119437 2958115193 Bacteria 6923548
455 2958125471 2958122699 Bacteria 7280457
456 2958135407 2958130278 Bacteria 6897202
457 2958151031 2958144490 Bacteria 6677056
458 2958168018 2958165035 Bacteria 6906348
459 2958177090 2958172287 Bacteria 6716688
460 2958184436 2958179912 Bacteria 6874908
461 2961082491 2961077736 Bacteria 7079850
462 2961118747 2961114664 Bacteria 6680456
463 2961131294 2961127735 Bacteria 7196641
464 2961140806 2961136820 Bacteria 6775228
465 2961166484 2961163497 Bacteria 6901077
466 2961176589 2961170736 Bacteria 7072258
467 2961185726 2961183825 Bacteria 6688536
468 2963644981 2963644680 Bacteria 6530403
469 2965021304 2965018300 Bacteria 6883036
470 2965030334 2965025482 Bacteria 6532201
471 2965034305 2965032056 Bacteria 6887443
472 2965041558 2965040258 Bacteria 6855979
473 2965065548 2965062239 Bacteria 7412989
474 2965094274 2965089291 Bacteria 6866420
475 2965108744 2965102966 Bacteria 6800987
476 2965113464 2965110997 Bacteria 6693150
477 2968001394 2967996073 Bacteria 6787468
478 2968007447 2968003550 Bacteria 6929263
479 2968017077 2968016561 Bacteria 7022047
480 2968088737 2968083720 Bacteria 7351627
481 2968093871 2968091066 Bacteria 6052692
482 2968101350 2968097103 Bacteria 6107094
483 2968115252 2968110612 Bacteria 6814636
484 2968121948 2968117919 Bacteria 6536078
485 2968134148 2968128360 Bacteria 6270294
486 2968174888 2968171901 Bacteria 6894245
487 2970470234 2970469710 Bacteria 6969209
488 2970490189 2970489779 Bacteria 6517260
489 2970509260 2970503327 Bacteria 7099517
490 2970514767 2970510686 Bacteria 7006402
491 2970525729 2970524798 Bacteria 6840927
492 2970537933 2970532167 Bacteria 6553173
493 2970541362 2970540015 Bacteria 6977556
494 2970550447 2970547951 Bacteria 6931819
495 2970557958 2970554993 Bacteria 6814252
496 2970594715 2970593180 Bacteria 7073582
497 2970624238 2970619444 Bacteria 6986144
498 2970627991 2970627176 Bacteria 6680862
499 2977824606 2977821940 Bacteria 6906439
500 2977835333 2977828996 Bacteria 7007971
501 2977845504 2977843712 Bacteria 6753583
502 2977857614 2977851361 Bacteria 6694324
503 2977864796 2977858184 Bacteria 6215359
504 2977866526 2977864932 Bacteria 7534097
505 2977873673 2977872689 Bacteria 7270173
506 2977905575 2977898635 Bacteria 6675551
507 2977911531 2977907340 Bacteria 6577984
508 2977916142 2977915119 Bacteria 6829656
509 2977925891 2977922695 Bacteria 6956781
510 2977941860 2977935797 Bacteria 6252826
511 2977950681 2977942078 Bacteria 7570577
512 2977951475 2977950692 Bacteria 6893264
513 2977963399 2977957713 Bacteria 6877875
514 2977975837 2977971508 Bacteria 7472917
515 2977990017 2977986579 Bacteria 6581278
516 2978970880 2978969890 Bacteria 5400756
517 2979717431 2979710463 Bacteria 6785254
518 2979747417 2979742915 Bacteria 7301278
519 2979769471 2979764755 Bacteria 6610066
520 2979778235 2979772303 Bacteria 6618277
521 2979781884 2979779861 Bacteria 6219781
522 2979813939 2979808191 Bacteria 7179355
523 2984587989 2984587000 Bacteria 5263363
524 2987641195 2987636660 Bacteria 8088555
525 2987649032 2987645492 Bacteria 6117018
526 2987662494 2987659509 Bacteria 6966464
527 2987667572 2987666974 Bacteria 6509233
528 2987674494 2987673487 Bacteria 6884027
529 2989772453 2989771324 Bacteria 5605128
530 2996316475 2996310559 Bacteria 6357320
531 2996336506 2996336353 Bacteria 5511628
532 2996342225 2996341866 Bacteria 6643098
533 2996348986 2996348954 Bacteria 7239054
534 2996391676 2996386984 Bacteria 6978667
535 3000142603 3000135777 Bacteria 6891109
536 3002141864 3002141150 Bacteria 5254435
537 3004172842 3004167301 Bacteria 8330599
538 3004191544 3004188549 Bacteria 6952365
539 3004197869 3004195979 Bacteria 6776956
540 3004210001 3004203850 Bacteria 7307914
541 3004216445 3004211236 Bacteria 7417683
542 3004218656 3004218560 Bacteria 7421728
543 3004239400 3004232784 Bacteria 6662140
544 3004242171 3004239961 Bacteria 6892290
545 3004254073 3004248173 Bacteria 6563236
546 3004272575 3004268573 Bacteria 7043476
547 3004275698 3004275668 Bacteria 7114440
548 3004337775 3004334049 Bacteria 8449246
549 637077368 637000159 Bacteria 7596297
550 649870198 649633066 Bacteria 6690028
551 8004301743 8004300914 Bacteria 6132239
552 8004315000 8004312739 Bacteria 7444653
553 8004377046 8004374579 Bacteria 6898112
554 8004393296 8004387939 Bacteria 7049250
555 8004396295 8004395343 Bacteria 6620908
556 8004446363 8004445564 Bacteria 6322258
557 8004633644 8004633249 Bacteria 6723080
558 8004644260 8004640170 Bacteria 6723001
559 8004707021 8004703790 Bacteria 8006957
560 8004720083 8004714634 Bacteria 6776161
561 8004727917 8004727605 Bacteria 6643904
562 8005310369 8005307578 Bacteria 7395396
563 8005560102 8005556819 Bacteria 6908598
564 8005564399 8005563573 Bacteria 7153261
565 8005661603 8005658619 Bacteria 4500593
566 8018152825 8018150411 Bacteria 5549903
567 8018167472 8018163183 Bacteria 7277977
568 8023681154 8023680758 Bacteria 7729763
569 8024479821 8024479707 Bacteria 6954785
570 8055433690 8055431914 Bacteria 4551896
571 8055617543 8055617313 Bacteria 7548464
572 Ga0466972_0053643
573 JGI25155J39150_1000054
574 JGI25156J39149_1000258
575 JGI25154J39366_1000104
576 JGI25157J39369_1000291
577 JGI25157J39369_1000462
578 JGI25157J39369_1002897
579 JGI25159J45721_1000015
580 JGI25165J46597_1000206
581 JGI25165J46597_1002956
582 JGI25153J46596_10002351
583 JGI25153J46596_10006813
584 rootH2_10294441
585 JGI25160J50197_1000003
586 JGI25161J50226_1000219
587 Ga0055542_1000256
588 Ga0055526_1003824
589 Ga0055524_1030662
590 Ga0055524_1032134
591 Ga0055536_1005156
592 Ga0055528_1001254
593 Ga0055530_10014105
594 Ga0055531_10026358
595 Ga0055543_1000034
596 Ga0065165_1000025
597 Ga0070658_10198396
598 Ga0070661_100169012
599 Ga0070659_100236504
600 Ga0070667_100082791
601 Ga0070714_100074985
602 Ga0070713_100211505
603 Ga0070663_100118199
604 Ga0070678_100336563
605 Ga0068853_100022594
606 Ga0070672_100140433
607 Ga0070665_100029417
608 Ga0070665_100215386
609 Ga0068855_100207076
610 Ga0068857_100144397
611 Ga0081455_10005744
612 Ga0075365_10005367
613 Ga0075365_10023830
614 Ga0075365_10054407
615 Ga0075368_10008944
616 Ga0075369_10005264
617 Ga0075431_100197086
618 Ga0105240_10166244
619 Ga0105247_10024305
620 Ga0105243_10414130
621 Ga0105237_10000538
622 Ga0105237_10064036
623 Ga0105237_10304322
624 Ga0105238_10009675
625 Ga0105238_10114258
626 Ga0105239_10076398
627 Ga0182008_10047250
628 Ga0182005_1004758
629 Ga0182005_1007445
630 Ga0209435_100065
631 Ga0209436_100767
632 Ga0209437_108788
633 Ga0209646_1000195
634 Ga0209026_1000050
635 Ga0209026_1000235
636 Ga0209677_102979
637 Ga0209148_1000032
638 Ga0209759_1000268
639 Ga0209233_1000034
640 Ga0209233_1000236
641 Ga0209233_1025452
642 Ga0209455_1000235
643 Ga0209673_1000024
644 Ga0209130_1000005
645 Ga0209676_1003201
646 Ga0209676_1020378
647 Ga0209025_1000105
648 Ga0209564_1000113
649 Ga0209564_1004918
650 Ga0209758_1005874
651 Ga0209050_1000773
652 Ga0209256_1001386
653 Ga0209256_1004283
654 Ga0207426_1000015
655 Ga0209051_1010555
656 Ga0209257_1002062
657 Ga0207645_10104683
658 Ga0207705_10191040
659 Ga0207657_10054645
660 Ga0207694_10003257
661 Ga0207694_10248683
662 Ga0207664_10058602
663 Ga0207711_10396382
664 Ga0207640_10143600
665 Ga0207658_10092273
666 Ga0207639_10003680
667 Ga0207639_10304003
668 Ga0207678_10082759
669 Ga0207648_10261813
670 Ga0207674_10214350
671 Ga0207683_10591470
672 Ga0268266_10007221
673 Ga0268266_10107807
674 Ga0268266_10202198
675 Ga0307515_10085397
676 Ga0307513_10010669
677 Ga0307406_10068301
678 Ga0307416_100429696
679 Ga0307414_10260148
680 Ga0316582_0014924
681 Ga0373925_0382353
682 Ga0395899_0000014
683 Ga0395900_0000007
684 Ga0395900_0084598
685 Ga0395898_0000011
686 Ga0395898_0113118
687 Ga0395905_0000008
688 Ga0395905_0166850
689 Ga0395905_0233299
690 Ga0395901_0000020
691 Ga0395901_0046061
692 Ga0395901_0081739
693 Ga0395901_0165499
694 Ga0436365_0825675
695 Ga0436363_1383630
696 Ga0451837_1052623
697 Ga0466970_0032066
698 Ga0451576_0021846
699 Ga0495590_0049609
700 Ga0495584_0048368
701 Ga0495606_0060035
702 Ga0495610_0054674
703 Ga0495631_0078064
704 Ga0495643_0001807
705 Ga0495668_0087035
706 Ga0495625_0027790
707 Ga0495683_0044783
708 Ga0496112_0109985
709 Ga0496113_0080040
710 Ga0496117_0004320
711 Ga0496119_0035172
712 Ga0496120_0005277
713 Ga0496122_0000309
714 Ga0496122_0016789
715 Ga0496123_0002465
716 Ga0496123_0003792
717 Ga0496123_0033371
718 Ga0496124_0027087
719 Ga0496125_0007910
720 Ga0496125_0028346
721 Ga0496126_0000069
722 Ga0496126_0002943
723 Ga0495678_049933
724 Ga0501031_0000243
725 Ga0501031_0018388
726 Ga0501031_0018626
727 Ga0501032_0000004
728 Ga0501032_0002337
729 Ga0501032_0016853
730 Ga0501033_0000806
731 Ga0501033_0004831
732 Ga0501033_0016295
733 Ga0501033_0031582
734 Ga0501033_0038662
735 Ga0501034_0000011
736 Ga0501034_0034612
737 Ga0501034_0101541
738 Ga0501034_0250854
739 Ga0501034_0334012
740 Ga0501034_0407646
741 Ga0501036_0000001
742 Ga0501036_0008143
743 Ga0501037_0000064
744 Ga0501037_0000236
745 Ga0501037_0024117
746 Ga0501037_0064777
747 Ga0501038_0000003
748 Ga0501038_0061518
749 Ga0501038_0168357
750 Ga0501038_0241663
751 Ga0501038_0409671
752 Ga0501039_0000004
753 Ga0501040_0004730
754 Ga0501043_0000065
755 Ga0501043_0000747
756 Ga0501043_0011089
757 Ga0501043_0063885
758 Ga0501043_0256523
759 Ga0501043_0296639
760 Ga0501046_0143260
761 Ga0501046_0220374
762 Ga0501047_0000988
763 Ga0501047_0004472
764 Ga0501047_0024316
765 Ga0501047_0286519
766 Ga0501047_0288906
767 Ga0501047_0409933
768 Ga0501048_0020521
769 Ga0501067_0031393
770 Ga0501068_0050887
771 Ga0501069_0000002
772 Ga0501069_0047325
773 Ga0501069_0054269
774 Ga0501069_0062970
775 Ga0501070_0000339
776 Ga0501070_0002288
777 Ga0501070_0005978
778 Ga0501070_0024663
779 Ga0501070_0027159
780 Ga0501070_0034632
781 Ga0501070_0052966
782 Ga0501070_0231084
783 Ga0501071_0111010
784 Ga0501071_0132625
785 Ga0501072_0233205
786 Ga0501073_0059834
787 Ga0501073_0108414
788 Ga0501073_0141656
789 Ga0501074_0000009
790 Ga0501074_0036603
791 Ga0501074_0082925
792 Ga0501074_0196329
793 Ga0501075_0014517
794 Ga0501076_0040667
795 Ga0501080_0000617
796 Ga0501080_0292283
797 Ga0501081_0003273
798 Ga0501083_0007081
799 Ga0501035_0000009
800 Ga0501035_0000124
801 Ga0501035_0004856
802 Ga0501035_0005548
803 Ga0501035_0016799
804 Ga0501035_0020045
805 Ga0501035_0041294
806 Ga0501035_0197371
807 Ga0501044_0000005
808 Ga0501044_0000087
809 Ga0501044_0023118
810 Ga0501044_0026109
811 Ga0501044_0034261
812 Ga0501044_0050032
813 Ga0501044_0071573
814 Ga0501044_0542202
815 nmdc:mga0yw44_1171_c2
816 nmdc:mga0yw44_2346_c1
817 nmdc:mga0yw44_476_c2
818 nmdc:mga04h51_32992_c1
819 nmdc:mga0sz30_4669_c3
820 Ga0500578_0018428
821 Ga0500643_035341
822 Ga0500658_0001070
823 Ga0500568_0000010
824 Ga0501084_0003823
825 Ga0501082_0009777
826 Ga0501082_0024440
827 Ga0501082_0195136
828 Ga0530510_0127359
829 2503198307
830 2509114467
831 2509140074
832 2509368376
833 2509393220
834 2510314657
835 2510843260
836 2511392025
837 2512934217
838 2512962519
839 2513609783
840 2514038649
841 2514419048
842 2514585992
843 2515741067
844 2517078842
845 2523470581
846 2561466618
847 2585523825
848 2588520370
849 2597810555
850 2599935484
851 2600197548
852 2643772086
853 2643777377
854 2643795825
855 2643836663
856 2643853784
857 2643983943
858 2644156073
859 2644671577
860 2688595631
861 2694628204
862 2694640939
863 2723572830
864 2739349673
865 2756674286
866 2770196505
867 2776283491
868 2792746816
869 2837651466
870 2838689726
871 2838731578
872 2838744519
873 2839993518
874 2840766529
875 2841736056
876 2841853059
877 2842160386
878 2842165636
879 2842183948
880 2842231529
881 2842246001
882 2842260379
883 2842273790
884 2842875015
885 2844003840
886 2844010430
887 2844456474
888 2847673160
889 2847689676
890 2856319807
891 2856321941
892 2856332887
893 2856340268
894 2856345770
895 2856354645
896 2856360424
897 2856366138
898 2857352603
899 2857373455
900 2869165894
901 2869176062
902 2869238746
903 2869246206
904 2869254180
905 2869260671
906 2869267183
907 2869275486
908 2869280118
909 2869291007
910 2871433289
911 2871446869
912 2871458088
913 2871465494
914 2871470623
915 2871475019
916 2871485677
917 2871491057
918 2871498897
919 2874103091
920 2874115333
921 2874118342
922 2874131406
923 2874133469
924 2874143330
925 2874148769
926 2874160815
927 2874164804
928 2874172021
929 2876363521
930 2876385864
931 2876387533
932 2876397359
933 2876403905
934 2876413066
935 2876418855
936 2876424975
937 2878035764
938 2878734977
939 2878740603
940 2878750902
941 2878755467
942 2878763110
943 2878770085
944 2878775719
945 2878781321
946 2878789319
947 2881147880
948 2881158958
949 2881164660
950 2881855807
951 2881861595
952 2882915121
953 2885306500
954 2885314487
955 2885324252
956 2885328475
957 2885340576
958 2885346224
959 2885351339
960 2888342974
961 2888344025
962 2889014562
963 2889020456
964 2891375339
965 2903454396
966 2903499058
967 2903506246
968 2903516292
969 2903525471
970 2903531784
971 2903543696
972 2904664113
973 2906313827
974 2906326536
975 2906334870
976 2906369603
977 2906375548
978 2906378053
979 2906398529
980 2906403045
981 2906413706
982 2906420583
983 2906429864
984 2917558648
985 2919120512
986 2919168256
987 2922136141
988 2922155107
989 2922161024
990 2922177870
991 2922185429
992 2922193382
993 2924715974
994 2924724678
995 2924727217
996 2924736686
997 2924744760
998 2924753866
999 2924756787
1000 2924764035
1001 2924778204
1002 2924791561
1003 2928522586
1004 2935902443
1005 2937819868
1006 2937826353
1007 2937836710
1008 2937843609
1009 2937854702
1010 2937866810
1011 2937878000
1012 2937897733
1013 2937973987
1014 2937983716
1015 2937997545
1016 2938016362
1017 2939673315
1018 2954014033
1019 2958035984
1020 2958045290
1021 2958076078
1022 2958085111
1023 2958101718
1024 2958110379
1025 2958119437
1026 2958125471
1027 2958135407
1028 2958151031
1029 2958168018
1030 2958177090
1031 2958184436
1032 2961082491
1033 2961118747
1034 2961131294
1035 2961140806
1036 2961166484
1037 2961176589
1038 2961185726
1039 2963644981
1040 2965021304
1041 2965030334
1042 2965034305
1043 2965041558
1044 2965065548
1045 2965094274
1046 2965108744
1047 2965113464
1048 2968001394
1049 2968007447
1050 2968017077
1051 2968088737
1052 2968093871
1053 2968101350
1054 2968115252
1055 2968121948
1056 2968134148
1057 2968174888
1058 2970470234
1059 2970490189
1060 2970509260
1061 2970514767
1062 2970525729
1063 2970537933
1064 2970541362
1065 2970550447
1066 2970557958
1067 2970594715
1068 2970624238
1069 2970627991
1070 2977824606
1071 2977835333
1072 2977845504
1073 2977857614
1074 2977864796
1075 2977866526
1076 2977873673
1077 2977905575
1078 2977911531
1079 2977916142
1080 2977925891
1081 2977941860
1082 2977950681
1083 2977951475
1084 2977963399
1085 2977975837
1086 2977990017
1087 2978970880
1088 2979717431
1089 2979747417
1090 2979769471
1091 2979778235
1092 2979781884
1093 2979813939
1094 2984587989
1095 2987641195
1096 2987649032
1097 2987662494
1098 2987667572
1099 2987674494
1100 2989772453
1101 2996316475
1102 2996336506
1103 2996342225
1104 2996348986
1105 2996391676
1106 3000142603
1107 3002141864
1108 3004172842
1109 3004191544
1110 3004197869
1111 3004210001
1112 3004216445
1113 3004218656
1114 3004239400
1115 3004242171
1116 3004254073
1117 3004272575
1118 3004275698
1119 3004337775
1120 637077368
1121 649870198
1122 8004301743
1123 8004315000
1124 8004377046
1125 8004393296
1126 8004396295
1127 8004446363
1128 8004633644
1129 8004644260
1130 8004707021
1131 8004720083
1132 8004727917
1133 8005310369
1134 8005560102
1135 8005564399
1136 8005661603
1137 8018152825
1138 8018167472
1139 8023681154
1140 8024479821
1141 8055433690
1142 8055617543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

64

161

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

64

272

0.85

PF04321

RmlD_sub_bind

RmlD substrate binding domain

62

300

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

65

171

0.81

PF13460

NAD_binding_10

NAD(P)H-binding

68

211

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ak5-assembly1.cif.gz_P cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a 0.945 8 301
7r4f-assembly1.cif.gz_P bovine complex i in the presence of im1761092, slack class i (composite map) 0.9445 8 302
7r47-assembly1.cif.gz_P bovine complex i in the presence of im1761092, deactive class iii (composite map) 0.9444 8 301
7v2f-assembly1.cif.gz_J deactive state complex i from q10-nadh dataset 0.9443 8 301
6g72-assembly1.cif.gz_P mouse mitochondrial complex i in the deactive state 0.9376 9 301
ID Description Score Start End Superfamily
af_Q9SK66_71_329_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9639 11 249 3.40.50.720
af_A0A2R8RUA9_55_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 8 172 3.40.50.720
af_Q9DC69_47_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9537 8 214 3.40.50.720
af_Q4DU32_30_254_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 9 218 3.40.50.720
af_Q9N3H3_46_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 8 216 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V3KSF4-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9987 59 155 GO:0044877
GO:1901006
AF-A0A659YHF6-F1-model_v4 deleted 0.9865 107 247
AF-A0A2N3CM24-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9809 7 150 GO:0044877
GO:1901006
AF-A0A4V3KSF4-F1-model_v4 Complex I NDUFA9 subunit family protein 0.9786 59 155 GO:0044877
GO:1901006
AF-A0A4Q3YF92-F1-model_v4 Complex I NDUFA9 subunit family protein 0.978 7 240 GO:0044877
GO:1901006

Map