F465003

General Info

Members Datasets Scaffolds Average Seq Length
571 394 389 140

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0071788|Ga0501034_0071788_213_662
Length 149
Sequence MSAEAERLISVLKLAPHPEGGHYRETFRDCGPPPADRDGEGRGHSSAIFFLLKAGETSWWHRVDAAEVWHYHRGAPLELSIAHNGVITRQLLGAAIEKGETPQLVVPKDAWQMAKSLGDYTLVGCTVAPGFEFAGFELASKDFDPEKAR

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
18 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
19 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2519899620 Rhizobium sp. Pop5 Isolate Nodule
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
27 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
28 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
29 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
30 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
31 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
32 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
33 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
34 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
35 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
36 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
37 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
38 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
39 2643221599 Rhizobium sp. Root708 Isolate Unclassified
40 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
41 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
42 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
43 2718217882 Rhizobium sp. N741 Isolate Nodule
44 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
45 2718218009 Rhizobium sp. N561 Isolate Nodule
46 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
47 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
48 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
49 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
50 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
51 2718218363 Rhizobium sp. N113 Isolate Nodule
52 2718218365 Rhizobium sp. N731 Isolate Nodule
53 2718218366 Rhizobium sp. N621 Isolate Nodule
54 2721755514 Rhizobium sp. N6212 Isolate Nodule
55 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
56 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
57 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
58 2721755810 Rhizobium sp. N871 Isolate Nodule
59 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
60 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
61 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
62 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
63 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
64 2728369365 Rhizobium sp. N1341 Isolate Nodule
65 2728369397 Rhizobium sp. N1314 Isolate Nodule
66 2738541293 Rhizobium sp. GV031 Isolate Unclassified
67 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
68 2791355256 Rhizobium sp. M10 Isolate Nodule
69 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
70 2791355261 Rhizobium sp. J15 Isolate Nodule
71 2791355262 Rhizobium sp. M1 Isolate Nodule
72 2791355263 Rhizobium chutanense C5 Isolate Nodule
73 2791355264 Rhizobium sp. S9 Isolate Nodule
74 2791355265 Rhizobium sp. H4 Isolate Nodule
75 2791355266 Rhizobium sp. L43 Isolate Nodule
76 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
77 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
78 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
79 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
80 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
81 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
82 2838048938 Rhizobium pisi 27/80 Isolate Nodule
83 2838061910 Rhizobium phaseoli L15 Isolate Nodule
84 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
85 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
86 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
87 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
88 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
89 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
90 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
91 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
92 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
93 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
94 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
95 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
96 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
97 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
98 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
99 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
100 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
101 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
102 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
103 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
104 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
105 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
106 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
107 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
108 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
109 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
110 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
111 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
112 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
113 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
114 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
115 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
116 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
117 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
118 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
119 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
120 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
121 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
122 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
123 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
124 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
125 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
126 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
127 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
128 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
129 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
130 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
131 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
132 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
133 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
134 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
135 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
136 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
137 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
138 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
139 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
140 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
141 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
142 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
143 2933599457 Rhizobium phaseoli M3 Isolate Nodule
144 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
145 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
146 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
147 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
148 2936381700 Rhizobium chutanense C16 Isolate Unclassified
149 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
150 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
151 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
152 2996887358 Rhizobium sp. R711 Isolate Nodule
153 2996893221 Rhizobium sp. R635 Isolate Nodule
154 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
155 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
156 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
157 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
158 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
159 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
160 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
161 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
162 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
163 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
164 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
165 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
166 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
167 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
168 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
169 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
170 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
171 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
172 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
173 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
177 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
178 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
179 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
180 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
181 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
182 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
183 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
184 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
185 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
186 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
187 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
188 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
189 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
190 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
191 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
192 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
193 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
194 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
195 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
196 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
197 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
198 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
199 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
202 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
203 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
204 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
230 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
241 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
242 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
243 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
252 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
359 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
360 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
364 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
365 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
366 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
369 8005258706 Rhizobium sp. R693 Isolate Nodule
370 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
371 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
372 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
373 8005321885 Rhizobium sp. R72 Isolate Nodule
374 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
375 8005382845 Rhizobium sp. R634 Isolate Nodule
376 8005395548 Rhizobium sp. R339 Isolate Nodule
377 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
378 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
379 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
380 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
381 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
382 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
383 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
384 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
385 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
386 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
387 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
388 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
389 8018176218 Rhizobium sp. N122 Isolate Nodule
390 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
391 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
392 8024501048 Rhizobium sp. H4 Isolate Nodule
393 8056382006 Rhizobium croatiense 13T Isolate Nodule
394 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.78
Metatranscriptomes 0.35
Isolates 31.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.61
Nodule 25.74
Rhizoplane 2.1
Rhizosphere 38.18
Stem 0
Stem Tuber 0
Unclassified 14.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000413 3300002737 Bacteria 34872
2 JGI25158J39367_1000028 3300002739 Bacteria 33872
3 JGI25152J39213_1004277 3300002773 Bacteria 4556
4 JGI25152J39213_1015032 3300002773 Bacteria 1543
5 JGI25150J39212_1000166 3300002774 Bacteria 37196
6 JGI25150J39212_1004290 3300002774 Bacteria 3194
7 JGI25159J45721_1004013 3300002987 Bacteria 5009
8 JGI25151J46595_10000081 3300003187 Bacteria 131317
9 JGI25165J46597_1000675 3300003214 Bacteria 27458
10 JGI25165J46597_1001441 3300003214 Bacteria 12657
11 JGI25153J46596_10002857 3300003215 Bacteria 9811
12 JGI25153J46596_10003148 3300003215 Bacteria 9308
13 JGI25153J46596_10035946 3300003215 Bacteria 1596
14 JGI25153J46596_10037405 3300003215 Bacteria 1543
15 JGI25160J50197_1003057 3300003354 Bacteria 7631
16 JGI25160J50197_1013415 3300003354 Bacteria 2794
17 JGI25161J50226_1000155 3300003374 Bacteria 47660
18 Ga0006562J51391_1034136 3300003578 Bacteria 939
19 Ga0055526_1000804 3300003771 Bacteria 23394
20 Ga0055526_1003345 3300003771 Bacteria 10243
21 Ga0055524_1008951 3300003775 Bacteria 4116
22 Ga0055524_1017966 3300003775 Bacteria 2475
23 Ga0055524_1032923 3300003775 Bacteria 1460
24 Ga0055528_1001359 3300003790 Bacteria 15075
25 Ga0055528_1002326 3300003790 Bacteria 10294
26 Ga0055528_1002725 3300003790 Bacteria 9272
27 Ga0055528_1009993 3300003790 Bacteria 3908
28 Ga0055540_1004866 3300003792 Bacteria 5882
29 Ga0055540_1011606 3300003792 Bacteria 2826
30 Ga0055543_1000423 3300004625 Bacteria 26609
31 Ga0065165_1006427 3300005262 Bacteria 6165
32 Ga0070680_100000923 3300005336 Bacteria 20814
33 Ga0070668_100009914 3300005347 Bacteria 7054
34 Ga0070669_100035902 3300005353 Bacteria 3591
35 Ga0070671_100031536 3300005355 Bacteria 4379
36 Ga0070663_100053733 3300005455 Bacteria 2876
37 Ga0070678_100863487 3300005456 Bacteria 825
38 Ga0070662_100499972 3300005457 Bacteria 1014
39 Ga0070681_10000001 3300005458 Bacteria 946857
40 Ga0070679_100000619 3300005530 Bacteria 30202
41 Ga0070665_100224697 3300005548 Bacteria 1878
42 Ga0068852_102366991 3300005616 Bacteria 552
43 Ga0075365_10083254 3300006038 Bacteria 2170
44 Ga0075368_10061066 3300006042 Bacteria 1509
45 Ga0075367_10000200 3300006178 Bacteria 19844
46 Ga0075369_10027353 3300006186 Bacteria 2384
47 Ga0075370_10307848 3300006353 Bacteria 943
48 Ga0105245_10010260 3300009098 Bacteria 8156
49 Ga0105243_12054844 3300009148 Bacteria 606
50 Ga0123340_1042979 3300009763 Bacteria 1992
51 Ga0123340_1064801 3300009763 Bacteria 972
52 Ga0123341_1000020 3300009765 Bacteria 79523
53 Ga0123342_1007072 3300009766 Bacteria 15110
54 Ga0157373_10678759 3300013100 Bacteria 754
55 Ga0157370_11041193 3300013104 Bacteria 740
56 Ga0157369_10701348 3300013105 Bacteria 1042
57 Ga0157369_11211406 3300013105 Bacteria 770
58 Ga0157378_10707855 3300013297 Bacteria 1027
59 Ga0213876_10009966 3300021384 Bacteria 5108
60 Ga0209436_100166 3300025208 Bacteria 32105
61 Ga0209437_100057 3300025233 Bacteria 362922
62 Ga0207425_1000034 3300025245 Bacteria 227886
63 Ga0207425_1001449 3300025245 Bacteria 9910
64 Ga0209129_1000094 3300025258 Bacteria 172051
65 Ga0209129_1000608 3300025258 Bacteria 24205
66 Ga0209129_1000666 3300025258 Bacteria 22807
67 Ga0209129_1001174 3300025258 Bacteria 15079
68 Ga0209129_1001392 3300025258 Bacteria 13522
69 Ga0209129_1011148 3300025258 Bacteria 2171
70 Ga0209233_1000134 3300025261 Bacteria 202535
71 Ga0209565_1030391 3300025263 Bacteria 1055
72 Ga0209455_1022240 3300025272 Bacteria 1212
73 Ga0209673_1000158 3300025273 Bacteria 143067
74 Ga0209673_1000283 3300025273 Bacteria 94995
75 Ga0209673_1001657 3300025273 Bacteria 19214
76 Ga0209673_1004624 3300025273 Bacteria 7285
77 Ga0209673_1015004 3300025273 Bacteria 2968
78 Ga0209673_1102937 3300025273 Bacteria 611
79 Ga0209130_1000009 3300025284 Bacteria 498952
80 Ga0209130_1008375 3300025284 Bacteria 3061
81 Ga0209025_1000184 3300025294 Bacteria 155611
82 Ga0209025_1003126 3300025294 Bacteria 16197
83 Ga0209025_1007178 3300025294 Bacteria 8409
84 Ga0209025_1017517 3300025294 Bacteria 4127
85 Ga0209025_1041711 3300025294 Bacteria 1961
86 Ga0209025_1042917 3300025294 Bacteria 1914
87 Ga0209025_1050690 3300025294 Bacteria 1657
88 Ga0209564_1000381 3300025295 Bacteria 81150
89 Ga0209564_1003332 3300025295 Bacteria 11155
90 Ga0209564_1008671 3300025295 Bacteria 4971
91 Ga0209564_1050022 3300025295 Bacteria 1027
92 Ga0209758_1000159 3300025297 Bacteria 155588
93 Ga0209758_1002370 3300025297 Bacteria 19396
94 Ga0209758_1003084 3300025297 Bacteria 15820
95 Ga0209758_1003637 3300025297 Bacteria 13766
96 Ga0209758_1003681 3300025297 Bacteria 13630
97 Ga0209758_1022738 3300025297 Bacteria 2861
98 Ga0209256_1000440 3300025299 Bacteria 63735
99 Ga0209256_1006827 3300025299 Bacteria 5880
100 Ga0209256_1007538 3300025299 Bacteria 5326
101 Ga0209256_1015735 3300025299 Bacteria 2627
102 Ga0207426_1000041 3300025302 Bacteria 433536
103 Ga0207426_1000884 3300025302 Bacteria 30977
104 Ga0209051_1001788 3300025303 Bacteria 17065
105 Ga0209051_1014991 3300025303 Bacteria 3590
106 Ga0209051_1067419 3300025303 Bacteria 1094
107 Ga0209051_1071747 3300025303 Bacteria 1039
108 Ga0209257_1021874 3300025304 Bacteria 2303
109 Ga0207647_10484983 3300025904 Bacteria 690
110 Ga0207707_10000001 3300025912 Bacteria 1212482
111 Ga0207660_10000799 3300025917 Bacteria 20831
112 Ga0207652_10001218 3300025921 Bacteria 23056
113 Ga0207681_10031254 3300025923 Bacteria 3477
114 Ga0207687_10040542 3300025927 Bacteria 3192
115 Ga0207644_10043441 3300025931 Bacteria 3189
116 Ga0207706_10488306 3300025933 Bacteria 1064
117 Ga0207668_10027706 3300025972 Bacteria 3694
118 Ga0207678_10053991 3300026067 Bacteria 3461
119 Ga0207683_10560026 3300026121 Bacteria 1057
120 Ga0209813_10180797 3300027866 Bacteria 771
121 Ga0268266_10111888 3300028379 Bacteria 2420
122 Ga0268265_10411744 3300028380 Bacteria 1253
123 Ga0265318_10048345 3300028577 Bacteria 1602
124 Ga0265320_10024024 3300031240 Bacteria 3233
125 Ga0265331_10113872 3300031250 Bacteria 1239
126 Ga0265313_10003876 3300031595 Bacteria 11789
127 Ga0265314_10012546 3300031711 Bacteria 6906
128 Ga0307405_10053655 3300031731 Bacteria 2512
129 Ga0307406_10004003 3300031901 Bacteria 8013
130 Ga0307412_10005208 3300031911 Bacteria 7290
131 Ga0307412_10641152 3300031911 Bacteria 905
132 Ga0439436_0093731 3300041404 Bacteria 836
133 Ga0439466_0035629 3300041411 Bacteria 1683
134 Ga0439465_0009333 3300041413 Bacteria 3091
135 Ga0439465_0011565 3300041413 Bacteria 2769
136 Ga0439465_0028414 3300041413 Bacteria 1773
137 Ga0451793_0540921 3300041452 Bacteria 519
138 Ga0451839_0883655 3300041496 Bacteria 1020
139 Ga0451841_0778238 3300041498 Bacteria 1704
140 Ga0451847_0211998 3300041503 Bacteria 2233
141 Ga0451849_0445165 3300041505 Bacteria 1234
142 Ga0451855_1196708 3300041511 Bacteria 898
143 Ga0451855_1558172 3300041511 Bacteria 1211
144 Ga0439431_0071717 3300041997 Bacteria 924
145 Ga0439432_049298 3300042006 Bacteria 1317
146 Ga0439449_0016313 3300042007 Bacteria 2792
147 Ga0450906_041101 3300042145 Bacteria 816
148 Ga0439434_0128614 3300042435 Bacteria 830
149 Ga0495617_052535 3300046452 Bacteria 1354
150 Ga0495617_118728 3300046452 Bacteria 852
151 Ga0495627_071053 3300046453 Bacteria 1017
152 Ga0495592_0154883 3300046454 Bacteria 1582
153 Ga0495603_0465975 3300046455 Bacteria 724
154 Ga0495590_0087315 3300046457 Bacteria 1102
155 Ga0495591_066852 3300046458 Bacteria 942
156 Ga0495629_0456743 3300046459 Bacteria 864
157 Ga0495638_0000978 3300046460 Bacteria 28781
158 Ga0495651_0324076 3300046462 Bacteria 1026
159 Ga0495653_0507335 3300046463 Bacteria 751
160 Ga0495653_0540996 3300046463 Bacteria 722
161 Ga0495650_0052100 3300046471 Bacteria 1682
162 Ga0495650_0070474 3300046471 Bacteria 1373
163 Ga0495605_0005182 3300046474 Bacteria 7593
164 Ga0495605_0056265 3300046474 Bacteria 1898
165 Ga0495639_0162332 3300046475 Bacteria 1082
166 Ga0495662_0010665 3300046476 Bacteria 4495
167 Ga0495664_0436067 3300046477 Bacteria 785
168 Ga0495585_0002615 3300046492 Bacteria 12702
169 Ga0495585_0042592 3300046492 Bacteria 2542
170 Ga0495585_0260617 3300046492 Bacteria 862
171 Ga0495585_0563797 3300046492 Bacteria 537
172 Ga0495596_0272216 3300046500 Bacteria 658
173 Ga0495596_0399009 3300046500 Bacteria 536
174 Ga0495607_0048065 3300046501 Bacteria 2496
175 Ga0495607_0091605 3300046501 Bacteria 1646
176 Ga0495607_0106991 3300046501 Bacteria 1488
177 Ga0495583_0003310 3300046506 Bacteria 12484
178 Ga0495583_0013561 3300046506 Bacteria 4539
179 Ga0495583_0335775 3300046506 Bacteria 597
180 Ga0495606_0033669 3300046507 Bacteria 3531
181 Ga0495606_0105801 3300046507 Bacteria 1705
182 Ga0495606_0204418 3300046507 Bacteria 1123
183 Ga0495610_0021404 3300046512 Bacteria 3557
184 Ga0495610_0048758 3300046512 Bacteria 2077
185 Ga0495610_0078688 3300046512 Bacteria 1519
186 Ga0495610_0126529 3300046512 Bacteria 1114
187 Ga0495616_0015461 3300046513 Bacteria 4246
188 Ga0495618_0347883 3300046514 Bacteria 914
189 Ga0495620_0026229 3300046515 Bacteria 2742
190 Ga0495620_0031662 3300046515 Bacteria 2421
191 Ga0495620_0080628 3300046515 Bacteria 1317
192 Ga0495620_0118810 3300046515 Bacteria 1043
193 Ga0495631_0001352 3300046518 Bacteria 14999
194 Ga0495631_0056076 3300046518 Bacteria 1716
195 Ga0495631_0119134 3300046518 Bacteria 1135
196 Ga0495631_0164039 3300046518 Bacteria 953
197 Ga0495632_0005356 3300046519 Bacteria 8497
198 Ga0495632_0014024 3300046519 Bacteria 4549
199 Ga0495632_0032823 3300046519 Bacteria 2671
200 Ga0495632_0117622 3300046519 Bacteria 1244
201 Ga0495637_0173594 3300046520 Bacteria 803
202 Ga0495643_0023047 3300046522 Bacteria 3543
203 Ga0495643_0105461 3300046522 Bacteria 1439
204 Ga0495644_0227971 3300046523 Bacteria 721
205 Ga0495648_0080295 3300046524 Bacteria 1859
206 Ga0495652_0546304 3300046529 Bacteria 797
207 Ga0495654_0094077 3300046530 Bacteria 1387
208 Ga0495654_0113895 3300046530 Bacteria 1231
209 Ga0495654_0120008 3300046530 Bacteria 1191
210 Ga0495587_0261290 3300046536 Bacteria 972
211 Ga0495609_0040002 3300046538 Bacteria 2110
212 Ga0495622_0102253 3300046557 Bacteria 1313
213 Ga0495633_0017212 3300046558 Bacteria 3704
214 Ga0495633_0050913 3300046558 Bacteria 1952
215 Ga0495668_0087951 3300046616 Bacteria 1703
216 Ga0495668_0498079 3300046616 Bacteria 671
217 Ga0495611_0006470 3300046648 Bacteria 4991
218 Ga0495611_0081567 3300046648 Bacteria 1488
219 Ga0495611_0236004 3300046648 Bacteria 849
220 Ga0495625_0003537 3300046660 Bacteria 15460
221 Ga0495625_0018053 3300046660 Bacteria 5513
222 Ga0495625_0065577 3300046660 Bacteria 2559
223 Ga0495625_0143541 3300046660 Bacteria 1609
224 Ga0495625_0226925 3300046660 Bacteria 1221
225 Ga0495625_0361278 3300046660 Bacteria 915
226 Ga0495625_0392804 3300046660 Bacteria 868
227 Ga0495635_0596289 3300046663 Bacteria 722
228 Ga0495661_0068374 3300046665 Bacteria 2084
229 Ga0495588_0082886 3300046674 Bacteria 1675
230 Ga0495588_0361618 3300046674 Bacteria 762
231 Ga0495588_0405392 3300046674 Bacteria 716
232 Ga0495646_0463046 3300046680 Unclassified 654
233 Ga0495658_0270703 3300046683 Bacteria 1071
234 Ga0495613_0159806 3300046689 Bacteria 1604
235 Ga0495624_0480595 3300046690 Bacteria 744
236 Ga0495670_0034506 3300046691 Bacteria 2520
237 Ga0495670_0071458 3300046691 Bacteria 1757
238 Ga0495670_0088612 3300046691 Bacteria 1582
239 Ga0495670_0404785 3300046691 Bacteria 737
240 Ga0495671_0470286 3300046692 Bacteria 600
241 Ga0495649_0089151 3300046694 Bacteria 1645
242 Ga0495649_0621524 3300046694 Bacteria 532
243 Ga0495600_0122739 3300046809 Bacteria 1689
244 Ga0495660_0046928 3300046810 Bacteria 2367
245 Ga0495604_0076923 3300047317 Bacteria 2509
246 Ga0495636_0011950 3300047318 Bacteria 3440
247 Ga0495636_0032155 3300047318 Bacteria 2152
248 Ga0495672_0052903 3300047320 Bacteria 2383
249 Ga0495683_0046681 3300047323 Bacteria 2174
250 Ga0495683_0111105 3300047323 Bacteria 1308
251 Ga0495687_035257 3300047443 Bacteria 2251
252 Ga0495687_043728 3300047443 Bacteria 1950
253 Ga0495687_091624 3300047443 Bacteria 1162
254 Ga0495685_165257 3300047447 Bacteria 716
255 Ga0495681_0058908 3300047470 Bacteria 1778
256 Ga0495681_0125468 3300047470 Bacteria 1097
257 Ga0495681_0235679 3300047470 Bacteria 728
258 Ga0495686_0030552 3300047472 Bacteria 3498
259 Ga0495686_0128776 3300047472 Bacteria 1502
260 Ga0495686_0614138 3300047472 Bacteria 562
261 Ga0495615_0206344 3300048090 Bacteria 608
262 Ga0496101_0081205 3300048904 Bacteria 2397
263 Ga0496102_0307571 3300048905 Bacteria 1494
264 Ga0496102_0333953 3300048905 Bacteria 1427
265 Ga0496103_0212714 3300048906 Bacteria 1243
266 Ga0496104_1432731 3300048907 Bacteria 594
267 Ga0496106_0008801 3300048909 Bacteria 7459
268 Ga0496106_0201101 3300048909 Bacteria 1586
269 Ga0496111_0148392 3300048914 Bacteria 1739
270 Ga0496113_0352585 3300048916 Bacteria 1180
271 Ga0496113_1217922 3300048916 Bacteria 587
272 Ga0496116_0013189 3300048919 Bacteria 6685
273 Ga0496116_0042664 3300048919 Bacteria 3098
274 Ga0496116_0098920 3300048919 Bacteria 1748
275 Ga0496116_0103211 3300048919 Bacteria 1697
276 Ga0496116_0128039 3300048919 Bacteria 1453
277 Ga0496116_0187874 3300048919 Bacteria 1097
278 Ga0496116_0243654 3300048919 Bacteria 901
279 Ga0496117_0018264 3300048920 Bacteria 5819
280 Ga0496117_0035248 3300048920 Bacteria 3758
281 Ga0496117_0058971 3300048920 Bacteria 2655
282 Ga0496117_0164761 3300048920 Bacteria 1294
283 Ga0496117_0315049 3300048920 Bacteria 822
284 Ga0496118_0029488 3300048921 Bacteria 4599
285 Ga0496118_0032633 3300048921 Bacteria 4284
286 Ga0496118_0040575 3300048921 Bacteria 3699
287 Ga0496118_0126826 3300048921 Bacteria 1649
288 Ga0496118_0143359 3300048921 Bacteria 1509
289 Ga0496119_0050772 3300048922 Bacteria 2553
290 Ga0496119_0254476 3300048922 Bacteria 884
291 Ga0496121_0017843 3300048924 Bacteria 7207
292 Ga0496121_0041256 3300048924 Bacteria 4036
293 Ga0496121_0051710 3300048924 Bacteria 3457
294 Ga0496121_0081432 3300048924 Bacteria 2562
295 Ga0496121_0110014 3300048924 Bacteria 2103
296 Ga0496121_0149128 3300048924 Bacteria 1724
297 Ga0496121_0178455 3300048924 Bacteria 1535
298 Ga0496121_0185515 3300048924 Bacteria 1496
299 Ga0496121_0252302 3300048924 Bacteria 1223
300 Ga0496121_0380626 3300048924 Bacteria 931
301 Ga0496122_0013200 3300048925 Bacteria 8108
302 Ga0496122_0018541 3300048925 Bacteria 6421
303 Ga0496122_0045996 3300048925 Bacteria 3385
304 Ga0496122_0052396 3300048925 Bacteria 3089
305 Ga0496122_0053444 3300048925 Bacteria 3045
306 Ga0496122_0069960 3300048925 Bacteria 2510
307 Ga0496122_0083808 3300048925 Bacteria 2208
308 Ga0496123_0008958 3300048926 Bacteria 9096
309 Ga0496123_0027036 3300048926 Bacteria 4282
310 Ga0496123_0121455 3300048926 Bacteria 1468
311 Ga0496123_0127351 3300048926 Bacteria 1418
312 Ga0496124_0010128 3300048927 Bacteria 9597
313 Ga0496124_0059174 3300048927 Bacteria 3219
314 Ga0496124_0078985 3300048927 Bacteria 2710
315 Ga0496124_0204586 3300048927 Bacteria 1498
316 Ga0496124_0227942 3300048927 Bacteria 1395
317 Ga0496124_0283452 3300048927 Bacteria 1206
318 Ga0496124_0313678 3300048927 Bacteria 1126
319 Ga0496125_0005193 3300048928 Bacteria 14622
320 Ga0496125_0021105 3300048928 Bacteria 6087
321 Ga0496125_0061256 3300048928 Bacteria 3019
322 Ga0496125_0301926 3300048928 Bacteria 980
323 Ga0496125_0354932 3300048928 Bacteria 874
324 Ga0496125_0527361 3300048928 Bacteria 659
325 Ga0496126_0182747 3300048929 Bacteria 1780
326 Ga0496126_0195899 3300048929 Bacteria 1709
327 Ga0496126_0272137 3300048929 Bacteria 1405
328 Ga0495678_006569 3300049459 Bacteria 6167
329 Ga0495678_025882 3300049459 Bacteria 2513
330 Ga0495678_107404 3300049459 Bacteria 957
331 Ga0501032_0304613 3300049569 Bacteria 1030
332 Ga0501032_0337094 3300049569 Bacteria 972
333 Ga0501033_0069869 3300049570 Bacteria 2580
334 Ga0501033_0123898 3300049570 Bacteria 1874
335 Ga0501033_0359243 3300049570 Bacteria 1019
336 Ga0501034_0071788 3300049571 Bacteria 3471
337 Ga0501034_0370720 3300049571 Bacteria 1358
338 Ga0501034_0588308 3300049571 Bacteria 1019
339 Ga0501036_0235185 3300049572 Bacteria 1537
340 Ga0501037_0270950 3300049573 Bacteria 1185
341 Ga0501037_0338726 3300049573 Bacteria 1039
342 Ga0501043_0032212 3300049579 Bacteria 4121
343 Ga0501043_0080472 3300049579 Bacteria 2560
344 Ga0501043_0734399 3300049579 Bacteria 719
345 Ga0501043_1041461 3300049579 Bacteria 581
346 Ga0501046_0004556 3300049580 Bacteria 12551
347 Ga0501046_0329956 3300049580 Bacteria 1110
348 Ga0501047_0038410 3300049581 Bacteria 4632
349 Ga0501047_0946025 3300049581 Bacteria 675
350 Ga0501048_0421275 3300049582 Bacteria 955
351 Ga0501067_0187322 3300049583 Bacteria 1152
352 Ga0501068_0323701 3300049584 Bacteria 988
353 Ga0501073_0623894 3300049589 Bacteria 744
354 Ga0501080_0031594 3300049742 Bacteria 4934
355 Ga0501083_0040428 3300049744 Unclassified 3165
356 Ga0501035_0035452 3300049822 Bacteria 4528
357 Ga0501035_0295975 3300049822 Bacteria 1365
358 Ga0501044_0043291 3300049823 Bacteria 4678
359 Ga0501044_0071294 3300049823 Bacteria 3533
360 nmdc:mga06z11_119652_c1 3300050494 Bacteria 1468
361 nmdc:mga07m45_212182_c1 3300050496 Bacteria 1126
362 nmdc:mga0sz30_2503_c1 3300050516 Bacteria 6550
363 Ga0495601_0517683 3300053077 Bacteria 769
364 Ga0500578_0041900 3300053086 Bacteria 2940
365 Ga0500578_0310960 3300053086 Bacteria 931
366 Ga0500566_0393150 3300053094 Bacteria 623
367 Ga0500650_0208010 3300053098 Bacteria 889
368 Ga0500594_0029947 3300053118 Bacteria 1426
369 Ga0500595_022499 3300053119 Bacteria 2230
370 Ga0500658_0000307 3300053134 Bacteria 21913
371 Ga0500658_0029854 3300053134 Bacteria 2123
372 Ga0500568_0000803 3300053139 Bacteria 22116
373 Ga0500568_0020181 3300053139 Bacteria 2886
374 Ga0500573_0008514 3300053140 Bacteria 5652
375 Ga0500577_0187972 3300053142 Bacteria 888
376 Ga0500577_0317814 3300053142 Bacteria 680
377 Ga0500590_003834 3300053148 Bacteria 7006
378 Ga0500604_0012915 3300053151 Bacteria 2260
379 Ga0500606_100109 3300053152 Bacteria 978
380 Ga0500616_0001222 3300053153 Bacteria 25849
381 Ga0500616_0359172 3300053153 Bacteria 590
382 Ga0500622_0016825 3300053156 Bacteria 3902
383 Ga0500627_0054945 3300053158 Bacteria 1742
384 Ga0500627_0340087 3300053158 Bacteria 649
385 Ga0500633_0048089 3300053160 Bacteria 1461
386 Ga0500633_0091482 3300053160 Bacteria 1112
387 Ga0500596_024307 3300053735 Bacteria 921
388 Ga0587072_101299 3300059643 Bacteria 647
389 Ga0501082_0047807 3300060353 Bacteria 3687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028577 Ga0265318_10048345 Ga0265318_100483453 129
2 3300031240 Ga0265320_10024024 Ga0265320_100240244 129
3 3300031250 Ga0265331_10113872 Ga0265331_101138722 129
4 3300031595 Ga0265313_10003876 Ga0265313_1000387614 129
5 3300031711 Ga0265314_10012546 Ga0265314_100125464 129
6 3300046492 Ga0495585_0563797 Ga0495585_0563797_135_524 129
7 3300048090 Ga0495615_0206344 Ga0495615_0206344_199_588 129
8 3300050494 nmdc:mga06z11_119652_c1 nmdc:mga06z11_119652_c1_30_419 129
9 3300009098 Ga0105245_10010260 Ga0105245_100102609 130
10 3300025927 Ga0207687_10040542 Ga0207687_100405421 130
11 3300053077 Ga0495601_0517683 Ga0495601_0517683_11_403 130
12 3300013297 Ga0157378_10707855 Ga0157378_107078551 131
13 3300046454 Ga0495592_0154883 Ga0495592_0154883_546_947 131
14 3300046463 Ga0495653_0507335 Ga0495653_0507335_141_542 131
15 3300046529 Ga0495652_0546304 Ga0495652_0546304_117_518 131
16 3300053119 Ga0500595_022499 Ga0500595_022499_386_799 131
17 3300053735 Ga0500596_024307 Ga0500596_024307_416_817 131
18 3300013104 Ga0157370_11041193 Ga0157370_110411931 132
19 3300046680 Ga0495646_0463046 Ga0495646_0463046_84_494 132
20 3300049569 Ga0501032_0304613 Ga0501032_0304613_81_500 132
21 3300049569 Ga0501032_0337094 Ga0501032_0337094_53_463 132
22 3300049570 Ga0501033_0069869 Ga0501033_0069869_438_848 132
23 3300049570 Ga0501033_0123898 Ga0501033_0123898_286_696 132
24 3300049570 Ga0501033_0359243 Ga0501033_0359243_303_713 132
25 3300049572 Ga0501036_0235185 Ga0501036_0235185_990_1400 132
26 3300049573 Ga0501037_0270950 Ga0501037_0270950_271_681 132
27 3300049573 Ga0501037_0338726 Ga0501037_0338726_85_504 132
28 3300049579 Ga0501043_0080472 Ga0501043_0080472_1758_2168 132
29 3300049579 Ga0501043_0734399 Ga0501043_0734399_180_590 132
30 3300049579 Ga0501043_1041461 Ga0501043_1041461_22_432 132
31 3300049580 Ga0501046_0004556 Ga0501046_0004556_9811_10221 132
32 3300049581 Ga0501047_0038410 Ga0501047_0038410_1305_1715 132
33 3300049581 Ga0501047_0946025 Ga0501047_0946025_20_430 132
34 3300049582 Ga0501048_0421275 Ga0501048_0421275_421_831 132
35 3300049742 Ga0501080_0031594 Ga0501080_0031594_1710_2120 132
36 3300049822 Ga0501035_0035452 Ga0501035_0035452_1195_1605 132
37 3300049822 Ga0501035_0295975 Ga0501035_0295975_328_738 132
38 3300049823 Ga0501044_0043291 Ga0501044_0043291_570_980 132
39 3300049823 Ga0501044_0071294 Ga0501044_0071294_10_420 132
40 3300021384 Ga0213876_10009966 Ga0213876_100099664 134
41 3300049744 Ga0501083_0040428 Ga0501083_0040428_257_667 134
42 3300005336 Ga0070680_100000923 Ga0070680_1000009238 135
43 3300005458 Ga0070681_10000001 Ga0070681_10000001958 135
44 3300005530 Ga0070679_100000619 Ga0070679_10000061925 135
45 3300025912 Ga0207707_10000001 Ga0207707_10000001637 135
46 3300025917 Ga0207660_10000799 Ga0207660_100007998 135
47 3300025921 Ga0207652_10001218 Ga0207652_1000121820 135
48 iso_pu_bacteria 2643221643 2644240692 135
49 iso_pu_bacteria 2842110456 2842116243 135
50 iso_pu_bacteria 2857516855 2857521178 135
51 iso_pu_bacteria 2933586486 2933592461 135
52 3300026121 Ga0207683_10560026 Ga0207683_105600262 136
53 3300049571 Ga0501034_0588308 Ga0501034_0588308_96_533 136
54 iso_pu_bacteria 2509276033 2509445995 136
55 iso_pu_bacteria 2510065019 2510135067 136
56 iso_pu_bacteria 2510461076 2510896493 136
57 iso_pu_bacteria 2510917028 2511182251 136
58 iso_pu_bacteria 2513237084 2513571438 136
59 iso_pu_bacteria 2513237085 2513580718 136
60 iso_pu_bacteria 2513237088 2513599670 136
61 iso_pu_bacteria 2513237093 2513630397 136
62 iso_pu_bacteria 2513237103 2513713742 136
63 iso_pu_bacteria 2513237138 2513868441 136
64 iso_pu_bacteria 2513237144 2513912997 136
65 iso_pu_bacteria 2513237146 2513929162 136
66 iso_pu_bacteria 2515075009 2515114156 136
67 iso_pu_bacteria 2515154114 2515646466 136
68 iso_pu_bacteria 2515154116 2515660577 136
69 iso_pu_bacteria 2515154134 2515741387 136
70 iso_pu_bacteria 2516653085 2517078106 136
71 iso_pu_bacteria 2517287029 2517408712 136
72 iso_pu_bacteria 2519899620 2520376339 136
73 iso_pu_bacteria 2534681796 2535518806 136
74 iso_pu_bacteria 2582581294 2585201884 136
75 iso_pu_bacteria 2582581299 2585228841 136
76 iso_pu_bacteria 2582581867 2585403655 136
77 iso_pu_bacteria 2585427526 2585526247 136
78 iso_pu_bacteria 2585427590 2585824151 136
79 iso_pu_bacteria 2599185170 2599420341 136
80 iso_pu_bacteria 2643221599 2644002368 136
81 iso_pu_bacteria 2643221634 2644194029 136
82 iso_pu_bacteria 2718217882 2719182811 136
83 iso_pu_bacteria 2718218009 2719733528 136
84 iso_pu_bacteria 2718218232 2720615025 136
85 iso_pu_bacteria 2718218233 2720621797 136
86 iso_pu_bacteria 2718218235 2720633132 136
87 iso_pu_bacteria 2718218269 2720776851 136
88 iso_pu_bacteria 2718218363 2721148923 136
89 iso_pu_bacteria 2718218365 2721160321 136
90 iso_pu_bacteria 2718218366 2721165736 136
91 iso_pu_bacteria 2721755514 2722841906 136
92 iso_pu_bacteria 2721755556 2723028440 136
93 iso_pu_bacteria 2721755684 2723562066 136
94 iso_pu_bacteria 2721755685 2723568699 136
95 iso_pu_bacteria 2721755810 2724046284 136
96 iso_pu_bacteria 2721755819 2724091458 136
97 iso_pu_bacteria 2721755822 2724105964 136
98 iso_pu_bacteria 2724679232 2725947318 136
99 iso_pu_bacteria 2728369352 2730109376 136
100 iso_pu_bacteria 2728369365 2730166046 136
101 iso_pu_bacteria 2728369397 2730299953 136
102 iso_pu_bacteria 2791355256 2793299366 136
103 iso_pu_bacteria 2791355259 2793313602 136
104 iso_pu_bacteria 2791355261 2793331089 136
105 iso_pu_bacteria 2791355262 2793332073 136
106 iso_pu_bacteria 2791355263 2793338639 136
107 iso_pu_bacteria 2791355264 2793346448 136
108 iso_pu_bacteria 2791355265 2793354033 136
109 iso_pu_bacteria 2791355266 2793359552 136
110 iso_pu_bacteria 2802429605 2805926053 136
111 iso_pu_bacteria 2802429606 2805937002 136
112 iso_pu_bacteria 2838016132 2838021929 136
113 iso_pu_bacteria 2838035591 2838040549 136
114 iso_pu_bacteria 2838042994 2838048189 136
115 iso_pu_bacteria 2838048938 2838053653 136
116 iso_pu_bacteria 2838068647 2838073867 136
117 iso_pu_bacteria 2838661181 2838668452 136
118 iso_pu_bacteria 2838668709 2838672979 136
119 iso_pu_bacteria 2838680041 2838684052 136
120 iso_pu_bacteria 2838686498 2838690007 136
121 iso_pu_bacteria 2838694306 2838698581 136
122 iso_pu_bacteria 2838701080 2838705543 136
123 iso_pu_bacteria 2838707686 2838711696 136
124 iso_pu_bacteria 2838729681 2838731847 136
125 iso_pu_bacteria 2838742623 2838744743 136
126 iso_pu_bacteria 2841851746 2841857950 136
127 iso_pu_bacteria 2842077413 2842081497 136
128 iso_pu_bacteria 2842118031 2842121726 136
129 iso_pu_bacteria 2842146304 2842149873 136
130 iso_pu_bacteria 2842156927 2842160970 136
131 iso_pu_bacteria 2842163707 2842166488 136
132 iso_pu_bacteria 2842180545 2842184586 136
133 iso_pu_bacteria 2842192696 2842195063 136
134 iso_pu_bacteria 2842205361 2842207245 136
135 iso_pu_bacteria 2842217011 2842223946 136
136 iso_pu_bacteria 2842229732 2842232169 136
137 iso_pu_bacteria 2842237096 2842240741 136
138 iso_pu_bacteria 2842243621 2842246584 136
139 iso_pu_bacteria 2842250916 2842255223 136
140 iso_pu_bacteria 2842257432 2842261314 136
141 iso_pu_bacteria 2842264693 2842269074 136
142 iso_pu_bacteria 2842271015 2842274027 136
143 iso_pu_bacteria 2842278818 2842281044 136
144 iso_pu_bacteria 2842285085 2842288343 136
145 iso_pu_bacteria 2842291075 2842295154 136
146 iso_pu_bacteria 2842304105 2842306049 136
147 iso_pu_bacteria 2842311132 2842311194 136
148 iso_pu_bacteria 2842317721 2842320946 136
149 iso_pu_bacteria 2842370503 2842374828 136
150 iso_pu_bacteria 2842377471 2842381553 136
151 iso_pu_bacteria 2842384541 2842388623 136
152 iso_pu_bacteria 2842402390 2842406311 136
153 iso_pu_bacteria 2842409023 2842412896 136
154 iso_pu_bacteria 2842415677 2842419225 136
155 iso_pu_bacteria 2842422224 2842427794 136
156 iso_pu_bacteria 2842428310 2842433233 136
157 iso_pu_bacteria 2842434925 2842439659 136
158 iso_pu_bacteria 2842441272 2842446262 136
159 iso_pu_bacteria 2842447887 2842448942 136
160 iso_pu_bacteria 2842462802 2842467457 136
161 iso_pu_bacteria 2842469257 2842474030 136
162 iso_pu_bacteria 2842495871 2842498336 136
163 iso_pu_bacteria 2844454524 2844457230 136
164 iso_pu_bacteria 2923556063 2923562361 136
165 iso_pu_bacteria 2933016740 2933022849 136
166 iso_pu_bacteria 2933570622 2933572552 136
167 iso_pu_bacteria 2933599457 2933604312 136
168 iso_pu_bacteria 2935894831 2935897770 136
169 iso_pu_bacteria 2935901341 2935903839 136
170 iso_pu_bacteria 2936367885 2936369705 136
171 iso_pu_bacteria 2936375103 2936379493 136
172 iso_pu_bacteria 2936381700 2936385886 136
173 iso_pu_bacteria 2996887358 2996890730 136
174 iso_pu_bacteria 2996893221 2996896016 136
175 iso_pu_bacteria 3005409236 3005409490 136
176 iso_pu_bacteria 3005452660 3005455840 136
177 iso_pu_bacteria 639633055 639650225 136
178 iso_pu_bacteria 8005258706 8005262073 136
179 iso_pu_bacteria 8005282627 8005286137 136
180 iso_pu_bacteria 8005289223 8005292076 136
181 iso_pu_bacteria 8005307578 8005313494 136
182 iso_pu_bacteria 8005321885 8005325257 136
183 iso_pu_bacteria 8005376324 8005381750 136
184 iso_pu_bacteria 8005382845 8005387934 136
185 iso_pu_bacteria 8005395548 8005400972 136
186 iso_pu_bacteria 8005460587 8005464846 136
187 iso_pu_bacteria 8005497431 8005497497 136
188 iso_pu_bacteria 8005542996 8005546516 136
189 iso_pu_bacteria 8005556819 8005560952 136
190 iso_pu_bacteria 8005563573 8005565577 136
191 iso_pu_bacteria 8005619151 8005623241 136
192 iso_pu_bacteria 8005626139 8005628788 136
193 iso_pu_bacteria 8005668836 8005668902 136
194 iso_pu_bacteria 8018150411 8018154528 136
195 iso_pu_bacteria 8018163183 8018165312 136
196 iso_pu_bacteria 8018176218 8018178263 136
197 iso_pu_bacteria 8023680758 8023686332 136
198 iso_pu_bacteria 8024479707 8024484184 136
199 iso_pu_bacteria 8024501048 8024502490 136
200 iso_pu_bacteria 8056382006 8056383972 136
201 iso_pu_bacteria 8057874678 8057879776 136
202 iso_pu_bacteria 2510917022 2511133789 137
203 iso_pu_bacteria 2515154113 2515636316 137
204 iso_pu_bacteria 2582581307 2585271509 137
205 iso_pu_bacteria 2585427531 2585563251 137
206 iso_pu_bacteria 2585427594 2585844795 137
207 iso_pu_bacteria 2585427608 2585902698 137
208 iso_pu_bacteria 2585427609 2585907469 137
209 iso_pu_bacteria 2585428125 2587982537 137
210 iso_pu_bacteria 2667528174 2671113624 137
211 iso_pu_bacteria 2718217997 2719667147 137
212 iso_pu_bacteria 2718218199 2720493567 137
213 iso_pu_bacteria 2721755823 2724111788 137
214 iso_pu_bacteria 2738541293 2738805348 137
215 iso_pu_bacteria 2838029111 2838030786 137
216 iso_pu_bacteria 2838061910 2838067614 137
217 iso_pu_bacteria 2842475841 2842477518 137
218 iso_pu_bacteria 2842502639 2842504609 137
219 iso_pu_bacteria 2919408235 2919410917 137
220 iso_pu_bacteria 8005430974 8005433749 137
221 iso_pu_bacteria 8005484373 8005490149 137
222 iso_pu_bacteria 2738541317 2738947500 138
223 iso_pu_bacteria 2913308742 2913312407 138
224 3300048924 Ga0496121_0149128 Ga0496121_0149128_41_460 139
225 3300048925 Ga0496122_0018541 Ga0496122_0018541_1795_2229 139
226 3300048927 Ga0496124_0313678 Ga0496124_0313678_442_861 139
227 3300049571 Ga0501034_0071788 Ga0501034_0071788_213_662 139
228 3300053140 Ga0500573_0008514 Ga0500573_0008514_1108_1527 139
229 3300002739 JGI25158J39367_1000028 JGI25158J39367_100002837 140
230 3300002773 JGI25152J39213_1004277 JGI25152J39213_10042776 140
231 3300002773 JGI25152J39213_1015032 JGI25152J39213_10150322 140
232 3300002774 JGI25150J39212_1000166 JGI25150J39212_10001668 140
233 3300002774 JGI25150J39212_1004290 JGI25150J39212_10042904 140
234 3300002987 JGI25159J45721_1004013 JGI25159J45721_10040134 140
235 3300003187 JGI25151J46595_10000081 JGI25151J46595_10000081122 140
236 3300003215 JGI25153J46596_10002857 JGI25153J46596_1000285710 140
237 3300003215 JGI25153J46596_10003148 JGI25153J46596_100031486 140
238 3300003215 JGI25153J46596_10037405 JGI25153J46596_100374052 140
239 3300003354 JGI25160J50197_1003057 JGI25160J50197_10030577 140
240 3300003354 JGI25160J50197_1013415 JGI25160J50197_10134153 140
241 3300003374 JGI25161J50226_1000155 JGI25161J50226_100015546 140
242 3300003578 Ga0006562J51391_1034136 Ga0006562J51391_10341362 140
243 3300003771 Ga0055526_1000804 Ga0055526_10008043 140
244 3300003771 Ga0055526_1003345 Ga0055526_10033453 140
245 3300003775 Ga0055524_1008951 Ga0055524_10089514 140
246 3300003775 Ga0055524_1017966 Ga0055524_10179663 140
247 3300003775 Ga0055524_1032923 Ga0055524_10329232 140
248 3300003790 Ga0055528_1001359 Ga0055528_10013593 140
249 3300003790 Ga0055528_1002326 Ga0055528_100232610 140
250 3300003790 Ga0055528_1002725 Ga0055528_10027258 140
251 3300003790 Ga0055528_1009993 Ga0055528_10099934 140
252 3300003792 Ga0055540_1004866 Ga0055540_10048664 140
253 3300003792 Ga0055540_1011606 Ga0055540_10116064 140
254 3300004625 Ga0055543_1000423 Ga0055543_100042323 140
255 3300005262 Ga0065165_1006427 Ga0065165_10064276 140
256 3300005347 Ga0070668_100009914 Ga0070668_1000099148 140
257 3300005355 Ga0070671_100031536 Ga0070671_1000315365 140
258 3300005455 Ga0070663_100053733 Ga0070663_1000537333 140
259 3300005456 Ga0070678_100863487 Ga0070678_1008634872 140
260 3300005457 Ga0070662_100499972 Ga0070662_1004999722 140
261 3300005548 Ga0070665_100224697 Ga0070665_1002246972 140
262 3300005616 Ga0068852_102366991 Ga0068852_1023669911 140
263 3300006038 Ga0075365_10083254 Ga0075365_100832543 140
264 3300006042 Ga0075368_10061066 Ga0075368_100610663 140
265 3300006178 Ga0075367_10000200 Ga0075367_1000020010 140
266 3300006353 Ga0075370_10307848 Ga0075370_103078482 140
267 3300009148 Ga0105243_12054844 Ga0105243_120548442 140
268 3300009763 Ga0123340_1042979 Ga0123340_10429792 140
269 3300009763 Ga0123340_1064801 Ga0123340_10648012 140
270 3300009765 Ga0123341_1000020 Ga0123341_100002023 140
271 3300009766 Ga0123342_1007072 Ga0123342_100707219 140
272 3300013105 Ga0157369_11211406 Ga0157369_112114061 140
273 3300025208 Ga0209436_100166 Ga0209436_10016617 140
274 3300025245 Ga0207425_1000034 Ga0207425_1000034104 140
275 3300025245 Ga0207425_1001449 Ga0207425_10014492 140
276 3300025258 Ga0209129_1000094 Ga0209129_100009449 140
277 3300025258 Ga0209129_1000608 Ga0209129_100060819 140
278 3300025258 Ga0209129_1000666 Ga0209129_100066619 140
279 3300025258 Ga0209129_1001174 Ga0209129_100117416 140
280 3300025258 Ga0209129_1011148 Ga0209129_10111482 140
281 3300025263 Ga0209565_1030391 Ga0209565_10303912 140
282 3300025273 Ga0209673_1000158 Ga0209673_100015869 140
283 3300025273 Ga0209673_1000283 Ga0209673_100028337 140
284 3300025273 Ga0209673_1001657 Ga0209673_100165715 140
285 3300025273 Ga0209673_1004624 Ga0209673_10046246 140
286 3300025273 Ga0209673_1015004 Ga0209673_10150045 140
287 3300025284 Ga0209130_1000009 Ga0209130_1000009415 140
288 3300025284 Ga0209130_1008375 Ga0209130_10083753 140
289 3300025294 Ga0209025_1000184 Ga0209025_1000184121 140
290 3300025294 Ga0209025_1003126 Ga0209025_100312616 140
291 3300025294 Ga0209025_1007178 Ga0209025_10071782 140
292 3300025294 Ga0209025_1017517 Ga0209025_10175174 140
293 3300025294 Ga0209025_1042917 Ga0209025_10429173 140
294 3300025294 Ga0209025_1050690 Ga0209025_10506902 140
295 3300025295 Ga0209564_1000381 Ga0209564_100038119 140
296 3300025295 Ga0209564_1003332 Ga0209564_100333211 140
297 3300025295 Ga0209564_1008671 Ga0209564_10086714 140
298 3300025295 Ga0209564_1050022 Ga0209564_10500221 140
299 3300025297 Ga0209758_1000159 Ga0209758_1000159121 140
300 3300025297 Ga0209758_1002370 Ga0209758_100237019 140
301 3300025297 Ga0209758_1003084 Ga0209758_100308412 140
302 3300025297 Ga0209758_1003681 Ga0209758_100368114 140
303 3300025297 Ga0209758_1022738 Ga0209758_10227382 140
304 3300025299 Ga0209256_1000440 Ga0209256_100044010 140
305 3300025299 Ga0209256_1006827 Ga0209256_10068274 140
306 3300025299 Ga0209256_1007538 Ga0209256_10075384 140
307 3300025299 Ga0209256_1015735 Ga0209256_10157353 140
308 3300025302 Ga0207426_1000041 Ga0207426_1000041353 140
309 3300025302 Ga0207426_1000884 Ga0207426_100088434 140
310 3300025303 Ga0209051_1001788 Ga0209051_10017885 140
311 3300025303 Ga0209051_1014991 Ga0209051_10149913 140
312 3300025303 Ga0209051_1067419 Ga0209051_10674192 140
313 3300025303 Ga0209051_1071747 Ga0209051_10717472 140
314 3300025304 Ga0209257_1021874 Ga0209257_10218742 140
315 3300025904 Ga0207647_10484983 Ga0207647_104849832 140
316 3300025931 Ga0207644_10043441 Ga0207644_100434415 140
317 3300025933 Ga0207706_10488306 Ga0207706_104883062 140
318 3300025972 Ga0207668_10027706 Ga0207668_100277064 140
319 3300026067 Ga0207678_10053991 Ga0207678_100539912 140
320 3300027866 Ga0209813_10180797 Ga0209813_101807972 140
321 3300028379 Ga0268266_10111888 Ga0268266_101118882 140
322 3300028380 Ga0268265_10411744 Ga0268265_104117442 140
323 3300031731 Ga0307405_10053655 Ga0307405_100536553 140
324 3300031901 Ga0307406_10004003 Ga0307406_100040037 140
325 3300031911 Ga0307412_10005208 Ga0307412_100052085 140
326 3300031911 Ga0307412_10641152 Ga0307412_106411522 140
327 3300041404 Ga0439436_0093731 Ga0439436_0093731_368_790 140
328 3300041411 Ga0439466_0035629 Ga0439466_0035629_792_1214 140
329 3300041413 Ga0439465_0009333 Ga0439465_0009333_832_1254 140
330 3300041413 Ga0439465_0011565 Ga0439465_0011565_343_765 140
331 3300041413 Ga0439465_0028414 Ga0439465_0028414_321_758 140
332 3300041452 Ga0451793_0540921 Ga0451793_0540921_74_496 140
333 3300041496 Ga0451839_0883655 Ga0451839_0883655_234_656 140
334 3300041498 Ga0451841_0778238 Ga0451841_0778238_928_1350 140
335 3300041503 Ga0451847_0211998 Ga0451847_0211998_153_575 140
336 3300041505 Ga0451849_0445165 Ga0451849_0445165_375_797 140
337 3300041511 Ga0451855_1196708 Ga0451855_1196708_314_736 140
338 3300041511 Ga0451855_1558172 Ga0451855_1558172_48_470 140
339 3300041997 Ga0439431_0071717 Ga0439431_0071717_76_498 140
340 3300042006 Ga0439432_049298 Ga0439432_049298_735_1157 140
341 3300042007 Ga0439449_0016313 Ga0439449_0016313_2098_2520 140
342 3300042145 Ga0450906_041101 Ga0450906_041101_300_722 140
343 3300042435 Ga0439434_0128614 Ga0439434_0128614_177_599 140
344 3300046452 Ga0495617_052535 Ga0495617_052535_420_857 140
345 3300046452 Ga0495617_118728 Ga0495617_118728_226_648 140
346 3300046453 Ga0495627_071053 Ga0495627_071053_212_649 140
347 3300046455 Ga0495603_0465975 Ga0495603_0465975_203_625 140
348 3300046457 Ga0495590_0087315 Ga0495590_0087315_398_835 140
349 3300046458 Ga0495591_066852 Ga0495591_066852_163_600 140
350 3300046460 Ga0495638_0000978 Ga0495638_0000978_19256_19729 140
351 3300046471 Ga0495650_0052100 Ga0495650_0052100_1016_1438 140
352 3300046474 Ga0495605_0005182 Ga0495605_0005182_4464_4901 140
353 3300046474 Ga0495605_0056265 Ga0495605_0056265_857_1279 140
354 3300046475 Ga0495639_0162332 Ga0495639_0162332_464_886 140
355 3300046492 Ga0495585_0002615 Ga0495585_0002615_748_1185 140
356 3300046492 Ga0495585_0042592 Ga0495585_0042592_786_1208 140
357 3300046492 Ga0495585_0260617 Ga0495585_0260617_371_793 140
358 3300046500 Ga0495596_0399009 Ga0495596_0399009_40_462 140
359 3300046501 Ga0495607_0048065 Ga0495607_0048065_1423_1845 140
360 3300046501 Ga0495607_0091605 Ga0495607_0091605_294_731 140
361 3300046501 Ga0495607_0106991 Ga0495607_0106991_246_668 140
362 3300046506 Ga0495583_0003310 Ga0495583_0003310_1826_2248 140
363 3300046506 Ga0495583_0013561 Ga0495583_0013561_4070_4507 140
364 3300046506 Ga0495583_0335775 Ga0495583_0335775_76_498 140
365 3300046507 Ga0495606_0033669 Ga0495606_0033669_1341_1763 140
366 3300046507 Ga0495606_0204418 Ga0495606_0204418_151_588 140
367 3300046512 Ga0495610_0021404 Ga0495610_0021404_2673_3110 140
368 3300046512 Ga0495610_0048758 Ga0495610_0048758_82_504 140
369 3300046512 Ga0495610_0126529 Ga0495610_0126529_499_921 140
370 3300046513 Ga0495616_0015461 Ga0495616_0015461_2309_2746 140
371 3300046515 Ga0495620_0026229 Ga0495620_0026229_382_804 140
372 3300046515 Ga0495620_0031662 Ga0495620_0031662_816_1253 140
373 3300046515 Ga0495620_0080628 Ga0495620_0080628_107_529 140
374 3300046515 Ga0495620_0118810 Ga0495620_0118810_586_1023 140
375 3300046518 Ga0495631_0001352 Ga0495631_0001352_13022_13459 140
376 3300046518 Ga0495631_0056076 Ga0495631_0056076_662_1084 140
377 3300046518 Ga0495631_0119134 Ga0495631_0119134_229_651 140
378 3300046518 Ga0495631_0164039 Ga0495631_0164039_283_705 140
379 3300046519 Ga0495632_0005356 Ga0495632_0005356_2042_2494 140
380 3300046519 Ga0495632_0014024 Ga0495632_0014024_169_606 140
381 3300046519 Ga0495632_0032823 Ga0495632_0032823_328_750 140
382 3300046519 Ga0495632_0117622 Ga0495632_0117622_419_856 140
383 3300046520 Ga0495637_0173594 Ga0495637_0173594_26_448 140
384 3300046522 Ga0495643_0023047 Ga0495643_0023047_1352_1774 140
385 3300046522 Ga0495643_0105461 Ga0495643_0105461_893_1330 140
386 3300046523 Ga0495644_0227971 Ga0495644_0227971_284_706 140
387 3300046524 Ga0495648_0080295 Ga0495648_0080295_854_1291 140
388 3300046530 Ga0495654_0094077 Ga0495654_0094077_619_1041 140
389 3300046530 Ga0495654_0113895 Ga0495654_0113895_285_722 140
390 3300046530 Ga0495654_0120008 Ga0495654_0120008_659_1096 140
391 3300046538 Ga0495609_0040002 Ga0495609_0040002_1180_1617 140
392 3300046558 Ga0495633_0017212 Ga0495633_0017212_1497_1919 140
393 3300046558 Ga0495633_0050913 Ga0495633_0050913_369_791 140
394 3300046616 Ga0495668_0087951 Ga0495668_0087951_477_914 140
395 3300046616 Ga0495668_0498079 Ga0495668_0498079_42_479 140
396 3300046648 Ga0495611_0006470 Ga0495611_0006470_904_1341 140
397 3300046648 Ga0495611_0081567 Ga0495611_0081567_147_569 140
398 3300046648 Ga0495611_0236004 Ga0495611_0236004_378_800 140
399 3300046660 Ga0495625_0003537 Ga0495625_0003537_14730_15167 140
400 3300046660 Ga0495625_0018053 Ga0495625_0018053_2352_2774 140
401 3300046660 Ga0495625_0065577 Ga0495625_0065577_1096_1518 140
402 3300046660 Ga0495625_0226925 Ga0495625_0226925_71_493 140
403 3300046660 Ga0495625_0361278 Ga0495625_0361278_451_873 140
404 3300046660 Ga0495625_0392804 Ga0495625_0392804_93_515 140
405 3300046665 Ga0495661_0068374 Ga0495661_0068374_49_471 140
406 3300046674 Ga0495588_0082886 Ga0495588_0082886_92_514 140
407 3300046674 Ga0495588_0361618 Ga0495588_0361618_16_438 140
408 3300046674 Ga0495588_0405392 Ga0495588_0405392_225_677 140
409 3300046691 Ga0495670_0034506 Ga0495670_0034506_1171_1608 140
410 3300046691 Ga0495670_0071458 Ga0495670_0071458_1155_1577 140
411 3300046691 Ga0495670_0088612 Ga0495670_0088612_358_780 140
412 3300046691 Ga0495670_0404785 Ga0495670_0404785_302_724 140
413 3300046692 Ga0495671_0470286 Ga0495671_0470286_104_526 140
414 3300046694 Ga0495649_0621524 Ga0495649_0621524_67_489 140
415 3300046810 Ga0495660_0046928 Ga0495660_0046928_1547_1969 140
416 3300047318 Ga0495636_0011950 Ga0495636_0011950_2569_2991 140
417 3300047318 Ga0495636_0032155 Ga0495636_0032155_868_1341 140
418 3300047320 Ga0495672_0052903 Ga0495672_0052903_405_878 140
419 3300047323 Ga0495683_0046681 Ga0495683_0046681_1715_2152 140
420 3300047323 Ga0495683_0111105 Ga0495683_0111105_730_1152 140
421 3300047443 Ga0495687_043728 Ga0495687_043728_1486_1908 140
422 3300047443 Ga0495687_091624 Ga0495687_091624_437_859 140
423 3300047447 Ga0495685_165257 Ga0495685_165257_95_517 140
424 3300047472 Ga0495686_0030552 Ga0495686_0030552_2499_2936 140
425 3300047472 Ga0495686_0128776 Ga0495686_0128776_1013_1435 140
426 3300047472 Ga0495686_0614138 Ga0495686_0614138_81_503 140
427 3300048904 Ga0496101_0081205 Ga0496101_0081205_1912_2349 140
428 3300048905 Ga0496102_0307571 Ga0496102_0307571_554_991 140
429 3300048905 Ga0496102_0333953 Ga0496102_0333953_189_611 140
430 3300048906 Ga0496103_0212714 Ga0496103_0212714_588_1010 140
431 3300048907 Ga0496104_1432731 Ga0496104_1432731_33_470 140
432 3300048909 Ga0496106_0008801 Ga0496106_0008801_2050_2487 140
433 3300048909 Ga0496106_0201101 Ga0496106_0201101_1087_1509 140
434 3300048914 Ga0496111_0148392 Ga0496111_0148392_1149_1571 140
435 3300048916 Ga0496113_0352585 Ga0496113_0352585_542_964 140
436 3300048916 Ga0496113_1217922 Ga0496113_1217922_41_478 140
437 3300048919 Ga0496116_0013189 Ga0496116_0013189_2718_3155 140
438 3300048919 Ga0496116_0098920 Ga0496116_0098920_1111_1533 140
439 3300048919 Ga0496116_0103211 Ga0496116_0103211_857_1294 140
440 3300048919 Ga0496116_0128039 Ga0496116_0128039_233_670 140
441 3300048919 Ga0496116_0187874 Ga0496116_0187874_418_855 140
442 3300048919 Ga0496116_0243654 Ga0496116_0243654_351_788 140
443 3300048920 Ga0496117_0018264 Ga0496117_0018264_483_920 140
444 3300048920 Ga0496117_0035248 Ga0496117_0035248_2648_3085 140
445 3300048920 Ga0496117_0164761 Ga0496117_0164761_433_855 140
446 3300048920 Ga0496117_0315049 Ga0496117_0315049_338_775 140
447 3300048921 Ga0496118_0029488 Ga0496118_0029488_1907_2344 140
448 3300048921 Ga0496118_0032633 Ga0496118_0032633_2698_3120 140
449 3300048921 Ga0496118_0143359 Ga0496118_0143359_244_681 140
450 3300048922 Ga0496119_0254476 Ga0496119_0254476_336_773 140
451 3300048924 Ga0496121_0041256 Ga0496121_0041256_747_1169 140
452 3300048924 Ga0496121_0051710 Ga0496121_0051710_1747_2169 140
453 3300048924 Ga0496121_0081432 Ga0496121_0081432_1850_2287 140
454 3300048924 Ga0496121_0110014 Ga0496121_0110014_1198_1620 140
455 3300048924 Ga0496121_0178455 Ga0496121_0178455_629_1051 140
456 3300048924 Ga0496121_0185515 Ga0496121_0185515_276_713 140
457 3300048924 Ga0496121_0252302 Ga0496121_0252302_547_969 140
458 3300048924 Ga0496121_0380626 Ga0496121_0380626_350_787 140
459 3300048925 Ga0496122_0013200 Ga0496122_0013200_251_688 140
460 3300048925 Ga0496122_0052396 Ga0496122_0052396_1796_2233 140
461 3300048925 Ga0496122_0069960 Ga0496122_0069960_756_1193 140
462 3300048925 Ga0496122_0083808 Ga0496122_0083808_28_450 140
463 3300048926 Ga0496123_0008958 Ga0496123_0008958_8384_8821 140
464 3300048926 Ga0496123_0121455 Ga0496123_0121455_756_1193 140
465 3300048926 Ga0496123_0127351 Ga0496123_0127351_857_1294 140
466 3300048927 Ga0496124_0010128 Ga0496124_0010128_7256_7693 140
467 3300048927 Ga0496124_0078985 Ga0496124_0078985_1850_2287 140
468 3300048927 Ga0496124_0204586 Ga0496124_0204586_357_794 140
469 3300048927 Ga0496124_0283452 Ga0496124_0283452_185_622 140
470 3300048928 Ga0496125_0005193 Ga0496125_0005193_2633_3070 140
471 3300048928 Ga0496125_0301926 Ga0496125_0301926_90_527 140
472 3300048928 Ga0496125_0354932 Ga0496125_0354932_136_573 140
473 3300048928 Ga0496125_0527361 Ga0496125_0527361_88_510 140
474 3300048929 Ga0496126_0182747 Ga0496126_0182747_176_598 140
475 3300048929 Ga0496126_0195899 Ga0496126_0195899_884_1306 140
476 3300048929 Ga0496126_0272137 Ga0496126_0272137_484_921 140
477 3300049459 Ga0495678_006569 Ga0495678_006569_716_1153 140
478 3300049459 Ga0495678_025882 Ga0495678_025882_765_1202 140
479 3300049459 Ga0495678_107404 Ga0495678_107404_454_876 140
480 3300049571 Ga0501034_0370720 Ga0501034_0370720_457_894 140
481 3300049579 Ga0501043_0032212 Ga0501043_0032212_636_1073 140
482 3300049580 Ga0501046_0329956 Ga0501046_0329956_293_730 140
483 3300049583 Ga0501067_0187322 Ga0501067_0187322_675_1112 140
484 3300049584 Ga0501068_0323701 Ga0501068_0323701_391_828 140
485 3300049589 Ga0501073_0623894 Ga0501073_0623894_281_718 140
486 3300050496 nmdc:mga07m45_212182_c1 nmdc:mga07m45_212182_c1_573_1010 140
487 3300053086 Ga0500578_0041900 Ga0500578_0041900_1246_1683 140
488 3300053086 Ga0500578_0310960 Ga0500578_0310960_211_633 140
489 3300053094 Ga0500566_0393150 Ga0500566_0393150_44_481 140
490 3300053098 Ga0500650_0208010 Ga0500650_0208010_258_695 140
491 3300053118 Ga0500594_0029947 Ga0500594_0029947_421_843 140
492 3300053134 Ga0500658_0000307 Ga0500658_0000307_5204_5626 140
493 3300053134 Ga0500658_0029854 Ga0500658_0029854_1263_1700 140
494 3300053139 Ga0500568_0000803 Ga0500568_0000803_19274_19747 140
495 3300053139 Ga0500568_0020181 Ga0500568_0020181_394_831 140
496 3300053142 Ga0500577_0187972 Ga0500577_0187972_67_540 140
497 3300053142 Ga0500577_0317814 Ga0500577_0317814_151_573 140
498 3300053151 Ga0500604_0012915 Ga0500604_0012915_324_761 140
499 3300053152 Ga0500606_100109 Ga0500606_100109_399_821 140
500 3300053153 Ga0500616_0001222 Ga0500616_0001222_16359_16832 140
501 3300053153 Ga0500616_0359172 Ga0500616_0359172_139_561 140
502 3300053158 Ga0500627_0054945 Ga0500627_0054945_451_873 140
503 3300053158 Ga0500627_0340087 Ga0500627_0340087_187_624 140
504 3300053160 Ga0500633_0048089 Ga0500633_0048089_139_576 140
505 3300053160 Ga0500633_0091482 Ga0500633_0091482_348_770 140
506 3300059643 Ga0587072_101299 Ga0587072_101299_136_558 140
507 3300060353 Ga0501082_0047807 Ga0501082_0047807_2156_2593 140
508 iso_pu_bacteria 2582581304 2585257504 140
509 3300002737 JGI25162J39368_1000413 JGI25162J39368_100041336 141
510 3300003214 JGI25165J46597_1000675 JGI25165J46597_10006753 141
511 3300003214 JGI25165J46597_1001441 JGI25165J46597_10014414 141
512 3300003215 JGI25153J46596_10035946 JGI25153J46596_100359462 141
513 3300005353 Ga0070669_100035902 Ga0070669_1000359024 141
514 3300006186 Ga0075369_10027353 Ga0075369_100273533 141
515 3300013100 Ga0157373_10678759 Ga0157373_106787592 141
516 3300013105 Ga0157369_10701348 Ga0157369_107013482 141
517 3300025233 Ga0209437_100057 Ga0209437_10005765 141
518 3300025258 Ga0209129_1001392 Ga0209129_100139216 141
519 3300025261 Ga0209233_1000134 Ga0209233_100013465 141
520 3300025272 Ga0209455_1022240 Ga0209455_10222401 141
521 3300025273 Ga0209673_1102937 Ga0209673_11029371 141
522 3300025294 Ga0209025_1041711 Ga0209025_10417112 141
523 3300025297 Ga0209758_1003637 Ga0209758_10036372 141
524 3300025923 Ga0207681_10031254 Ga0207681_100312543 141
525 3300046459 Ga0495629_0456743 Ga0495629_0456743_418_843 141
526 3300046462 Ga0495651_0324076 Ga0495651_0324076_448_873 141
527 3300046463 Ga0495653_0540996 Ga0495653_0540996_134_559 141
528 3300046471 Ga0495650_0070474 Ga0495650_0070474_270_695 141
529 3300046476 Ga0495662_0010665 Ga0495662_0010665_477_902 141
530 3300046477 Ga0495664_0436067 Ga0495664_0436067_266_691 141
531 3300046500 Ga0495596_0272216 Ga0495596_0272216_46_474 141
532 3300046507 Ga0495606_0105801 Ga0495606_0105801_129_554 141
533 3300046512 Ga0495610_0078688 Ga0495610_0078688_556_996 141
534 3300046514 Ga0495618_0347883 Ga0495618_0347883_300_725 141
535 3300046536 Ga0495587_0261290 Ga0495587_0261290_472_897 141
536 3300046557 Ga0495622_0102253 Ga0495622_0102253_178_603 141
537 3300046660 Ga0495625_0143541 Ga0495625_0143541_509_937 141
538 3300046663 Ga0495635_0596289 Ga0495635_0596289_74_499 141
539 3300046683 Ga0495658_0270703 Ga0495658_0270703_456_881 141
540 3300046689 Ga0495613_0159806 Ga0495613_0159806_224_649 141
541 3300046690 Ga0495624_0480595 Ga0495624_0480595_289_714 141
542 3300046694 Ga0495649_0089151 Ga0495649_0089151_1127_1567 141
543 3300046809 Ga0495600_0122739 Ga0495600_0122739_956_1381 141
544 3300047317 Ga0495604_0076923 Ga0495604_0076923_1720_2145 141
545 3300047443 Ga0495687_035257 Ga0495687_035257_1150_1578 141
546 3300047470 Ga0495681_0058908 Ga0495681_0058908_1294_1722 141
547 3300047470 Ga0495681_0125468 Ga0495681_0125468_41_469 141
548 3300047470 Ga0495681_0235679 Ga0495681_0235679_34_462 141
549 3300048919 Ga0496116_0042664 Ga0496116_0042664_1770_2210 141
550 3300048920 Ga0496117_0058971 Ga0496117_0058971_415_855 141
551 3300048921 Ga0496118_0040575 Ga0496118_0040575_1849_2289 141
552 3300048921 Ga0496118_0126826 Ga0496118_0126826_835_1260 141
553 3300048922 Ga0496119_0050772 Ga0496119_0050772_1087_1512 141
554 3300048924 Ga0496121_0017843 Ga0496121_0017843_1160_1600 141
555 3300048925 Ga0496122_0045996 Ga0496122_0045996_1795_2235 141
556 3300048925 Ga0496122_0053444 Ga0496122_0053444_892_1317 141
557 3300048926 Ga0496123_0027036 Ga0496123_0027036_1624_2064 141
558 3300048927 Ga0496124_0059174 Ga0496124_0059174_1242_1667 141
559 3300048927 Ga0496124_0227942 Ga0496124_0227942_211_651 141
560 3300048928 Ga0496125_0021105 Ga0496125_0021105_1819_2259 141
561 3300048928 Ga0496125_0061256 Ga0496125_0061256_1132_1557 141
562 3300050516 nmdc:mga0sz30_2503_c1 nmdc:mga0sz30_2503_c1_2123_2563 141
563 3300053148 Ga0500590_003834 Ga0500590_003834_6045_6470 141
564 3300053156 Ga0500622_0016825 Ga0500622_0016825_1340_1780 141
565 iso_pu_bacteria 2510917030 2511198147 141
566 iso_pu_bacteria 2582581298 2585223778 141
567 iso_pu_bacteria 2585427529 2585549001 141
568 iso_pu_bacteria 2919100787 2919105236 141
569 iso_pu_bacteria 2960637947 2960645283 141
570 iso_pu_bacteria 2964628898 2964635228 141
571 iso_pu_bacteria 2964719344 2964721008 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06172

Cupin_5

Cupin superfamily (DUF985)

6

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1znp-assembly3.cif.gz_F-2 x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. 0.9493 1 138
1znp-assembly3.cif.gz_F-2 x-ray crystal structure of protein q8u9w0 from agrobacterium tumefaciens. northeast structural genomics consortium target atr55. 0.9297 1 138
1yud-assembly5.cif.gz_I x-ray crystal structure of protein so0799 from shewanella oneidensis. northeast structural genomics consortium target sor12. 0.9188 1 132
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8775 12 122
3loi-assembly1.cif.gz_A crystal structures of cupin superfamily bbduf985 from branchiostoma belcheri tsingtauense in the apo and gdp-bound forms 0.8767 4 133
ID Description Score Start End Superfamily
1znpB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9447 2 138 2.60.120.10
1znpB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9251 2 138 2.60.120.10
af_Q8GYZ3_2_189_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8925 1 133 2.60.120.10
1yudF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8911 1 132 2.60.120.10
af_A0A0P0WTM4_2_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8789 68 107 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6J4I2N0-F1-model_v4 DUF985 domain-containing protein 0.9696 35 138
AF-A0A437MNQ9-F1-model_v4 Cupin domain-containing protein 0.9632 1 139
AF-K3VXD8-F1-model_v4 DUF985 domain-containing protein 0.9632 1 119 GO:0005886
GO:0022857
AF-A0A142M2T6-F1-model_v4 deleted 0.9599 1 121
AF-A0A440J5T3-F1-model_v4 deleted 0.9571 2 114

Feature Viewer

pLDDT pTM Quality
91.14 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map