F465004
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 571 | 266 | 571 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300049765|Ga0501268_033164|Ga0501268_033164_209_565 |
| Length | 118 |
| Sequence | MAEKKTVVLGASDNPSRYSYLAVRKLQANHHPVVAIGKRVGDTDIVTDHNPVDSVDTITLYLNPMNQREYYDYILSLNPKRIIFNPGTENDELMKRAKENGIEPVVGCTLVMLSTGQY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 172 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 177 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 178 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 179 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 180 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 181 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 182 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 183 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 184 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 203 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 204 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 219 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 220 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 221 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 222 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 223 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 226 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 227 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 229 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 231 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 232 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 233 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 235 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 236 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 237 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 238 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 239 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 240 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 241 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 249 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 255 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 256 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 264 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 265 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.8 |
| Nodule | 0 |
| Rhizoplane | 0.7 |
| Rhizosphere | 95.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10028448 | 3300002077 | Unclassified | 1077 |
| 2 | JGI25153J46596_10048619 | 3300003215 | Bacteria | 1237 |
| 3 | rootL2_10200952 | 3300003322 | Bacteria | 4645 |
| 4 | JGI25160J50197_1005846 | 3300003354 | Bacteria | 5065 |
| 5 | Ga0055528_1000307 | 3300003790 | Bacteria | 41483 |
| 6 | Ga0055530_10001712 | 3300003791 | Bacteria | 15455 |
| 7 | Ga0055543_1017342 | 3300004625 | Bacteria | 1356 |
| 8 | Ga0065165_1000722 | 3300005262 | Bacteria | 46444 |
| 9 | Ga0065714_10182733 | 3300005288 | Bacteria | 956 |
| 10 | Ga0065704_10089928 | 3300005289 | Unclassified | 2823 |
| 11 | Ga0065704_10103610 | 3300005289 | Unclassified | 2167 |
| 12 | Ga0065712_10002222 | 3300005290 | Bacteria | 8378 |
| 13 | Ga0065712_10043539 | 3300005290 | Bacteria | 672 |
| 14 | Ga0065712_10256598 | 3300005290 | Bacteria | 946 |
| 15 | Ga0065715_10005986 | 3300005293 | Bacteria | 5971 |
| 16 | Ga0065715_10365032 | 3300005293 | Bacteria | 929 |
| 17 | Ga0065707_10013258 | 3300005295 | Unclassified | 1632 |
| 18 | Ga0070658_10001648 | 3300005327 | Bacteria | 18875 |
| 19 | Ga0070658_11213680 | 3300005327 | Bacteria | 656 |
| 20 | Ga0070676_10001113 | 3300005328 | Bacteria | 13439 |
| 21 | Ga0070676_10837650 | 3300005328 | Bacteria | 681 |
| 22 | Ga0070690_100266254 | 3300005330 | Bacteria | 1217 |
| 23 | Ga0070690_101193792 | 3300005330 | Bacteria | 607 |
| 24 | Ga0070670_100025113 | 3300005331 | Bacteria | 5127 |
| 25 | Ga0070670_100041225 | 3300005331 | Bacteria | 3968 |
| 26 | Ga0070670_100431519 | 3300005331 | Bacteria | 1166 |
| 27 | Ga0070670_101693224 | 3300005331 | Bacteria | 582 |
| 28 | Ga0070677_10057798 | 3300005333 | Bacteria | 1591 |
| 29 | Ga0068869_100007522 | 3300005334 | Bacteria | 6969 |
| 30 | Ga0068869_100033589 | 3300005334 | Bacteria | 3622 |
| 31 | Ga0068869_100131493 | 3300005334 | Unclassified | 1924 |
| 32 | Ga0068869_100141613 | 3300005334 | Bacteria | 1857 |
| 33 | Ga0068869_100230690 | 3300005334 | Bacteria | 1471 |
| 34 | Ga0070666_10000358 | 3300005335 | Bacteria | 28682 |
| 35 | Ga0070666_10450397 | 3300005335 | Unclassified | 929 |
| 36 | Ga0070666_10687081 | 3300005335 | Bacteria | 750 |
| 37 | Ga0068868_100000187 | 3300005338 | Bacteria | 41327 |
| 38 | Ga0068868_100105822 | 3300005338 | Bacteria | 2282 |
| 39 | Ga0068868_100807160 | 3300005338 | Unclassified | 847 |
| 40 | Ga0068868_100994554 | 3300005338 | Bacteria | 767 |
| 41 | Ga0068868_101604535 | 3300005338 | Bacteria | 611 |
| 42 | Ga0070660_100706540 | 3300005339 | Unclassified | 845 |
| 43 | Ga0070689_100013993 | 3300005340 | Bacteria | 5822 |
| 44 | Ga0070689_100018385 | 3300005340 | Bacteria | 5147 |
| 45 | Ga0070689_100568876 | 3300005340 | Bacteria | 978 |
| 46 | Ga0070687_100011391 | 3300005343 | Bacteria | 3889 |
| 47 | Ga0070687_100697830 | 3300005343 | Bacteria | 708 |
| 48 | Ga0070687_101438584 | 3300005343 | Unclassified | 516 |
| 49 | Ga0070661_100466500 | 3300005344 | Bacteria | 1006 |
| 50 | Ga0070668_100003714 | 3300005347 | Bacteria | 11263 |
| 51 | Ga0070668_100106593 | 3300005347 | Bacteria | 2227 |
| 52 | Ga0070668_101506977 | 3300005347 | Unclassified | 615 |
| 53 | Ga0070669_100004109 | 3300005353 | Bacteria | 10555 |
| 54 | Ga0070669_100066435 | 3300005353 | Bacteria | 2658 |
| 55 | Ga0070669_100390225 | 3300005353 | Bacteria | 1137 |
| 56 | Ga0070669_100891519 | 3300005353 | Bacteria | 759 |
| 57 | Ga0070669_101251971 | 3300005353 | Bacteria | 642 |
| 58 | Ga0070675_100007290 | 3300005354 | Bacteria | 8533 |
| 59 | Ga0070675_100070045 | 3300005354 | Bacteria | 2906 |
| 60 | Ga0070675_100323287 | 3300005354 | Bacteria | 1363 |
| 61 | Ga0070675_100419440 | 3300005354 | Bacteria | 1196 |
| 62 | Ga0070675_100611429 | 3300005354 | Bacteria | 989 |
| 63 | Ga0070675_100620078 | 3300005354 | Bacteria | 982 |
| 64 | Ga0070675_100996146 | 3300005354 | Bacteria | 769 |
| 65 | Ga0070675_102046537 | 3300005354 | Unclassified | 528 |
| 66 | Ga0070671_100266299 | 3300005355 | Bacteria | 1456 |
| 67 | Ga0070674_100372952 | 3300005356 | Unclassified | 1159 |
| 68 | Ga0070674_100614442 | 3300005356 | Unclassified | 920 |
| 69 | Ga0070674_100672004 | 3300005356 | Bacteria | 882 |
| 70 | Ga0070673_100000124 | 3300005364 | Bacteria | 35840 |
| 71 | Ga0070673_100020821 | 3300005364 | Bacteria | 4738 |
| 72 | Ga0070673_100225863 | 3300005364 | Bacteria | 1623 |
| 73 | Ga0070673_100256834 | 3300005364 | Bacteria | 1525 |
| 74 | Ga0070673_100630659 | 3300005364 | Bacteria | 980 |
| 75 | Ga0070688_100021022 | 3300005365 | Unclassified | 3805 |
| 76 | Ga0070688_100024251 | 3300005365 | Bacteria | 3576 |
| 77 | Ga0070688_100110762 | 3300005365 | Unclassified | 1825 |
| 78 | Ga0070688_100261637 | 3300005365 | Bacteria | 1236 |
| 79 | Ga0070667_100000980 | 3300005367 | Bacteria | 26248 |
| 80 | Ga0070667_100295443 | 3300005367 | Bacteria | 1458 |
| 81 | Ga0070667_100504135 | 3300005367 | Bacteria | 1110 |
| 82 | Ga0070701_10197861 | 3300005438 | Unclassified | 1186 |
| 83 | Ga0070701_10233378 | 3300005438 | Bacteria | 1103 |
| 84 | Ga0070705_100670508 | 3300005440 | Bacteria | 811 |
| 85 | Ga0070700_100047150 | 3300005441 | Bacteria | 2666 |
| 86 | Ga0070700_100173095 | 3300005441 | Bacteria | 1496 |
| 87 | Ga0070700_101304083 | 3300005441 | Bacteria | 610 |
| 88 | Ga0070694_100988799 | 3300005444 | Bacteria | 698 |
| 89 | Ga0070663_100087774 | 3300005455 | Bacteria | 2299 |
| 90 | Ga0070663_100794034 | 3300005455 | Unclassified | 811 |
| 91 | Ga0070678_100086792 | 3300005456 | Unclassified | 2388 |
| 92 | Ga0070678_100614875 | 3300005456 | Bacteria | 971 |
| 93 | Ga0070662_100010835 | 3300005457 | Bacteria | 6003 |
| 94 | Ga0070662_100577376 | 3300005457 | Bacteria | 944 |
| 95 | Ga0068867_100022992 | 3300005459 | Bacteria | 4461 |
| 96 | Ga0068867_100953814 | 3300005459 | Bacteria | 775 |
| 97 | Ga0068867_100970919 | 3300005459 | Bacteria | 769 |
| 98 | Ga0070685_10002080 | 3300005466 | Bacteria | 10351 |
| 99 | Ga0070685_10004179 | 3300005466 | Bacteria | 7282 |
| 100 | Ga0070685_10254127 | 3300005466 | Bacteria | 1165 |
| 101 | Ga0070685_10706994 | 3300005466 | Unclassified | 735 |
| 102 | Ga0070698_100001241 | 3300005471 | Bacteria | 28439 |
| 103 | Ga0070698_100024064 | 3300005471 | Bacteria | 6357 |
| 104 | Ga0070698_100055572 | 3300005471 | Bacteria | 4013 |
| 105 | Ga0070698_100239629 | 3300005471 | Bacteria | 1747 |
| 106 | Ga0070699_100150518 | 3300005518 | Bacteria | 2058 |
| 107 | Ga0070684_100259776 | 3300005535 | Bacteria | 1589 |
| 108 | Ga0068853_100002569 | 3300005539 | Bacteria | 13648 |
| 109 | Ga0068853_100033328 | 3300005539 | Bacteria | 4369 |
| 110 | Ga0070672_100000105 | 3300005543 | Bacteria | 41868 |
| 111 | Ga0070672_100030184 | 3300005543 | Bacteria | 4070 |
| 112 | Ga0070672_100048718 | 3300005543 | Unclassified | 3294 |
| 113 | Ga0070672_100706635 | 3300005543 | Bacteria | 883 |
| 114 | Ga0070672_101413943 | 3300005543 | Unclassified | 622 |
| 115 | Ga0070686_100042427 | 3300005544 | Bacteria | 2849 |
| 116 | Ga0070686_100140349 | 3300005544 | Unclassified | 1681 |
| 117 | Ga0070665_100000635 | 3300005548 | Bacteria | 47836 |
| 118 | Ga0070665_100707600 | 3300005548 | Bacteria | 1020 |
| 119 | Ga0068855_100072463 | 3300005563 | Bacteria | 4004 |
| 120 | Ga0070664_100587894 | 3300005564 | Bacteria | 1032 |
| 121 | Ga0068857_100411900 | 3300005577 | Unclassified | 1259 |
| 122 | Ga0068854_100069273 | 3300005578 | Bacteria | 2575 |
| 123 | Ga0068854_100146313 | 3300005578 | Bacteria | 1818 |
| 124 | Ga0068854_100237692 | 3300005578 | Bacteria | 1449 |
| 125 | Ga0068856_100125471 | 3300005614 | Unclassified | 2570 |
| 126 | Ga0068856_100633016 | 3300005614 | Bacteria | 1090 |
| 127 | Ga0070702_100132063 | 3300005615 | Bacteria | 1578 |
| 128 | Ga0068852_100043934 | 3300005616 | Bacteria | 3792 |
| 129 | Ga0068852_100553120 | 3300005616 | Unclassified | 1151 |
| 130 | Ga0068859_100016832 | 3300005617 | Bacteria | 7339 |
| 131 | Ga0068859_100099276 | 3300005617 | Unclassified | 2967 |
| 132 | Ga0068859_100158567 | 3300005617 | Bacteria | 2341 |
| 133 | Ga0068859_100456253 | 3300005617 | Bacteria | 1374 |
| 134 | Ga0068859_100561632 | 3300005617 | Bacteria | 1235 |
| 135 | Ga0068859_102028218 | 3300005617 | Bacteria | 635 |
| 136 | Ga0068859_102467620 | 3300005617 | Bacteria | 573 |
| 137 | Ga0068864_100006131 | 3300005618 | Bacteria | 9864 |
| 138 | Ga0068864_100136114 | 3300005618 | Bacteria | 2212 |
| 139 | Ga0068864_100136404 | 3300005618 | Bacteria | 2210 |
| 140 | Ga0068864_101454835 | 3300005618 | Unclassified | 688 |
| 141 | Ga0068864_101998794 | 3300005618 | Bacteria | 586 |
| 142 | Ga0068861_100023393 | 3300005719 | Bacteria | 4455 |
| 143 | Ga0068861_100033187 | 3300005719 | Bacteria | 3806 |
| 144 | Ga0068861_100094835 | 3300005719 | Bacteria | 2362 |
| 145 | Ga0068861_100413277 | 3300005719 | Bacteria | 1200 |
| 146 | Ga0068861_100800181 | 3300005719 | Bacteria | 885 |
| 147 | Ga0068861_100884973 | 3300005719 | Bacteria | 845 |
| 148 | Ga0068851_10016169 | 3300005834 | Bacteria | 3566 |
| 149 | Ga0068851_10528380 | 3300005834 | Bacteria | 710 |
| 150 | Ga0068870_10168364 | 3300005840 | Bacteria | 1305 |
| 151 | Ga0068870_10236799 | 3300005840 | Bacteria | 1125 |
| 152 | Ga0068870_10399345 | 3300005840 | Bacteria | 894 |
| 153 | Ga0068870_11461334 | 3300005840 | Unclassified | 502 |
| 154 | Ga0068863_100001976 | 3300005841 | Bacteria | 20394 |
| 155 | Ga0068863_100007551 | 3300005841 | Bacteria | 10635 |
| 156 | Ga0068863_100669684 | 3300005841 | Bacteria | 1030 |
| 157 | Ga0068863_100671912 | 3300005841 | Bacteria | 1028 |
| 158 | Ga0068858_100010584 | 3300005842 | Bacteria | 8734 |
| 159 | Ga0068858_100053682 | 3300005842 | Bacteria | 3728 |
| 160 | Ga0068858_100222894 | 3300005842 | Unclassified | 1786 |
| 161 | Ga0068858_101256789 | 3300005842 | Bacteria | 728 |
| 162 | Ga0068858_101635994 | 3300005842 | Bacteria | 636 |
| 163 | Ga0068860_100001418 | 3300005843 | Bacteria | 25953 |
| 164 | Ga0068860_100003309 | 3300005843 | Bacteria | 16586 |
| 165 | Ga0068860_100744040 | 3300005843 | Bacteria | 992 |
| 166 | Ga0068860_101248065 | 3300005843 | Unclassified | 764 |
| 167 | Ga0068862_100002509 | 3300005844 | Bacteria | 16247 |
| 168 | Ga0068862_100385177 | 3300005844 | Bacteria | 1308 |
| 169 | Ga0068862_100543410 | 3300005844 | Bacteria | 1109 |
| 170 | Ga0068862_101410931 | 3300005844 | Bacteria | 700 |
| 171 | Ga0081539_10236136 | 3300005985 | Bacteria | 821 |
| 172 | Ga0097621_100001817 | 3300006237 | Bacteria | 14674 |
| 173 | Ga0097621_100199891 | 3300006237 | Bacteria | 1735 |
| 174 | Ga0097621_100452739 | 3300006237 | Unclassified | 1157 |
| 175 | Ga0097621_100506023 | 3300006237 | Bacteria | 1095 |
| 176 | Ga0097621_100551417 | 3300006237 | Bacteria | 1049 |
| 177 | Ga0097621_101553916 | 3300006237 | Bacteria | 629 |
| 178 | Ga0068871_100009967 | 3300006358 | Bacteria | 6904 |
| 179 | Ga0068871_100010690 | 3300006358 | Bacteria | 6711 |
| 180 | Ga0068871_100375072 | 3300006358 | Bacteria | 1263 |
| 181 | Ga0068871_102188288 | 3300006358 | Unclassified | 527 |
| 182 | Ga0075428_100040899 | 3300006844 | Bacteria | 5098 |
| 183 | Ga0075428_100672582 | 3300006844 | Bacteria | 1103 |
| 184 | Ga0075430_100239773 | 3300006846 | Unclassified | 1503 |
| 185 | Ga0075431_100299054 | 3300006847 | Unclassified | 1626 |
| 186 | Ga0075429_100015826 | 3300006880 | Bacteria | 6532 |
| 187 | Ga0075429_100477090 | 3300006880 | Bacteria | 1093 |
| 188 | Ga0075429_100609099 | 3300006880 | Bacteria | 957 |
| 189 | Ga0068865_100017646 | 3300006881 | Bacteria | 4594 |
| 190 | Ga0068865_100689512 | 3300006881 | Bacteria | 872 |
| 191 | Ga0068865_101481619 | 3300006881 | Unclassified | 608 |
| 192 | Ga0097620_100016833 | 3300006931 | Bacteria | 7339 |
| 193 | Ga0097620_100099279 | 3300006931 | Unclassified | 2967 |
| 194 | Ga0097620_100158567 | 3300006931 | Bacteria | 2341 |
| 195 | Ga0097620_100456237 | 3300006931 | Bacteria | 1374 |
| 196 | Ga0097620_100561621 | 3300006931 | Bacteria | 1235 |
| 197 | Ga0097620_102028669 | 3300006931 | Bacteria | 635 |
| 198 | Ga0097620_102467663 | 3300006931 | Bacteria | 573 |
| 199 | Ga0075435_101359135 | 3300007076 | Unclassified | 622 |
| 200 | Ga0105240_10000746 | 3300009093 | Bacteria | 59393 |
| 201 | Ga0105240_10076297 | 3300009093 | Bacteria | 4132 |
| 202 | Ga0105240_11726909 | 3300009093 | Bacteria | 653 |
| 203 | Ga0111539_10006668 | 3300009094 | Bacteria | 14871 |
| 204 | Ga0111539_10117592 | 3300009094 | Bacteria | 3116 |
| 205 | Ga0111539_10175593 | 3300009094 | Bacteria | 2503 |
| 206 | Ga0111539_10178539 | 3300009094 | Bacteria | 2480 |
| 207 | Ga0111539_10258394 | 3300009094 | Bacteria | 2028 |
| 208 | Ga0111539_10992133 | 3300009094 | Bacteria | 976 |
| 209 | Ga0111539_13314173 | 3300009094 | Bacteria | 518 |
| 210 | Ga0105245_10123697 | 3300009098 | Bacteria | 2419 |
| 211 | Ga0105247_10001867 | 3300009101 | Bacteria | 14743 |
| 212 | Ga0105247_10017539 | 3300009101 | Bacteria | 4294 |
| 213 | Ga0105247_10133032 | 3300009101 | Bacteria | 1623 |
| 214 | Ga0114129_10005331 | 3300009147 | Bacteria | 18156 |
| 215 | Ga0114129_11906917 | 3300009147 | Unclassified | 720 |
| 216 | Ga0105243_10662056 | 3300009148 | Unclassified | 1013 |
| 217 | Ga0105241_10008820 | 3300009174 | Bacteria | 7410 |
| 218 | Ga0105241_10372697 | 3300009174 | Unclassified | 1245 |
| 219 | Ga0105242_10018508 | 3300009176 | Bacteria | 5447 |
| 220 | Ga0105242_10341964 | 3300009176 | Unclassified | 1379 |
| 221 | Ga0105242_12284291 | 3300009176 | Bacteria | 587 |
| 222 | Ga0105248_10025712 | 3300009177 | Bacteria | 6548 |
| 223 | Ga0105248_10906132 | 3300009177 | Unclassified | 996 |
| 224 | Ga0105237_10800921 | 3300009545 | Bacteria | 949 |
| 225 | Ga0105238_10097951 | 3300009551 | Bacteria | 2917 |
| 226 | Ga0105249_10002678 | 3300009553 | Bacteria | 15401 |
| 227 | Ga0105249_10020437 | 3300009553 | Bacteria | 5919 |
| 228 | Ga0105249_10026181 | 3300009553 | Bacteria | 5253 |
| 229 | Ga0105249_10031914 | 3300009553 | Bacteria | 4765 |
| 230 | Ga0105249_10037534 | 3300009553 | Bacteria | 4397 |
| 231 | Ga0105249_10356050 | 3300009553 | Bacteria | 1484 |
| 232 | Ga0105239_10071591 | 3300010375 | Bacteria | 3809 |
| 233 | Ga0105239_10141040 | 3300010375 | Bacteria | 2685 |
| 234 | Ga0105239_13361620 | 3300010375 | Bacteria | 520 |
| 235 | Ga0105246_11101908 | 3300011119 | Unclassified | 725 |
| 236 | Ga0157369_10247260 | 3300013105 | Bacteria | 1862 |
| 237 | Ga0157369_12235688 | 3300013105 | Unclassified | 554 |
| 238 | Ga0157374_10002980 | 3300013296 | Bacteria | 14179 |
| 239 | Ga0157374_10852005 | 3300013296 | Unclassified | 928 |
| 240 | Ga0157378_10013251 | 3300013297 | Bacteria | 7209 |
| 241 | Ga0157378_10263310 | 3300013297 | Bacteria | 1655 |
| 242 | Ga0157378_10452024 | 3300013297 | Unclassified | 1275 |
| 243 | Ga0163162_10000312 | 3300013306 | Bacteria | 45022 |
| 244 | Ga0163162_10004060 | 3300013306 | Bacteria | 14047 |
| 245 | Ga0163162_10153332 | 3300013306 | Bacteria | 2422 |
| 246 | Ga0163162_10818473 | 3300013306 | Bacteria | 1048 |
| 247 | Ga0163162_11258459 | 3300013306 | Bacteria | 840 |
| 248 | Ga0163162_12210654 | 3300013306 | Unclassified | 632 |
| 249 | Ga0157372_10073469 | 3300013307 | Bacteria | 3855 |
| 250 | Ga0157372_10332960 | 3300013307 | Bacteria | 1768 |
| 251 | Ga0157372_10571310 | 3300013307 | Bacteria | 1318 |
| 252 | Ga0157372_11919917 | 3300013307 | Bacteria | 681 |
| 253 | Ga0157372_12929480 | 3300013307 | Bacteria | 546 |
| 254 | Ga0157375_10002871 | 3300013308 | Bacteria | 14932 |
| 255 | Ga0157375_10005226 | 3300013308 | Bacteria | 11266 |
| 256 | Ga0157375_10055440 | 3300013308 | Bacteria | 3908 |
| 257 | Ga0157375_10058124 | 3300013308 | Bacteria | 3825 |
| 258 | Ga0157375_10155653 | 3300013308 | Bacteria | 2424 |
| 259 | Ga0157375_11661213 | 3300013308 | Unclassified | 756 |
| 260 | Ga0163163_10000346 | 3300014325 | Bacteria | 44619 |
| 261 | Ga0163163_10043685 | 3300014325 | Bacteria | 4395 |
| 262 | Ga0163163_10057583 | 3300014325 | Bacteria | 3843 |
| 263 | Ga0163163_10201063 | 3300014325 | Bacteria | 2041 |
| 264 | Ga0163163_10299526 | 3300014325 | Bacteria | 1660 |
| 265 | Ga0163163_12512623 | 3300014325 | Unclassified | 573 |
| 266 | Ga0157380_10013625 | 3300014326 | Bacteria | 5934 |
| 267 | Ga0157380_10017475 | 3300014326 | Bacteria | 5307 |
| 268 | Ga0157380_10040584 | 3300014326 | Bacteria | 3626 |
| 269 | Ga0157380_10142780 | 3300014326 | Bacteria | 2059 |
| 270 | Ga0157380_10369636 | 3300014326 | Unclassified | 1349 |
| 271 | Ga0157380_10497993 | 3300014326 | Bacteria | 1183 |
| 272 | Ga0157380_10927474 | 3300014326 | Unclassified | 899 |
| 273 | Ga0157380_12881230 | 3300014326 | Bacteria | 547 |
| 274 | Ga0157380_13272438 | 3300014326 | Unclassified | 518 |
| 275 | Ga0157377_10020800 | 3300014745 | Bacteria | 3443 |
| 276 | Ga0157377_10030434 | 3300014745 | Bacteria | 2924 |
| 277 | Ga0157377_10419857 | 3300014745 | Unclassified | 916 |
| 278 | Ga0157379_10000242 | 3300014968 | Bacteria | 42795 |
| 279 | Ga0157379_10480804 | 3300014968 | Bacteria | 1149 |
| 280 | Ga0157379_10791003 | 3300014968 | Bacteria | 895 |
| 281 | Ga0157379_10925384 | 3300014968 | Bacteria | 828 |
| 282 | Ga0157376_10002821 | 3300014969 | Bacteria | 11880 |
| 283 | Ga0157376_10229136 | 3300014969 | Bacteria | 1725 |
| 284 | Ga0157376_10290128 | 3300014969 | Bacteria | 1544 |
| 285 | Ga0157376_10754551 | 3300014969 | Unclassified | 982 |
| 286 | Ga0163161_10039298 | 3300017792 | Unclassified | 3396 |
| 287 | Ga0163161_10116704 | 3300017792 | Bacteria | 2001 |
| 288 | Ga0163161_10124184 | 3300017792 | Bacteria | 1942 |
| 289 | Ga0163161_10134524 | 3300017792 | Bacteria | 1867 |
| 290 | Ga0209673_1000242 | 3300025273 | Bacteria | 104669 |
| 291 | Ga0209564_1015069 | 3300025295 | Bacteria | 3169 |
| 292 | Ga0209758_1010949 | 3300025297 | Bacteria | 5334 |
| 293 | Ga0209050_1000298 | 3300025298 | Bacteria | 104315 |
| 294 | Ga0207426_1001104 | 3300025302 | Bacteria | 24841 |
| 295 | Ga0209257_1007367 | 3300025304 | Bacteria | 6667 |
| 296 | Ga0207697_10085949 | 3300025315 | Bacteria | 1329 |
| 297 | Ga0207697_10510406 | 3300025315 | Bacteria | 530 |
| 298 | Ga0207656_10004467 | 3300025321 | Bacteria | 4888 |
| 299 | Ga0207682_10022153 | 3300025893 | Bacteria | 2502 |
| 300 | Ga0207642_10547664 | 3300025899 | Bacteria | 714 |
| 301 | Ga0207710_10001574 | 3300025900 | Bacteria | 11207 |
| 302 | Ga0207688_10234220 | 3300025901 | Bacteria | 1109 |
| 303 | Ga0207680_10003927 | 3300025903 | Bacteria | 7016 |
| 304 | Ga0207680_10259804 | 3300025903 | Bacteria | 1202 |
| 305 | Ga0207647_10227495 | 3300025904 | Bacteria | 1074 |
| 306 | Ga0207645_10001794 | 3300025907 | Bacteria | 17325 |
| 307 | Ga0207645_10006873 | 3300025907 | Bacteria | 8118 |
| 308 | Ga0207643_10004498 | 3300025908 | Bacteria | 7493 |
| 309 | Ga0207643_10061552 | 3300025908 | Bacteria | 2144 |
| 310 | Ga0207643_10118908 | 3300025908 | Unclassified | 1563 |
| 311 | Ga0207705_10017600 | 3300025909 | Bacteria | 5114 |
| 312 | Ga0207654_10070468 | 3300025911 | Bacteria | 2076 |
| 313 | Ga0207707_11463064 | 3300025912 | Bacteria | 543 |
| 314 | Ga0207695_10000647 | 3300025913 | Bacteria | 69264 |
| 315 | Ga0207695_10261753 | 3300025913 | Bacteria | 1627 |
| 316 | Ga0207662_10011142 | 3300025918 | Bacteria | 4976 |
| 317 | Ga0207662_10048615 | 3300025918 | Bacteria | 2513 |
| 318 | Ga0207646_11191288 | 3300025922 | Bacteria | 668 |
| 319 | Ga0207681_10017038 | 3300025923 | Unclassified | 4558 |
| 320 | Ga0207681_10057500 | 3300025923 | Bacteria | 2658 |
| 321 | Ga0207650_10094765 | 3300025925 | Bacteria | 2288 |
| 322 | Ga0207650_10279214 | 3300025925 | Bacteria | 1360 |
| 323 | Ga0207650_10463838 | 3300025925 | Bacteria | 1055 |
| 324 | Ga0207659_10144909 | 3300025926 | Bacteria | 1848 |
| 325 | Ga0207659_10250390 | 3300025926 | Bacteria | 1437 |
| 326 | Ga0207659_10294927 | 3300025926 | Bacteria | 1330 |
| 327 | Ga0207659_10829355 | 3300025926 | Bacteria | 795 |
| 328 | Ga0207659_11386765 | 3300025926 | Bacteria | 603 |
| 329 | Ga0207659_11470757 | 3300025926 | Unclassified | 583 |
| 330 | Ga0207687_10331509 | 3300025927 | Unclassified | 1235 |
| 331 | Ga0207644_10044561 | 3300025931 | Bacteria | 3152 |
| 332 | Ga0207706_10031804 | 3300025933 | Bacteria | 4699 |
| 333 | Ga0207706_10036781 | 3300025933 | Unclassified | 4348 |
| 334 | Ga0207706_10454890 | 3300025933 | Bacteria | 1107 |
| 335 | Ga0207706_10546629 | 3300025933 | Bacteria | 997 |
| 336 | Ga0207686_10001766 | 3300025934 | Bacteria | 12028 |
| 337 | Ga0207709_10581915 | 3300025935 | Unclassified | 884 |
| 338 | Ga0207670_10002352 | 3300025936 | Bacteria | 9907 |
| 339 | Ga0207670_10020981 | 3300025936 | Bacteria | 4023 |
| 340 | Ga0207670_10344666 | 3300025936 | Unclassified | 1178 |
| 341 | Ga0207669_11102418 | 3300025937 | Unclassified | 670 |
| 342 | Ga0207704_10381769 | 3300025938 | Bacteria | 1106 |
| 343 | Ga0207704_10441076 | 3300025938 | Unclassified | 1037 |
| 344 | Ga0207704_10845247 | 3300025938 | Unclassified | 767 |
| 345 | Ga0207691_10000012 | 3300025940 | Bacteria | 147942 |
| 346 | Ga0207691_10001776 | 3300025940 | Bacteria | 21223 |
| 347 | Ga0207691_10026934 | 3300025940 | Bacteria | 5393 |
| 348 | Ga0207691_10218251 | 3300025940 | Bacteria | 1654 |
| 349 | Ga0207691_11043248 | 3300025940 | Bacteria | 681 |
| 350 | Ga0207711_10088381 | 3300025941 | Bacteria | 2721 |
| 351 | Ga0207711_11992990 | 3300025941 | Unclassified | 523 |
| 352 | Ga0207689_10046539 | 3300025942 | Bacteria | 3585 |
| 353 | Ga0207689_10269254 | 3300025942 | Bacteria | 1410 |
| 354 | Ga0207679_10054424 | 3300025945 | Bacteria | 2946 |
| 355 | Ga0207667_10698113 | 3300025949 | Bacteria | 1017 |
| 356 | Ga0207651_10000216 | 3300025960 | Bacteria | 24808 |
| 357 | Ga0207651_10057394 | 3300025960 | Bacteria | 2685 |
| 358 | Ga0207651_10128181 | 3300025960 | Bacteria | 1937 |
| 359 | Ga0207651_10346578 | 3300025960 | Bacteria | 1249 |
| 360 | Ga0207651_10752529 | 3300025960 | Bacteria | 861 |
| 361 | Ga0207712_10006134 | 3300025961 | Bacteria | 7578 |
| 362 | Ga0207712_10011299 | 3300025961 | Bacteria | 5684 |
| 363 | Ga0207712_10012082 | 3300025961 | Bacteria | 5513 |
| 364 | Ga0207712_10364743 | 3300025961 | Bacteria | 1204 |
| 365 | Ga0207668_10001361 | 3300025972 | Bacteria | 14445 |
| 366 | Ga0207668_10283661 | 3300025972 | Bacteria | 1359 |
| 367 | Ga0207668_10935222 | 3300025972 | Bacteria | 773 |
| 368 | Ga0207668_11964447 | 3300025972 | Bacteria | 527 |
| 369 | Ga0207640_10128000 | 3300025981 | Bacteria | 1831 |
| 370 | Ga0207640_10642371 | 3300025981 | Unclassified | 903 |
| 371 | Ga0207658_10000374 | 3300025986 | Bacteria | 43784 |
| 372 | Ga0207658_10150153 | 3300025986 | Bacteria | 1897 |
| 373 | Ga0207658_10262861 | 3300025986 | Bacteria | 1471 |
| 374 | Ga0207677_10000984 | 3300026023 | Bacteria | 15691 |
| 375 | Ga0207677_10060994 | 3300026023 | Unclassified | 2609 |
| 376 | Ga0207677_10116924 | 3300026023 | Bacteria | 1998 |
| 377 | Ga0207677_10884259 | 3300026023 | Unclassified | 804 |
| 378 | Ga0207677_11508154 | 3300026023 | Bacteria | 621 |
| 379 | Ga0207703_10019138 | 3300026035 | Bacteria | 5348 |
| 380 | Ga0207703_10078395 | 3300026035 | Bacteria | 2745 |
| 381 | Ga0207703_10513343 | 3300026035 | Unclassified | 1126 |
| 382 | Ga0207639_10016498 | 3300026041 | Bacteria | 5229 |
| 383 | Ga0207639_11209399 | 3300026041 | Bacteria | 709 |
| 384 | Ga0207708_10393671 | 3300026075 | Bacteria | 1144 |
| 385 | Ga0207708_10619445 | 3300026075 | Bacteria | 918 |
| 386 | Ga0207641_10000549 | 3300026088 | Bacteria | 42051 |
| 387 | Ga0207641_10007761 | 3300026088 | Bacteria | 8917 |
| 388 | Ga0207641_10127104 | 3300026088 | Bacteria | 2284 |
| 389 | Ga0207641_10188413 | 3300026088 | Bacteria | 1894 |
| 390 | Ga0207641_10309805 | 3300026088 | Bacteria | 1494 |
| 391 | Ga0207641_10586385 | 3300026088 | Bacteria | 1090 |
| 392 | Ga0207648_10012970 | 3300026089 | Bacteria | 7778 |
| 393 | Ga0207648_10253340 | 3300026089 | Bacteria | 1570 |
| 394 | Ga0207648_10399598 | 3300026089 | Bacteria | 1245 |
| 395 | Ga0207648_10403188 | 3300026089 | Bacteria | 1239 |
| 396 | Ga0207676_10017316 | 3300026095 | Bacteria | 5223 |
| 397 | Ga0207676_10058856 | 3300026095 | Bacteria | 3032 |
| 398 | Ga0207676_10086780 | 3300026095 | Bacteria | 2557 |
| 399 | Ga0207674_10168304 | 3300026116 | Bacteria | 2145 |
| 400 | Ga0207674_10386433 | 3300026116 | Unclassified | 1353 |
| 401 | Ga0207675_100002745 | 3300026118 | Bacteria | 17311 |
| 402 | Ga0207675_100082732 | 3300026118 | Bacteria | 3011 |
| 403 | Ga0207675_100314173 | 3300026118 | Bacteria | 1529 |
| 404 | Ga0207675_100886530 | 3300026118 | Bacteria | 908 |
| 405 | Ga0207675_100905029 | 3300026118 | Bacteria | 899 |
| 406 | Ga0207675_101240568 | 3300026118 | Unclassified | 766 |
| 407 | Ga0207683_10038720 | 3300026121 | Bacteria | 4158 |
| 408 | Ga0207683_10047913 | 3300026121 | Bacteria | 3742 |
| 409 | Ga0207683_10131329 | 3300026121 | Unclassified | 2253 |
| 410 | Ga0207683_10655878 | 3300026121 | Bacteria | 972 |
| 411 | Ga0207698_10009340 | 3300026142 | Bacteria | 6249 |
| 412 | Ga0207698_10734721 | 3300026142 | Bacteria | 985 |
| 413 | Ga0207428_10040954 | 3300027907 | Bacteria | 3752 |
| 414 | Ga0207428_10166363 | 3300027907 | Bacteria | 1672 |
| 415 | Ga0207428_10895158 | 3300027907 | Bacteria | 627 |
| 416 | Ga0268266_10005379 | 3300028379 | Bacteria | 11960 |
| 417 | Ga0268265_10022623 | 3300028380 | Bacteria | 4419 |
| 418 | Ga0268265_10054023 | 3300028380 | Bacteria | 3045 |
| 419 | Ga0268265_10481603 | 3300028380 | Bacteria | 1165 |
| 420 | Ga0268264_10003975 | 3300028381 | Bacteria | 12651 |
| 421 | Ga0268264_10050397 | 3300028381 | Bacteria | 3467 |
| 422 | Ga0268264_10348450 | 3300028381 | Bacteria | 1409 |
| 423 | Ga0268264_11693305 | 3300028381 | Bacteria | 643 |
| 424 | Ga0268264_11965261 | 3300028381 | Unclassified | 594 |
| 425 | Ga0265327_10016784 | 3300031251 | Bacteria | 4628 |
| 426 | Ga0265327_10025288 | 3300031251 | Bacteria | 3466 |
| 427 | Ga0265327_10079493 | 3300031251 | Bacteria | 1623 |
| 428 | Ga0307408_101157596 | 3300031548 | Bacteria | 720 |
| 429 | Ga0307516_10254821 | 3300031730 | Unclassified | 1448 |
| 430 | Ga0307413_10096242 | 3300031824 | Bacteria | 1943 |
| 431 | Ga0307413_10480622 | 3300031824 | Unclassified | 993 |
| 432 | Ga0307406_10790915 | 3300031901 | Bacteria | 800 |
| 433 | Ga0307414_10832410 | 3300032004 | Unclassified | 843 |
| 434 | Ga0307414_10920717 | 3300032004 | Bacteria | 802 |
| 435 | Ga0307411_10828499 | 3300032005 | Bacteria | 817 |
| 436 | Ga0307415_100117466 | 3300032126 | Bacteria | 1987 |
| 437 | Ga0373937_0552868 | 3300036401 | Bacteria | 1093 |
| 438 | Ga0395905_0000880 | 3300037471 | Bacteria | 39152 |
| 439 | Ga0395905_0039564 | 3300037471 | Bacteria | 4424 |
| 440 | Ga0436365_1760299 | 3300039437 | Unclassified | 755 |
| 441 | Ga0439439_0018629 | 3300041406 | Bacteria | 1717 |
| 442 | Ga0439453_0059931 | 3300041408 | Bacteria | 786 |
| 443 | Ga0439465_0064822 | 3300041413 | Bacteria | 1216 |
| 444 | Ga0451791_1774381 | 3300041451 | Unclassified | 765 |
| 445 | Ga0451798_1146056 | 3300041458 | Bacteria | 518 |
| 446 | Ga0451837_0296872 | 3300041494 | Bacteria | 592 |
| 447 | Ga0451839_0566319 | 3300041496 | Bacteria | 947 |
| 448 | Ga0439445_0150918 | 3300042004 | Bacteria | 676 |
| 449 | Ga0439449_0064504 | 3300042007 | Bacteria | 1351 |
| 450 | Ga0439457_006726 | 3300042014 | Bacteria | 2793 |
| 451 | Ga0439457_018711 | 3300042014 | Unclassified | 1539 |
| 452 | Ga0450923_014686 | 3300042125 | Bacteria | 1456 |
| 453 | Ga0450896_009261 | 3300042133 | Bacteria | 1371 |
| 454 | Ga0450898_005828 | 3300042134 | Unclassified | 1876 |
| 455 | Ga0439446_0074793 | 3300042156 | Bacteria | 1041 |
| 456 | Ga0439434_0228952 | 3300042435 | Bacteria | 632 |
| 457 | Ga0439444_0004901 | 3300042437 | Bacteria | 1964 |
| 458 | Ga0451577_0017795 | 3300042876 | Bacteria | 6558 |
| 459 | Ga0451577_0474241 | 3300042876 | Unclassified | 1136 |
| 460 | Ga0453684_0164175 | 3300044712 | Bacteria | 2624 |
| 461 | Ga0453684_0885089 | 3300044712 | Unclassified | 957 |
| 462 | Ga0466970_0005316 | 3300044765 | Bacteria | 6382 |
| 463 | Ga0495594_0187864 | 3300046499 | Unclassified | 1177 |
| 464 | Ga0495630_0173378 | 3300046517 | Unclassified | 1644 |
| 465 | Ga0495663_0082900 | 3300046525 | Bacteria | 1035 |
| 466 | Ga0495598_0091182 | 3300046537 | Bacteria | 994 |
| 467 | Ga0495621_0021199 | 3300046539 | Bacteria | 2140 |
| 468 | Ga0495668_0000242 | 3300046616 | Bacteria | 78022 |
| 469 | Ga0495634_0500425 | 3300046642 | Bacteria | 712 |
| 470 | Ga0495600_0493818 | 3300046809 | Bacteria | 753 |
| 471 | Ga0495674_0222354 | 3300047319 | Bacteria | 1560 |
| 472 | Ga0495677_0411487 | 3300047445 | Bacteria | 535 |
| 473 | Ga0496104_0575647 | 3300048907 | Bacteria | 1037 |
| 474 | Ga0496109_0057555 | 3300048912 | Bacteria | 3549 |
| 475 | Ga0501291_145651 | 3300049514 | Unclassified | 531 |
| 476 | Ga0501292_004172 | 3300049515 | Bacteria | 1963 |
| 477 | Ga0501292_027337 | 3300049515 | Bacteria | 945 |
| 478 | Ga0501032_0006362 | 3300049569 | Bacteria | 8705 |
| 479 | Ga0501032_0016376 | 3300049569 | Bacteria | 5216 |
| 480 | Ga0501032_0031070 | 3300049569 | Bacteria | 3663 |
| 481 | Ga0501034_0006235 | 3300049571 | Bacteria | 12837 |
| 482 | Ga0501034_0081604 | 3300049571 | Unclassified | 3236 |
| 483 | Ga0501034_0244563 | 3300049571 | Bacteria | 1739 |
| 484 | Ga0501034_0303925 | 3300049571 | Unclassified | 1531 |
| 485 | Ga0501034_0431823 | 3300049571 | Unclassified | 1237 |
| 486 | Ga0501036_0017337 | 3300049572 | Bacteria | 6019 |
| 487 | Ga0501036_0670469 | 3300049572 | Unclassified | 858 |
| 488 | Ga0501038_0041309 | 3300049574 | Bacteria | 4022 |
| 489 | Ga0501038_0322934 | 3300049574 | Bacteria | 1207 |
| 490 | Ga0501039_0012185 | 3300049575 | Bacteria | 6555 |
| 491 | Ga0501043_0004908 | 3300049579 | Bacteria | 10810 |
| 492 | Ga0501043_0079534 | 3300049579 | Bacteria | 2576 |
| 493 | Ga0501043_1329545 | 3300049579 | Unclassified | 501 |
| 494 | Ga0501046_0003782 | 3300049580 | Bacteria | 13851 |
| 495 | Ga0501046_0715626 | 3300049580 | Unclassified | 705 |
| 496 | Ga0501047_0019301 | 3300049581 | Bacteria | 6540 |
| 497 | Ga0501047_0063478 | 3300049581 | Bacteria | 3563 |
| 498 | Ga0501047_0144031 | 3300049581 | Bacteria | 2261 |
| 499 | Ga0501048_0060437 | 3300049582 | Bacteria | 2685 |
| 500 | Ga0501067_0469522 | 3300049583 | Bacteria | 703 |
| 501 | Ga0501069_0115940 | 3300049585 | Bacteria | 1528 |
| 502 | Ga0501070_0008000 | 3300049586 | Bacteria | 8953 |
| 503 | Ga0501073_0006191 | 3300049589 | Bacteria | 8928 |
| 504 | Ga0501074_0008812 | 3300049590 | Bacteria | 7313 |
| 505 | Ga0501198_001549 | 3300049649 | Bacteria | 3025 |
| 506 | Ga0501202_192313 | 3300049652 | Bacteria | 555 |
| 507 | Ga0501207_006685 | 3300049654 | Bacteria | 1627 |
| 508 | Ga0501209_191335 | 3300049656 | Bacteria | 627 |
| 509 | Ga0501217_000662 | 3300049661 | Bacteria | 5835 |
| 510 | Ga0501217_016471 | 3300049661 | Bacteria | 1694 |
| 511 | Ga0501223_001821 | 3300049663 | Bacteria | 4814 |
| 512 | Ga0501223_125529 | 3300049663 | Bacteria | 544 |
| 513 | Ga0501224_000573 | 3300049664 | Bacteria | 4517 |
| 514 | Ga0501228_028460 | 3300049666 | Bacteria | 672 |
| 515 | Ga0501230_025057 | 3300049667 | Bacteria | 1073 |
| 516 | Ga0501233_008589 | 3300049668 | Bacteria | 1973 |
| 517 | Ga0501240_004003 | 3300049673 | Bacteria | 1682 |
| 518 | Ga0501242_015403 | 3300049674 | Bacteria | 953 |
| 519 | Ga0501243_002316 | 3300049675 | Bacteria | 2779 |
| 520 | Ga0501246_051710 | 3300049676 | Unclassified | 515 |
| 521 | Ga0501249_054667 | 3300049679 | Bacteria | 919 |
| 522 | Ga0501251_002823 | 3300049681 | Bacteria | 1704 |
| 523 | Ga0501252_015849 | 3300049682 | Bacteria | 944 |
| 524 | Ga0501252_077554 | 3300049682 | Bacteria | 545 |
| 525 | Ga0501253_023066 | 3300049683 | Bacteria | 1115 |
| 526 | Ga0501255_011460 | 3300049684 | Bacteria | 1022 |
| 527 | Ga0501256_001315 | 3300049685 | Bacteria | 1811 |
| 528 | Ga0501257_030627 | 3300049686 | Bacteria | 1296 |
| 529 | Ga0501259_000701 | 3300049688 | Bacteria | 5410 |
| 530 | Ga0501259_031059 | 3300049688 | Bacteria | 1009 |
| 531 | Ga0501221_000086 | 3300049704 | Bacteria | 10739 |
| 532 | Ga0501221_253031 | 3300049704 | Bacteria | 507 |
| 533 | Ga0501225_0007974 | 3300049705 | Bacteria | 3051 |
| 534 | Ga0501234_020266 | 3300049707 | Bacteria | 1057 |
| 535 | Ga0501234_093916 | 3300049707 | Bacteria | 540 |
| 536 | Ga0501245_000771 | 3300049708 | Bacteria | 3999 |
| 537 | Ga0501245_099573 | 3300049708 | Bacteria | 587 |
| 538 | Ga0501079_0712128 | 3300049741 | Bacteria | 790 |
| 539 | Ga0501080_0053288 | 3300049742 | Bacteria | 3765 |
| 540 | Ga0501080_1605619 | 3300049742 | Bacteria | 551 |
| 541 | Ga0501083_0135584 | 3300049744 | Bacteria | 1613 |
| 542 | Ga0501241_015454 | 3300049758 | Bacteria | 1389 |
| 543 | Ga0501265_008678 | 3300049762 | Bacteria | 1216 |
| 544 | Ga0501268_002840 | 3300049765 | Bacteria | 2319 |
| 545 | Ga0501268_033164 | 3300049765 | Bacteria | 944 |
| 546 | Ga0501270_124184 | 3300049767 | Bacteria | 565 |
| 547 | Ga0501283_049519 | 3300049779 | Bacteria | 742 |
| 548 | Ga0501035_0005857 | 3300049822 | Bacteria | 11590 |
| 549 | Ga0501035_0017112 | 3300049822 | Bacteria | 6680 |
| 550 | Ga0501035_0326276 | 3300049822 | Bacteria | 1289 |
| 551 | Ga0501044_0009331 | 3300049823 | Bacteria | 10705 |
| 552 | Ga0501044_0297995 | 3300049823 | Bacteria | 1542 |
| 553 | Ga0501204_046342 | 3300049850 | Bacteria | 653 |
| 554 | Ga0501212_026447 | 3300049851 | Bacteria | 920 |
| 555 | nmdc:mga0k408_72214_c1 | 3300050493 | Bacteria | 2015 |
| 556 | nmdc:mga05p37_126978_c1 | 3300050507 | Unclassified | 3131 |
| 557 | nmdc:mga05p37_2034069_c1 | 3300050507 | Bacteria | 542 |
| 558 | nmdc:mga09592_15108_c1 | 3300050508 | Bacteria | 6308 |
| 559 | nmdc:mga09592_1676305_c1 | 3300050508 | Unclassified | 513 |
| 560 | nmdc:mga0qj67_242207_c1 | 3300050509 | Unclassified | 1463 |
| 561 | nmdc:mga06r32_18180_c1 | 3300050510 | Bacteria | 6431 |
| 562 | nmdc:mga08y16_195739_c1 | 3300050511 | Bacteria | 2095 |
| 563 | nmdc:mga08y16_20692_c1 | 3300050511 | Bacteria | 6944 |
| 564 | nmdc:mga08y16_248913_c1 | 3300050511 | Bacteria | 1836 |
| 565 | nmdc:mga08y16_583919_c1 | 3300050511 | Bacteria | 1128 |
| 566 | nmdc:mga08y16_621409_c1 | 3300050511 | Bacteria | 1087 |
| 567 | nmdc:mga0rr50_1712549_c1 | 3300050513 | Unclassified | 530 |
| 568 | Ga0500618_022626 | 3300053125 | Bacteria | 1526 |
| 569 | Ga0500568_0003666 | 3300053139 | Bacteria | 8443 |
| 570 | Ga0500573_0544617 | 3300053140 | Bacteria | 515 |
| 571 | Ga0501082_0020131 | 3300060353 | Bacteria | 5750 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006358 | Ga0068871_102188288 | Ga0068871_1021882881 | 114 |
| 2 | 3300005614 | Ga0068856_100633016 | Ga0068856_1006330162 | 118 |
| 3 | 3300049765 | Ga0501268_033164 | Ga0501268_033164_209_565 | 118 |
| 4 | 3300005338 | Ga0068868_100807160 | Ga0068868_1008071601 | 119 |
| 5 | 3300005843 | Ga0068860_100003309 | Ga0068860_1000033096 | 119 |
| 6 | 3300006237 | Ga0097621_100551417 | Ga0097621_1005514172 | 119 |
| 7 | 3300009545 | Ga0105237_10800921 | Ga0105237_108009212 | 119 |
| 8 | 3300010375 | Ga0105239_10071591 | Ga0105239_100715916 | 119 |
| 9 | 3300013296 | Ga0157374_10852005 | Ga0157374_108520051 | 119 |
| 10 | 3300013306 | Ga0163162_10004060 | Ga0163162_100040605 | 119 |
| 11 | 3300014968 | Ga0157379_10925384 | Ga0157379_109253842 | 119 |
| 12 | 3300026023 | Ga0207677_10884259 | Ga0207677_108842592 | 119 |
| 13 | 3300028381 | Ga0268264_10050397 | Ga0268264_100503971 | 119 |
| 14 | 3300031251 | Ga0265327_10016784 | Ga0265327_100167844 | 119 |
| 15 | 3300031548 | Ga0307408_101157596 | Ga0307408_1011575962 | 119 |
| 16 | 3300039437 | Ga0436365_1760299 | Ga0436365_1760299_11_370 | 119 |
| 17 | 3300049571 | Ga0501034_0431823 | Ga0501034_0431823_601_960 | 119 |
| 18 | 3300049682 | Ga0501252_077554 | Ga0501252_077554_56_415 | 119 |
| 19 | 3300049779 | Ga0501283_049519 | Ga0501283_049519_348_707 | 119 |
| 20 | 3300053125 | Ga0500618_022626 | Ga0500618_022626_1077_1436 | 119 |
| 21 | 3300053140 | Ga0500573_0544617 | Ga0500573_0544617_121_480 | 119 |
| 22 | 3300005327 | Ga0070658_11213680 | Ga0070658_112136801 | 120 |
| 23 | 3300013105 | Ga0157369_10247260 | Ga0157369_102472602 | 120 |
| 24 | 3300013307 | Ga0157372_10073469 | Ga0157372_100734692 | 120 |
| 25 | 3300041451 | Ga0451791_1774381 | Ga0451791_1774381_153_515 | 120 |
| 26 | 3300042876 | Ga0451577_0474241 | Ga0451577_0474241_298_660 | 120 |
| 27 | 3300044712 | Ga0453684_0164175 | Ga0453684_0164175_2136_2498 | 120 |
| 28 | 3300046616 | Ga0495668_0000242 | Ga0495668_0000242_335_697 | 120 |
| 29 | 3300049569 | Ga0501032_0016376 | Ga0501032_0016376_2885_3247 | 120 |
| 30 | 3300049571 | Ga0501034_0081604 | Ga0501034_0081604_2127_2489 | 120 |
| 31 | 3300049574 | Ga0501038_0322934 | Ga0501038_0322934_32_394 | 120 |
| 32 | 3300049579 | Ga0501043_0079534 | Ga0501043_0079534_978_1340 | 120 |
| 33 | 3300049822 | Ga0501035_0326276 | Ga0501035_0326276_131_493 | 120 |
| 34 | 3300049823 | Ga0501044_0297995 | Ga0501044_0297995_1010_1372 | 120 |
| 35 | 3300005327 | Ga0070658_10001648 | Ga0070658_100016489 | 121 |
| 36 | 3300005328 | Ga0070676_10001113 | Ga0070676_1000111310 | 121 |
| 37 | 3300005334 | Ga0068869_100007522 | Ga0068869_1000075228 | 121 |
| 38 | 3300005334 | Ga0068869_100131493 | Ga0068869_1001314933 | 121 |
| 39 | 3300005335 | Ga0070666_10000358 | Ga0070666_100003586 | 121 |
| 40 | 3300005338 | Ga0068868_100000187 | Ga0068868_10000018734 | 121 |
| 41 | 3300005338 | Ga0068868_101604535 | Ga0068868_1016045352 | 121 |
| 42 | 3300005339 | Ga0070660_100706540 | Ga0070660_1007065401 | 121 |
| 43 | 3300005340 | Ga0070689_100568876 | Ga0070689_1005688762 | 121 |
| 44 | 3300005344 | Ga0070661_100466500 | Ga0070661_1004665002 | 121 |
| 45 | 3300005347 | Ga0070668_100003714 | Ga0070668_1000037147 | 121 |
| 46 | 3300005353 | Ga0070669_100066435 | Ga0070669_1000664352 | 121 |
| 47 | 3300005354 | Ga0070675_100323287 | Ga0070675_1003232872 | 121 |
| 48 | 3300005356 | Ga0070674_100672004 | Ga0070674_1006720042 | 121 |
| 49 | 3300005364 | Ga0070673_100000124 | Ga0070673_1000001247 | 121 |
| 50 | 3300005367 | Ga0070667_100000980 | Ga0070667_1000009807 | 121 |
| 51 | 3300005367 | Ga0070667_100504135 | Ga0070667_1005041352 | 121 |
| 52 | 3300005455 | Ga0070663_100087774 | Ga0070663_1000877743 | 121 |
| 53 | 3300005456 | Ga0070678_100614875 | Ga0070678_1006148752 | 121 |
| 54 | 3300005457 | Ga0070662_100010835 | Ga0070662_1000108357 | 121 |
| 55 | 3300005459 | Ga0068867_100022992 | Ga0068867_1000229926 | 121 |
| 56 | 3300005466 | Ga0070685_10254127 | Ga0070685_102541272 | 121 |
| 57 | 3300005535 | Ga0070684_100259776 | Ga0070684_1002597762 | 121 |
| 58 | 3300005539 | Ga0068853_100002569 | Ga0068853_1000025699 | 121 |
| 59 | 3300005543 | Ga0070672_100000105 | Ga0070672_10000010530 | 121 |
| 60 | 3300005548 | Ga0070665_100000635 | Ga0070665_10000063530 | 121 |
| 61 | 3300005563 | Ga0068855_100072463 | Ga0068855_1000724636 | 121 |
| 62 | 3300005564 | Ga0070664_100587894 | Ga0070664_1005878943 | 121 |
| 63 | 3300005577 | Ga0068857_100411900 | Ga0068857_1004119002 | 121 |
| 64 | 3300005578 | Ga0068854_100069273 | Ga0068854_1000692733 | 121 |
| 65 | 3300005614 | Ga0068856_100125471 | Ga0068856_1001254714 | 121 |
| 66 | 3300005616 | Ga0068852_100043934 | Ga0068852_1000439345 | 121 |
| 67 | 3300005616 | Ga0068852_100553120 | Ga0068852_1005531202 | 121 |
| 68 | 3300005617 | Ga0068859_100016832 | Ga0068859_1000168327 | 121 |
| 69 | 3300005618 | Ga0068864_100006131 | Ga0068864_1000061312 | 121 |
| 70 | 3300005719 | Ga0068861_100094835 | Ga0068861_1000948351 | 121 |
| 71 | 3300005834 | Ga0068851_10016169 | Ga0068851_100161696 | 121 |
| 72 | 3300005840 | Ga0068870_11461334 | Ga0068870_114613342 | 121 |
| 73 | 3300005841 | Ga0068863_100001976 | Ga0068863_1000019765 | 121 |
| 74 | 3300005841 | Ga0068863_100671912 | Ga0068863_1006719121 | 121 |
| 75 | 3300005842 | Ga0068858_100010584 | Ga0068858_1000105847 | 121 |
| 76 | 3300005842 | Ga0068858_100053682 | Ga0068858_1000536824 | 121 |
| 77 | 3300005843 | Ga0068860_100001418 | Ga0068860_10000141819 | 121 |
| 78 | 3300005844 | Ga0068862_100543410 | Ga0068862_1005434102 | 121 |
| 79 | 3300005844 | Ga0068862_101410931 | Ga0068862_1014109311 | 121 |
| 80 | 3300006237 | Ga0097621_100001817 | Ga0097621_1000018175 | 121 |
| 81 | 3300006358 | Ga0068871_100009967 | Ga0068871_1000099679 | 121 |
| 82 | 3300006881 | Ga0068865_100689512 | Ga0068865_1006895122 | 121 |
| 83 | 3300006881 | Ga0068865_101481619 | Ga0068865_1014816192 | 121 |
| 84 | 3300006931 | Ga0097620_100016833 | Ga0097620_1000168334 | 121 |
| 85 | 3300009093 | Ga0105240_10076297 | Ga0105240_100762972 | 121 |
| 86 | 3300009098 | Ga0105245_10123697 | Ga0105245_101236973 | 121 |
| 87 | 3300009101 | Ga0105247_10017539 | Ga0105247_100175396 | 121 |
| 88 | 3300009148 | Ga0105243_10662056 | Ga0105243_106620562 | 121 |
| 89 | 3300009174 | Ga0105241_10008820 | Ga0105241_100088209 | 121 |
| 90 | 3300009174 | Ga0105241_10372697 | Ga0105241_103726972 | 121 |
| 91 | 3300009176 | Ga0105242_10341964 | Ga0105242_103419642 | 121 |
| 92 | 3300009177 | Ga0105248_10025712 | Ga0105248_100257128 | 121 |
| 93 | 3300009551 | Ga0105238_10097951 | Ga0105238_100979512 | 121 |
| 94 | 3300009553 | Ga0105249_10002678 | Ga0105249_1000267814 | 121 |
| 95 | 3300009553 | Ga0105249_10020437 | Ga0105249_100204375 | 121 |
| 96 | 3300010375 | Ga0105239_10141040 | Ga0105239_101410403 | 121 |
| 97 | 3300013105 | Ga0157369_12235688 | Ga0157369_122356881 | 121 |
| 98 | 3300013296 | Ga0157374_10002980 | Ga0157374_100029807 | 121 |
| 99 | 3300013297 | Ga0157378_10013251 | Ga0157378_100132517 | 121 |
| 100 | 3300013306 | Ga0163162_10000312 | Ga0163162_1000031230 | 121 |
| 101 | 3300013307 | Ga0157372_10332960 | Ga0157372_103329602 | 121 |
| 102 | 3300013307 | Ga0157372_11919917 | Ga0157372_119199172 | 121 |
| 103 | 3300013308 | Ga0157375_10002871 | Ga0157375_100028719 | 121 |
| 104 | 3300014325 | Ga0163163_10000346 | Ga0163163_1000034622 | 121 |
| 105 | 3300014325 | Ga0163163_10057583 | Ga0163163_100575833 | 121 |
| 106 | 3300014968 | Ga0157379_10000242 | Ga0157379_1000024216 | 121 |
| 107 | 3300014969 | Ga0157376_10002821 | Ga0157376_100028218 | 121 |
| 108 | 3300014969 | Ga0157376_10229136 | Ga0157376_102291363 | 121 |
| 109 | 3300017792 | Ga0163161_10116704 | Ga0163161_101167043 | 121 |
| 110 | 3300025321 | Ga0207656_10004467 | Ga0207656_100044672 | 121 |
| 111 | 3300025903 | Ga0207680_10003927 | Ga0207680_100039276 | 121 |
| 112 | 3300025904 | Ga0207647_10227495 | Ga0207647_102274952 | 121 |
| 113 | 3300025907 | Ga0207645_10001794 | Ga0207645_100017947 | 121 |
| 114 | 3300025909 | Ga0207705_10017600 | Ga0207705_100176002 | 121 |
| 115 | 3300025911 | Ga0207654_10070468 | Ga0207654_100704684 | 121 |
| 116 | 3300025912 | Ga0207707_11463064 | Ga0207707_114630641 | 121 |
| 117 | 3300025913 | Ga0207695_10261753 | Ga0207695_102617533 | 121 |
| 118 | 3300025923 | Ga0207681_10057500 | Ga0207681_100575002 | 121 |
| 119 | 3300025926 | Ga0207659_10294927 | Ga0207659_102949272 | 121 |
| 120 | 3300025927 | Ga0207687_10331509 | Ga0207687_103315092 | 121 |
| 121 | 3300025933 | Ga0207706_10031804 | Ga0207706_100318043 | 121 |
| 122 | 3300025935 | Ga0207709_10581915 | Ga0207709_105819152 | 121 |
| 123 | 3300025938 | Ga0207704_10381769 | Ga0207704_103817691 | 121 |
| 124 | 3300025938 | Ga0207704_10441076 | Ga0207704_104410762 | 121 |
| 125 | 3300025940 | Ga0207691_10000012 | Ga0207691_1000001266 | 121 |
| 126 | 3300025941 | Ga0207711_10088381 | Ga0207711_100883811 | 121 |
| 127 | 3300025945 | Ga0207679_10054424 | Ga0207679_100544242 | 121 |
| 128 | 3300025949 | Ga0207667_10698113 | Ga0207667_106981132 | 121 |
| 129 | 3300025960 | Ga0207651_10000216 | Ga0207651_100002167 | 121 |
| 130 | 3300025961 | Ga0207712_10011299 | Ga0207712_100112997 | 121 |
| 131 | 3300025972 | Ga0207668_10001361 | Ga0207668_100013619 | 121 |
| 132 | 3300025981 | Ga0207640_10642371 | Ga0207640_106423712 | 121 |
| 133 | 3300025986 | Ga0207658_10000374 | Ga0207658_1000037435 | 121 |
| 134 | 3300025986 | Ga0207658_10150153 | Ga0207658_101501532 | 121 |
| 135 | 3300026023 | Ga0207677_10000984 | Ga0207677_100009847 | 121 |
| 136 | 3300026023 | Ga0207677_11508154 | Ga0207677_115081541 | 121 |
| 137 | 3300026035 | Ga0207703_10019138 | Ga0207703_100191386 | 121 |
| 138 | 3300026035 | Ga0207703_10078395 | Ga0207703_100783952 | 121 |
| 139 | 3300026041 | Ga0207639_10016498 | Ga0207639_100164985 | 121 |
| 140 | 3300026088 | Ga0207641_10007761 | Ga0207641_100077615 | 121 |
| 141 | 3300026088 | Ga0207641_10309805 | Ga0207641_103098053 | 121 |
| 142 | 3300026089 | Ga0207648_10012970 | Ga0207648_100129702 | 121 |
| 143 | 3300026095 | Ga0207676_10017316 | Ga0207676_100173167 | 121 |
| 144 | 3300026095 | Ga0207676_10058856 | Ga0207676_100588565 | 121 |
| 145 | 3300026116 | Ga0207674_10386433 | Ga0207674_103864331 | 121 |
| 146 | 3300026121 | Ga0207683_10655878 | Ga0207683_106558782 | 121 |
| 147 | 3300026142 | Ga0207698_10009340 | Ga0207698_100093407 | 121 |
| 148 | 3300028379 | Ga0268266_10005379 | Ga0268266_100053797 | 121 |
| 149 | 3300028380 | Ga0268265_10481603 | Ga0268265_104816032 | 121 |
| 150 | 3300028381 | Ga0268264_10003975 | Ga0268264_100039758 | 121 |
| 151 | 3300031730 | Ga0307516_10254821 | Ga0307516_102548212 | 121 |
| 152 | 3300041494 | Ga0451837_0296872 | Ga0451837_0296872_105_470 | 121 |
| 153 | 3300048907 | Ga0496104_0575647 | Ga0496104_0575647_328_693 | 121 |
| 154 | 3300048912 | Ga0496109_0057555 | Ga0496109_0057555_486_851 | 121 |
| 155 | 3300049579 | Ga0501043_1329545 | Ga0501043_1329545_116_481 | 121 |
| 156 | 3300049580 | Ga0501046_0715626 | Ga0501046_0715626_166_531 | 121 |
| 157 | 3300049581 | Ga0501047_0063478 | Ga0501047_0063478_652_1017 | 121 |
| 158 | 3300049708 | Ga0501245_099573 | Ga0501245_099573_105_470 | 121 |
| 159 | 3300049822 | Ga0501035_0017112 | Ga0501035_0017112_3288_3653 | 121 |
| 160 | 3300053139 | Ga0500568_0003666 | Ga0500568_0003666_5831_6196 | 121 |
| 161 | 3300003322 | rootL2_10200952 | rootL2_102009523 | 122 |
| 162 | 3300005288 | Ga0065714_10182733 | Ga0065714_101827332 | 122 |
| 163 | 3300005289 | Ga0065704_10089928 | Ga0065704_100899282 | 122 |
| 164 | 3300005289 | Ga0065704_10103610 | Ga0065704_101036102 | 122 |
| 165 | 3300005290 | Ga0065712_10002222 | Ga0065712_100022227 | 122 |
| 166 | 3300005290 | Ga0065712_10043539 | Ga0065712_100435391 | 122 |
| 167 | 3300005290 | Ga0065712_10256598 | Ga0065712_102565981 | 122 |
| 168 | 3300005293 | Ga0065715_10005986 | Ga0065715_100059865 | 122 |
| 169 | 3300005293 | Ga0065715_10365032 | Ga0065715_103650322 | 122 |
| 170 | 3300005295 | Ga0065707_10013258 | Ga0065707_100132582 | 122 |
| 171 | 3300005328 | Ga0070676_10837650 | Ga0070676_108376501 | 122 |
| 172 | 3300005330 | Ga0070690_101193792 | Ga0070690_1011937921 | 122 |
| 173 | 3300005331 | Ga0070670_100025113 | Ga0070670_1000251137 | 122 |
| 174 | 3300005331 | Ga0070670_100041225 | Ga0070670_1000412252 | 122 |
| 175 | 3300005331 | Ga0070670_100431519 | Ga0070670_1004315191 | 122 |
| 176 | 3300005331 | Ga0070670_101693224 | Ga0070670_1016932241 | 122 |
| 177 | 3300005333 | Ga0070677_10057798 | Ga0070677_100577981 | 122 |
| 178 | 3300005334 | Ga0068869_100033589 | Ga0068869_1000335896 | 122 |
| 179 | 3300005334 | Ga0068869_100230690 | Ga0068869_1002306902 | 122 |
| 180 | 3300005335 | Ga0070666_10687081 | Ga0070666_106870811 | 122 |
| 181 | 3300005338 | Ga0068868_100994554 | Ga0068868_1009945542 | 122 |
| 182 | 3300005340 | Ga0070689_100013993 | Ga0070689_1000139933 | 122 |
| 183 | 3300005340 | Ga0070689_100018385 | Ga0070689_1000183853 | 122 |
| 184 | 3300005343 | Ga0070687_100697830 | Ga0070687_1006978301 | 122 |
| 185 | 3300005343 | Ga0070687_101438584 | Ga0070687_1014385841 | 122 |
| 186 | 3300005347 | Ga0070668_100106593 | Ga0070668_1001065933 | 122 |
| 187 | 3300005347 | Ga0070668_101506977 | Ga0070668_1015069772 | 122 |
| 188 | 3300005353 | Ga0070669_100004109 | Ga0070669_1000041099 | 122 |
| 189 | 3300005353 | Ga0070669_100891519 | Ga0070669_1008915191 | 122 |
| 190 | 3300005353 | Ga0070669_101251971 | Ga0070669_1012519711 | 122 |
| 191 | 3300005354 | Ga0070675_100007290 | Ga0070675_1000072902 | 122 |
| 192 | 3300005354 | Ga0070675_100070045 | Ga0070675_1000700453 | 122 |
| 193 | 3300005354 | Ga0070675_100419440 | Ga0070675_1004194402 | 122 |
| 194 | 3300005354 | Ga0070675_100620078 | Ga0070675_1006200782 | 122 |
| 195 | 3300005354 | Ga0070675_100996146 | Ga0070675_1009961461 | 122 |
| 196 | 3300005354 | Ga0070675_102046537 | Ga0070675_1020465371 | 122 |
| 197 | 3300005356 | Ga0070674_100372952 | Ga0070674_1003729522 | 122 |
| 198 | 3300005356 | Ga0070674_100614442 | Ga0070674_1006144422 | 122 |
| 199 | 3300005364 | Ga0070673_100020821 | Ga0070673_1000208212 | 122 |
| 200 | 3300005364 | Ga0070673_100256834 | Ga0070673_1002568343 | 122 |
| 201 | 3300005364 | Ga0070673_100630659 | Ga0070673_1006306591 | 122 |
| 202 | 3300005365 | Ga0070688_100021022 | Ga0070688_1000210225 | 122 |
| 203 | 3300005365 | Ga0070688_100024251 | Ga0070688_1000242514 | 122 |
| 204 | 3300005365 | Ga0070688_100110762 | Ga0070688_1001107622 | 122 |
| 205 | 3300005365 | Ga0070688_100261637 | Ga0070688_1002616372 | 122 |
| 206 | 3300005367 | Ga0070667_100295443 | Ga0070667_1002954431 | 122 |
| 207 | 3300005438 | Ga0070701_10233378 | Ga0070701_102333782 | 122 |
| 208 | 3300005440 | Ga0070705_100670508 | Ga0070705_1006705082 | 122 |
| 209 | 3300005441 | Ga0070700_100047150 | Ga0070700_1000471504 | 122 |
| 210 | 3300005441 | Ga0070700_100173095 | Ga0070700_1001730951 | 122 |
| 211 | 3300005444 | Ga0070694_100988799 | Ga0070694_1009887992 | 122 |
| 212 | 3300005459 | Ga0068867_100953814 | Ga0068867_1009538141 | 122 |
| 213 | 3300005459 | Ga0068867_100970919 | Ga0068867_1009709191 | 122 |
| 214 | 3300005466 | Ga0070685_10002080 | Ga0070685_100020809 | 122 |
| 215 | 3300005466 | Ga0070685_10004179 | Ga0070685_100041797 | 122 |
| 216 | 3300005471 | Ga0070698_100001241 | Ga0070698_10000124125 | 122 |
| 217 | 3300005471 | Ga0070698_100024064 | Ga0070698_1000240645 | 122 |
| 218 | 3300005471 | Ga0070698_100055572 | Ga0070698_1000555724 | 122 |
| 219 | 3300005471 | Ga0070698_100239629 | Ga0070698_1002396293 | 122 |
| 220 | 3300005518 | Ga0070699_100150518 | Ga0070699_1001505181 | 122 |
| 221 | 3300005543 | Ga0070672_100030184 | Ga0070672_1000301846 | 122 |
| 222 | 3300005543 | Ga0070672_100706635 | Ga0070672_1007066352 | 122 |
| 223 | 3300005543 | Ga0070672_101413943 | Ga0070672_1014139431 | 122 |
| 224 | 3300005544 | Ga0070686_100140349 | Ga0070686_1001403492 | 122 |
| 225 | 3300005578 | Ga0068854_100146313 | Ga0068854_1001463133 | 122 |
| 226 | 3300005615 | Ga0070702_100132063 | Ga0070702_1001320632 | 122 |
| 227 | 3300005617 | Ga0068859_100099276 | Ga0068859_1000992762 | 122 |
| 228 | 3300005617 | Ga0068859_100158567 | Ga0068859_1001585673 | 122 |
| 229 | 3300005617 | Ga0068859_100456253 | Ga0068859_1004562531 | 122 |
| 230 | 3300005617 | Ga0068859_100561632 | Ga0068859_1005616322 | 122 |
| 231 | 3300005617 | Ga0068859_102028218 | Ga0068859_1020282181 | 122 |
| 232 | 3300005617 | Ga0068859_102467620 | Ga0068859_1024676201 | 122 |
| 233 | 3300005618 | Ga0068864_100136114 | Ga0068864_1001361141 | 122 |
| 234 | 3300005618 | Ga0068864_100136404 | Ga0068864_1001364043 | 122 |
| 235 | 3300005719 | Ga0068861_100023393 | Ga0068861_1000233933 | 122 |
| 236 | 3300005719 | Ga0068861_100033187 | Ga0068861_1000331875 | 122 |
| 237 | 3300005719 | Ga0068861_100413277 | Ga0068861_1004132772 | 122 |
| 238 | 3300005719 | Ga0068861_100884973 | Ga0068861_1008849731 | 122 |
| 239 | 3300005840 | Ga0068870_10168364 | Ga0068870_101683642 | 122 |
| 240 | 3300005840 | Ga0068870_10399345 | Ga0068870_103993452 | 122 |
| 241 | 3300005841 | Ga0068863_100007551 | Ga0068863_1000075518 | 122 |
| 242 | 3300005841 | Ga0068863_100669684 | Ga0068863_1006696843 | 122 |
| 243 | 3300005842 | Ga0068858_100222894 | Ga0068858_1002228942 | 122 |
| 244 | 3300005842 | Ga0068858_101635994 | Ga0068858_1016359941 | 122 |
| 245 | 3300005843 | Ga0068860_100744040 | Ga0068860_1007440401 | 122 |
| 246 | 3300005844 | Ga0068862_100002509 | Ga0068862_10000250910 | 122 |
| 247 | 3300005844 | Ga0068862_100385177 | Ga0068862_1003851772 | 122 |
| 248 | 3300005985 | Ga0081539_10236136 | Ga0081539_102361362 | 122 |
| 249 | 3300006237 | Ga0097621_100199891 | Ga0097621_1001998911 | 122 |
| 250 | 3300006237 | Ga0097621_100506023 | Ga0097621_1005060232 | 122 |
| 251 | 3300006237 | Ga0097621_101553916 | Ga0097621_1015539161 | 122 |
| 252 | 3300006358 | Ga0068871_100010690 | Ga0068871_1000106907 | 122 |
| 253 | 3300006358 | Ga0068871_100375072 | Ga0068871_1003750722 | 122 |
| 254 | 3300006844 | Ga0075428_100040899 | Ga0075428_1000408997 | 122 |
| 255 | 3300006844 | Ga0075428_100672582 | Ga0075428_1006725822 | 122 |
| 256 | 3300006846 | Ga0075430_100239773 | Ga0075430_1002397732 | 122 |
| 257 | 3300006847 | Ga0075431_100299054 | Ga0075431_1002990542 | 122 |
| 258 | 3300006880 | Ga0075429_100015826 | Ga0075429_1000158269 | 122 |
| 259 | 3300006880 | Ga0075429_100477090 | Ga0075429_1004770902 | 122 |
| 260 | 3300006880 | Ga0075429_100609099 | Ga0075429_1006090992 | 122 |
| 261 | 3300006881 | Ga0068865_100017646 | Ga0068865_1000176461 | 122 |
| 262 | 3300006931 | Ga0097620_100099279 | Ga0097620_1000992793 | 122 |
| 263 | 3300006931 | Ga0097620_100158567 | Ga0097620_1001585673 | 122 |
| 264 | 3300006931 | Ga0097620_100456237 | Ga0097620_1004562371 | 122 |
| 265 | 3300006931 | Ga0097620_100561621 | Ga0097620_1005616212 | 122 |
| 266 | 3300006931 | Ga0097620_102028669 | Ga0097620_1020286691 | 122 |
| 267 | 3300006931 | Ga0097620_102467663 | Ga0097620_1024676631 | 122 |
| 268 | 3300009094 | Ga0111539_10006668 | Ga0111539_1000666814 | 122 |
| 269 | 3300009094 | Ga0111539_10117592 | Ga0111539_101175924 | 122 |
| 270 | 3300009094 | Ga0111539_10175593 | Ga0111539_101755933 | 122 |
| 271 | 3300009094 | Ga0111539_10178539 | Ga0111539_101785393 | 122 |
| 272 | 3300009094 | Ga0111539_10258394 | Ga0111539_102583943 | 122 |
| 273 | 3300009094 | Ga0111539_10992133 | Ga0111539_109921332 | 122 |
| 274 | 3300009094 | Ga0111539_13314173 | Ga0111539_133141731 | 122 |
| 275 | 3300009101 | Ga0105247_10001867 | Ga0105247_1000186715 | 122 |
| 276 | 3300009101 | Ga0105247_10133032 | Ga0105247_101330322 | 122 |
| 277 | 3300009147 | Ga0114129_10005331 | Ga0114129_1000533111 | 122 |
| 278 | 3300009147 | Ga0114129_11906917 | Ga0114129_119069172 | 122 |
| 279 | 3300009176 | Ga0105242_10018508 | Ga0105242_100185084 | 122 |
| 280 | 3300009176 | Ga0105242_12284291 | Ga0105242_122842911 | 122 |
| 281 | 3300009553 | Ga0105249_10026181 | Ga0105249_100261813 | 122 |
| 282 | 3300009553 | Ga0105249_10031914 | Ga0105249_100319145 | 122 |
| 283 | 3300009553 | Ga0105249_10037534 | Ga0105249_100375346 | 122 |
| 284 | 3300009553 | Ga0105249_10356050 | Ga0105249_103560501 | 122 |
| 285 | 3300010375 | Ga0105239_13361620 | Ga0105239_133616201 | 122 |
| 286 | 3300013297 | Ga0157378_10452024 | Ga0157378_104520242 | 122 |
| 287 | 3300013306 | Ga0163162_10818473 | Ga0163162_108184732 | 122 |
| 288 | 3300013306 | Ga0163162_11258459 | Ga0163162_112584592 | 122 |
| 289 | 3300013307 | Ga0157372_10571310 | Ga0157372_105713103 | 122 |
| 290 | 3300013307 | Ga0157372_12929480 | Ga0157372_129294801 | 122 |
| 291 | 3300013308 | Ga0157375_10055440 | Ga0157375_100554404 | 122 |
| 292 | 3300013308 | Ga0157375_10058124 | Ga0157375_100581244 | 122 |
| 293 | 3300013308 | Ga0157375_11661213 | Ga0157375_116612132 | 122 |
| 294 | 3300014325 | Ga0163163_10201063 | Ga0163163_102010633 | 122 |
| 295 | 3300014325 | Ga0163163_12512623 | Ga0163163_125126231 | 122 |
| 296 | 3300014326 | Ga0157380_10013625 | Ga0157380_100136254 | 122 |
| 297 | 3300014326 | Ga0157380_10017475 | Ga0157380_100174754 | 122 |
| 298 | 3300014326 | Ga0157380_10040584 | Ga0157380_100405846 | 122 |
| 299 | 3300014326 | Ga0157380_10497993 | Ga0157380_104979932 | 122 |
| 300 | 3300014326 | Ga0157380_13272438 | Ga0157380_132724381 | 122 |
| 301 | 3300014745 | Ga0157377_10020800 | Ga0157377_100208005 | 122 |
| 302 | 3300014745 | Ga0157377_10030434 | Ga0157377_100304342 | 122 |
| 303 | 3300014968 | Ga0157379_10480804 | Ga0157379_104808042 | 122 |
| 304 | 3300014968 | Ga0157379_10791003 | Ga0157379_107910032 | 122 |
| 305 | 3300014969 | Ga0157376_10290128 | Ga0157376_102901282 | 122 |
| 306 | 3300014969 | Ga0157376_10754551 | Ga0157376_107545511 | 122 |
| 307 | 3300017792 | Ga0163161_10039298 | Ga0163161_100392983 | 122 |
| 308 | 3300017792 | Ga0163161_10124184 | Ga0163161_101241842 | 122 |
| 309 | 3300017792 | Ga0163161_10134524 | Ga0163161_101345242 | 122 |
| 310 | 3300025315 | Ga0207697_10085949 | Ga0207697_100859492 | 122 |
| 311 | 3300025315 | Ga0207697_10510406 | Ga0207697_105104062 | 122 |
| 312 | 3300025893 | Ga0207682_10022153 | Ga0207682_100221532 | 122 |
| 313 | 3300025899 | Ga0207642_10547664 | Ga0207642_105476641 | 122 |
| 314 | 3300025900 | Ga0207710_10001574 | Ga0207710_1000157412 | 122 |
| 315 | 3300025908 | Ga0207643_10004498 | Ga0207643_100044986 | 122 |
| 316 | 3300025908 | Ga0207643_10061552 | Ga0207643_100615523 | 122 |
| 317 | 3300025918 | Ga0207662_10011142 | Ga0207662_100111423 | 122 |
| 318 | 3300025922 | Ga0207646_11191288 | Ga0207646_111912881 | 122 |
| 319 | 3300025923 | Ga0207681_10017038 | Ga0207681_100170386 | 122 |
| 320 | 3300025925 | Ga0207650_10094765 | Ga0207650_100947652 | 122 |
| 321 | 3300025925 | Ga0207650_10463838 | Ga0207650_104638382 | 122 |
| 322 | 3300025926 | Ga0207659_10144909 | Ga0207659_101449092 | 122 |
| 323 | 3300025926 | Ga0207659_10250390 | Ga0207659_102503902 | 122 |
| 324 | 3300025926 | Ga0207659_10829355 | Ga0207659_108293551 | 122 |
| 325 | 3300025926 | Ga0207659_11386765 | Ga0207659_113867651 | 122 |
| 326 | 3300025926 | Ga0207659_11470757 | Ga0207659_114707571 | 122 |
| 327 | 3300025933 | Ga0207706_10036781 | Ga0207706_100367816 | 122 |
| 328 | 3300025933 | Ga0207706_10454890 | Ga0207706_104548902 | 122 |
| 329 | 3300025934 | Ga0207686_10001766 | Ga0207686_100017663 | 122 |
| 330 | 3300025936 | Ga0207670_10002352 | Ga0207670_100023525 | 122 |
| 331 | 3300025936 | Ga0207670_10020981 | Ga0207670_100209813 | 122 |
| 332 | 3300025937 | Ga0207669_11102418 | Ga0207669_111024181 | 122 |
| 333 | 3300025940 | Ga0207691_10001776 | Ga0207691_1000177611 | 122 |
| 334 | 3300025940 | Ga0207691_10218251 | Ga0207691_102182513 | 122 |
| 335 | 3300025942 | Ga0207689_10046539 | Ga0207689_100465394 | 122 |
| 336 | 3300025960 | Ga0207651_10057394 | Ga0207651_100573942 | 122 |
| 337 | 3300025960 | Ga0207651_10128181 | Ga0207651_101281813 | 122 |
| 338 | 3300025960 | Ga0207651_10752529 | Ga0207651_107525292 | 122 |
| 339 | 3300025961 | Ga0207712_10006134 | Ga0207712_100061349 | 122 |
| 340 | 3300025961 | Ga0207712_10012082 | Ga0207712_100120822 | 122 |
| 341 | 3300025961 | Ga0207712_10364743 | Ga0207712_103647431 | 122 |
| 342 | 3300025972 | Ga0207668_10283661 | Ga0207668_102836613 | 122 |
| 343 | 3300025972 | Ga0207668_10935222 | Ga0207668_109352221 | 122 |
| 344 | 3300025972 | Ga0207668_11964447 | Ga0207668_119644471 | 122 |
| 345 | 3300025981 | Ga0207640_10128000 | Ga0207640_101280002 | 122 |
| 346 | 3300025986 | Ga0207658_10262861 | Ga0207658_102628612 | 122 |
| 347 | 3300026023 | Ga0207677_10116924 | Ga0207677_101169242 | 122 |
| 348 | 3300026041 | Ga0207639_11209399 | Ga0207639_112093992 | 122 |
| 349 | 3300026075 | Ga0207708_10393671 | Ga0207708_103936712 | 122 |
| 350 | 3300026075 | Ga0207708_10619445 | Ga0207708_106194451 | 122 |
| 351 | 3300026088 | Ga0207641_10000549 | Ga0207641_100005499 | 122 |
| 352 | 3300026088 | Ga0207641_10188413 | Ga0207641_101884132 | 122 |
| 353 | 3300026088 | Ga0207641_10586385 | Ga0207641_105863851 | 122 |
| 354 | 3300026089 | Ga0207648_10253340 | Ga0207648_102533403 | 122 |
| 355 | 3300026089 | Ga0207648_10399598 | Ga0207648_103995982 | 122 |
| 356 | 3300026095 | Ga0207676_10086780 | Ga0207676_100867803 | 122 |
| 357 | 3300026116 | Ga0207674_10168304 | Ga0207674_101683043 | 122 |
| 358 | 3300026118 | Ga0207675_100002745 | Ga0207675_1000027458 | 122 |
| 359 | 3300026118 | Ga0207675_100082732 | Ga0207675_1000827324 | 122 |
| 360 | 3300026118 | Ga0207675_100886530 | Ga0207675_1008865302 | 122 |
| 361 | 3300026118 | Ga0207675_100905029 | Ga0207675_1009050291 | 122 |
| 362 | 3300026118 | Ga0207675_101240568 | Ga0207675_1012405682 | 122 |
| 363 | 3300026121 | Ga0207683_10038720 | Ga0207683_100387202 | 122 |
| 364 | 3300027907 | Ga0207428_10040954 | Ga0207428_100409542 | 122 |
| 365 | 3300027907 | Ga0207428_10166363 | Ga0207428_101663633 | 122 |
| 366 | 3300027907 | Ga0207428_10895158 | Ga0207428_108951581 | 122 |
| 367 | 3300028380 | Ga0268265_10022623 | Ga0268265_100226232 | 122 |
| 368 | 3300028380 | Ga0268265_10054023 | Ga0268265_100540233 | 122 |
| 369 | 3300028381 | Ga0268264_10348450 | Ga0268264_103484502 | 122 |
| 370 | 3300028381 | Ga0268264_11693305 | Ga0268264_116933051 | 122 |
| 371 | 3300031824 | Ga0307413_10096242 | Ga0307413_100962423 | 122 |
| 372 | 3300031824 | Ga0307413_10480622 | Ga0307413_104806222 | 122 |
| 373 | 3300031901 | Ga0307406_10790915 | Ga0307406_107909152 | 122 |
| 374 | 3300032004 | Ga0307414_10832410 | Ga0307414_108324102 | 122 |
| 375 | 3300032004 | Ga0307414_10920717 | Ga0307414_109207171 | 122 |
| 376 | 3300032005 | Ga0307411_10828499 | Ga0307411_108284992 | 122 |
| 377 | 3300032126 | Ga0307415_100117466 | Ga0307415_1001174661 | 122 |
| 378 | 3300036401 | Ga0373937_0552868 | Ga0373937_0552868_354_722 | 122 |
| 379 | 3300037471 | Ga0395905_0000880 | Ga0395905_0000880_25265_25684 | 122 |
| 380 | 3300037471 | Ga0395905_0039564 | Ga0395905_0039564_2304_2672 | 122 |
| 381 | 3300041406 | Ga0439439_0018629 | Ga0439439_0018629_497_865 | 122 |
| 382 | 3300041408 | Ga0439453_0059931 | Ga0439453_0059931_195_563 | 122 |
| 383 | 3300041413 | Ga0439465_0064822 | Ga0439465_0064822_411_779 | 122 |
| 384 | 3300041458 | Ga0451798_1146056 | Ga0451798_1146056_40_408 | 122 |
| 385 | 3300041496 | Ga0451839_0566319 | Ga0451839_0566319_284_652 | 122 |
| 386 | 3300042004 | Ga0439445_0150918 | Ga0439445_0150918_143_511 | 122 |
| 387 | 3300042007 | Ga0439449_0064504 | Ga0439449_0064504_653_1021 | 122 |
| 388 | 3300042014 | Ga0439457_006726 | Ga0439457_006726_2167_2544 | 122 |
| 389 | 3300042014 | Ga0439457_018711 | Ga0439457_018711_760_1128 | 122 |
| 390 | 3300042125 | Ga0450923_014686 | Ga0450923_014686_157_525 | 122 |
| 391 | 3300042133 | Ga0450896_009261 | Ga0450896_009261_82_450 | 122 |
| 392 | 3300042134 | Ga0450898_005828 | Ga0450898_005828_1340_1708 | 122 |
| 393 | 3300042156 | Ga0439446_0074793 | Ga0439446_0074793_462_830 | 122 |
| 394 | 3300042435 | Ga0439434_0228952 | Ga0439434_0228952_28_396 | 122 |
| 395 | 3300042437 | Ga0439444_0004901 | Ga0439444_0004901_1398_1766 | 122 |
| 396 | 3300044765 | Ga0466970_0005316 | Ga0466970_0005316_1896_2276 | 122 |
| 397 | 3300046499 | Ga0495594_0187864 | Ga0495594_0187864_384_752 | 122 |
| 398 | 3300046525 | Ga0495663_0082900 | Ga0495663_0082900_311_679 | 122 |
| 399 | 3300046537 | Ga0495598_0091182 | Ga0495598_0091182_542_910 | 122 |
| 400 | 3300046539 | Ga0495621_0021199 | Ga0495621_0021199_1541_1909 | 122 |
| 401 | 3300046809 | Ga0495600_0493818 | Ga0495600_0493818_95_463 | 122 |
| 402 | 3300047445 | Ga0495677_0411487 | Ga0495677_0411487_50_418 | 122 |
| 403 | 3300049514 | Ga0501291_145651 | Ga0501291_145651_73_441 | 122 |
| 404 | 3300049515 | Ga0501292_004172 | Ga0501292_004172_1106_1474 | 122 |
| 405 | 3300049515 | Ga0501292_027337 | Ga0501292_027337_94_462 | 122 |
| 406 | 3300049569 | Ga0501032_0006362 | Ga0501032_0006362_7049_7417 | 122 |
| 407 | 3300049571 | Ga0501034_0006235 | Ga0501034_0006235_9537_9905 | 122 |
| 408 | 3300049572 | Ga0501036_0017337 | Ga0501036_0017337_2970_3338 | 122 |
| 409 | 3300049574 | Ga0501038_0041309 | Ga0501038_0041309_1627_1995 | 122 |
| 410 | 3300049575 | Ga0501039_0012185 | Ga0501039_0012185_1574_1942 | 122 |
| 411 | 3300049579 | Ga0501043_0004908 | Ga0501043_0004908_5872_6240 | 122 |
| 412 | 3300049580 | Ga0501046_0003782 | Ga0501046_0003782_2136_2504 | 122 |
| 413 | 3300049581 | Ga0501047_0019301 | Ga0501047_0019301_5350_5718 | 122 |
| 414 | 3300049582 | Ga0501048_0060437 | Ga0501048_0060437_200_568 | 122 |
| 415 | 3300049583 | Ga0501067_0469522 | Ga0501067_0469522_94_462 | 122 |
| 416 | 3300049585 | Ga0501069_0115940 | Ga0501069_0115940_962_1330 | 122 |
| 417 | 3300049586 | Ga0501070_0008000 | Ga0501070_0008000_1746_2114 | 122 |
| 418 | 3300049589 | Ga0501073_0006191 | Ga0501073_0006191_7601_7969 | 122 |
| 419 | 3300049590 | Ga0501074_0008812 | Ga0501074_0008812_5731_6099 | 122 |
| 420 | 3300049649 | Ga0501198_001549 | Ga0501198_001549_615_983 | 122 |
| 421 | 3300049652 | Ga0501202_192313 | Ga0501202_192313_147_515 | 122 |
| 422 | 3300049654 | Ga0501207_006685 | Ga0501207_006685_417_785 | 122 |
| 423 | 3300049656 | Ga0501209_191335 | Ga0501209_191335_96_464 | 122 |
| 424 | 3300049661 | Ga0501217_000662 | Ga0501217_000662_1753_2121 | 122 |
| 425 | 3300049661 | Ga0501217_016471 | Ga0501217_016471_826_1194 | 122 |
| 426 | 3300049663 | Ga0501223_001821 | Ga0501223_001821_444_812 | 122 |
| 427 | 3300049663 | Ga0501223_125529 | Ga0501223_125529_119_487 | 122 |
| 428 | 3300049664 | Ga0501224_000573 | Ga0501224_000573_651_1019 | 122 |
| 429 | 3300049666 | Ga0501228_028460 | Ga0501228_028460_126_494 | 122 |
| 430 | 3300049667 | Ga0501230_025057 | Ga0501230_025057_35_403 | 122 |
| 431 | 3300049668 | Ga0501233_008589 | Ga0501233_008589_1294_1662 | 122 |
| 432 | 3300049673 | Ga0501240_004003 | Ga0501240_004003_1096_1464 | 122 |
| 433 | 3300049674 | Ga0501242_015403 | Ga0501242_015403_318_686 | 122 |
| 434 | 3300049675 | Ga0501243_002316 | Ga0501243_002316_1190_1558 | 122 |
| 435 | 3300049676 | Ga0501246_051710 | Ga0501246_051710_18_386 | 122 |
| 436 | 3300049679 | Ga0501249_054667 | Ga0501249_054667_522_890 | 122 |
| 437 | 3300049681 | Ga0501251_002823 | Ga0501251_002823_150_518 | 122 |
| 438 | 3300049682 | Ga0501252_015849 | Ga0501252_015849_132_500 | 122 |
| 439 | 3300049683 | Ga0501253_023066 | Ga0501253_023066_534_902 | 122 |
| 440 | 3300049684 | Ga0501255_011460 | Ga0501255_011460_505_873 | 122 |
| 441 | 3300049685 | Ga0501256_001315 | Ga0501256_001315_1401_1769 | 122 |
| 442 | 3300049686 | Ga0501257_030627 | Ga0501257_030627_742_1110 | 122 |
| 443 | 3300049688 | Ga0501259_000701 | Ga0501259_000701_3361_3729 | 122 |
| 444 | 3300049688 | Ga0501259_031059 | Ga0501259_031059_316_684 | 122 |
| 445 | 3300049704 | Ga0501221_000086 | Ga0501221_000086_6662_7030 | 122 |
| 446 | 3300049704 | Ga0501221_253031 | Ga0501221_253031_102_470 | 122 |
| 447 | 3300049705 | Ga0501225_0007974 | Ga0501225_0007974_420_788 | 122 |
| 448 | 3300049707 | Ga0501234_020266 | Ga0501234_020266_437_805 | 122 |
| 449 | 3300049707 | Ga0501234_093916 | Ga0501234_093916_77_445 | 122 |
| 450 | 3300049708 | Ga0501245_000771 | Ga0501245_000771_298_666 | 122 |
| 451 | 3300049741 | Ga0501079_0712128 | Ga0501079_0712128_351_719 | 122 |
| 452 | 3300049742 | Ga0501080_0053288 | Ga0501080_0053288_99_467 | 122 |
| 453 | 3300049744 | Ga0501083_0135584 | Ga0501083_0135584_606_974 | 122 |
| 454 | 3300049758 | Ga0501241_015454 | Ga0501241_015454_76_444 | 122 |
| 455 | 3300049762 | Ga0501265_008678 | Ga0501265_008678_429_797 | 122 |
| 456 | 3300049765 | Ga0501268_002840 | Ga0501268_002840_33_401 | 122 |
| 457 | 3300049767 | Ga0501270_124184 | Ga0501270_124184_49_417 | 122 |
| 458 | 3300049822 | Ga0501035_0005857 | Ga0501035_0005857_5349_5717 | 122 |
| 459 | 3300049823 | Ga0501044_0009331 | Ga0501044_0009331_4603_4971 | 122 |
| 460 | 3300049850 | Ga0501204_046342 | Ga0501204_046342_162_530 | 122 |
| 461 | 3300049851 | Ga0501212_026447 | Ga0501212_026447_68_436 | 122 |
| 462 | 3300050507 | nmdc:mga05p37_126978_c1 | nmdc:mga05p37_126978_c1_65_433 | 122 |
| 463 | 3300050507 | nmdc:mga05p37_2034069_c1 | nmdc:mga05p37_2034069_c1_31_399 | 122 |
| 464 | 3300050508 | nmdc:mga09592_15108_c1 | nmdc:mga09592_15108_c1_5813_6181 | 122 |
| 465 | 3300050508 | nmdc:mga09592_1676305_c1 | nmdc:mga09592_1676305_c1_106_474 | 122 |
| 466 | 3300050509 | nmdc:mga0qj67_242207_c1 | nmdc:mga0qj67_242207_c1_617_985 | 122 |
| 467 | 3300050510 | nmdc:mga06r32_18180_c1 | nmdc:mga06r32_18180_c1_1549_1917 | 122 |
| 468 | 3300050511 | nmdc:mga08y16_195739_c1 | nmdc:mga08y16_195739_c1_742_1110 | 122 |
| 469 | 3300050511 | nmdc:mga08y16_20692_c1 | nmdc:mga08y16_20692_c1_3422_3790 | 122 |
| 470 | 3300050511 | nmdc:mga08y16_248913_c1 | nmdc:mga08y16_248913_c1_717_1085 | 122 |
| 471 | 3300050511 | nmdc:mga08y16_583919_c1 | nmdc:mga08y16_583919_c1_98_466 | 122 |
| 472 | 3300050511 | nmdc:mga08y16_621409_c1 | nmdc:mga08y16_621409_c1_612_980 | 122 |
| 473 | 3300060353 | Ga0501082_0020131 | Ga0501082_0020131_2215_2583 | 122 |
| 474 | 3300002077 | JGI24744J21845_10028448 | JGI24744J21845_100284482 | 123 |
| 475 | 3300003215 | JGI25153J46596_10048619 | JGI25153J46596_100486192 | 123 |
| 476 | 3300003354 | JGI25160J50197_1005846 | JGI25160J50197_10058463 | 123 |
| 477 | 3300003790 | Ga0055528_1000307 | Ga0055528_100030711 | 123 |
| 478 | 3300003791 | Ga0055530_10001712 | Ga0055530_100017123 | 123 |
| 479 | 3300004625 | Ga0055543_1017342 | Ga0055543_10173422 | 123 |
| 480 | 3300005262 | Ga0065165_1000722 | Ga0065165_100072214 | 123 |
| 481 | 3300005330 | Ga0070690_100266254 | Ga0070690_1002662543 | 123 |
| 482 | 3300005334 | Ga0068869_100141613 | Ga0068869_1001416132 | 123 |
| 483 | 3300005335 | Ga0070666_10450397 | Ga0070666_104503971 | 123 |
| 484 | 3300005338 | Ga0068868_100105822 | Ga0068868_1001058223 | 123 |
| 485 | 3300005343 | Ga0070687_100011391 | Ga0070687_1000113914 | 123 |
| 486 | 3300005353 | Ga0070669_100390225 | Ga0070669_1003902251 | 123 |
| 487 | 3300005354 | Ga0070675_100611429 | Ga0070675_1006114291 | 123 |
| 488 | 3300005355 | Ga0070671_100266299 | Ga0070671_1002662992 | 123 |
| 489 | 3300005364 | Ga0070673_100225863 | Ga0070673_1002258632 | 123 |
| 490 | 3300005438 | Ga0070701_10197861 | Ga0070701_101978612 | 123 |
| 491 | 3300005441 | Ga0070700_101304083 | Ga0070700_1013040831 | 123 |
| 492 | 3300005455 | Ga0070663_100794034 | Ga0070663_1007940342 | 123 |
| 493 | 3300005456 | Ga0070678_100086792 | Ga0070678_1000867921 | 123 |
| 494 | 3300005457 | Ga0070662_100577376 | Ga0070662_1005773761 | 123 |
| 495 | 3300005466 | Ga0070685_10706994 | Ga0070685_107069941 | 123 |
| 496 | 3300005539 | Ga0068853_100033328 | Ga0068853_1000333283 | 123 |
| 497 | 3300005543 | Ga0070672_100048718 | Ga0070672_1000487183 | 123 |
| 498 | 3300005544 | Ga0070686_100042427 | Ga0070686_1000424273 | 123 |
| 499 | 3300005548 | Ga0070665_100707600 | Ga0070665_1007076002 | 123 |
| 500 | 3300005578 | Ga0068854_100237692 | Ga0068854_1002376923 | 123 |
| 501 | 3300005618 | Ga0068864_101454835 | Ga0068864_1014548351 | 123 |
| 502 | 3300005618 | Ga0068864_101998794 | Ga0068864_1019987941 | 123 |
| 503 | 3300005719 | Ga0068861_100800181 | Ga0068861_1008001811 | 123 |
| 504 | 3300005834 | Ga0068851_10528380 | Ga0068851_105283801 | 123 |
| 505 | 3300005840 | Ga0068870_10236799 | Ga0068870_102367991 | 123 |
| 506 | 3300005842 | Ga0068858_101256789 | Ga0068858_1012567892 | 123 |
| 507 | 3300005843 | Ga0068860_101248065 | Ga0068860_1012480651 | 123 |
| 508 | 3300006237 | Ga0097621_100452739 | Ga0097621_1004527392 | 123 |
| 509 | 3300007076 | Ga0075435_101359135 | Ga0075435_1013591351 | 123 |
| 510 | 3300009093 | Ga0105240_10000746 | Ga0105240_1000074616 | 123 |
| 511 | 3300009093 | Ga0105240_11726909 | Ga0105240_117269091 | 123 |
| 512 | 3300009177 | Ga0105248_10906132 | Ga0105248_109061322 | 123 |
| 513 | 3300011119 | Ga0105246_11101908 | Ga0105246_111019082 | 123 |
| 514 | 3300013297 | Ga0157378_10263310 | Ga0157378_102633102 | 123 |
| 515 | 3300013306 | Ga0163162_10153332 | Ga0163162_101533323 | 123 |
| 516 | 3300013306 | Ga0163162_12210654 | Ga0163162_122106541 | 123 |
| 517 | 3300013308 | Ga0157375_10005226 | Ga0157375_1000522611 | 123 |
| 518 | 3300013308 | Ga0157375_10155653 | Ga0157375_101556533 | 123 |
| 519 | 3300014325 | Ga0163163_10043685 | Ga0163163_100436856 | 123 |
| 520 | 3300014325 | Ga0163163_10299526 | Ga0163163_102995262 | 123 |
| 521 | 3300014326 | Ga0157380_10142780 | Ga0157380_101427804 | 123 |
| 522 | 3300014326 | Ga0157380_10369636 | Ga0157380_103696362 | 123 |
| 523 | 3300014326 | Ga0157380_10927474 | Ga0157380_109274741 | 123 |
| 524 | 3300014326 | Ga0157380_12881230 | Ga0157380_128812301 | 123 |
| 525 | 3300014745 | Ga0157377_10419857 | Ga0157377_104198572 | 123 |
| 526 | 3300025273 | Ga0209673_1000242 | Ga0209673_100024230 | 123 |
| 527 | 3300025295 | Ga0209564_1015069 | Ga0209564_10150694 | 123 |
| 528 | 3300025297 | Ga0209758_1010949 | Ga0209758_10109495 | 123 |
| 529 | 3300025298 | Ga0209050_1000298 | Ga0209050_100029862 | 123 |
| 530 | 3300025302 | Ga0207426_1001104 | Ga0207426_10011047 | 123 |
| 531 | 3300025304 | Ga0209257_1007367 | Ga0209257_10073676 | 123 |
| 532 | 3300025901 | Ga0207688_10234220 | Ga0207688_102342202 | 123 |
| 533 | 3300025903 | Ga0207680_10259804 | Ga0207680_102598041 | 123 |
| 534 | 3300025907 | Ga0207645_10006873 | Ga0207645_100068739 | 123 |
| 535 | 3300025908 | Ga0207643_10118908 | Ga0207643_101189083 | 123 |
| 536 | 3300025913 | Ga0207695_10000647 | Ga0207695_1000064733 | 123 |
| 537 | 3300025918 | Ga0207662_10048615 | Ga0207662_100486153 | 123 |
| 538 | 3300025925 | Ga0207650_10279214 | Ga0207650_102792142 | 123 |
| 539 | 3300025931 | Ga0207644_10044561 | Ga0207644_100445614 | 123 |
| 540 | 3300025933 | Ga0207706_10546629 | Ga0207706_105466291 | 123 |
| 541 | 3300025936 | Ga0207670_10344666 | Ga0207670_103446662 | 123 |
| 542 | 3300025938 | Ga0207704_10845247 | Ga0207704_108452472 | 123 |
| 543 | 3300025940 | Ga0207691_10026934 | Ga0207691_100269344 | 123 |
| 544 | 3300025940 | Ga0207691_11043248 | Ga0207691_110432482 | 123 |
| 545 | 3300025941 | Ga0207711_11992990 | Ga0207711_119929901 | 123 |
| 546 | 3300025942 | Ga0207689_10269254 | Ga0207689_102692542 | 123 |
| 547 | 3300025960 | Ga0207651_10346578 | Ga0207651_103465782 | 123 |
| 548 | 3300026023 | Ga0207677_10060994 | Ga0207677_100609943 | 123 |
| 549 | 3300026035 | Ga0207703_10513343 | Ga0207703_105133432 | 123 |
| 550 | 3300026088 | Ga0207641_10127104 | Ga0207641_101271043 | 123 |
| 551 | 3300026089 | Ga0207648_10403188 | Ga0207648_104031883 | 123 |
| 552 | 3300026118 | Ga0207675_100314173 | Ga0207675_1003141732 | 123 |
| 553 | 3300026121 | Ga0207683_10047913 | Ga0207683_100479135 | 123 |
| 554 | 3300026121 | Ga0207683_10131329 | Ga0207683_101313291 | 123 |
| 555 | 3300026142 | Ga0207698_10734721 | Ga0207698_107347212 | 123 |
| 556 | 3300028381 | Ga0268264_11965261 | Ga0268264_119652611 | 123 |
| 557 | 3300031251 | Ga0265327_10025288 | Ga0265327_100252886 | 123 |
| 558 | 3300031251 | Ga0265327_10079493 | Ga0265327_100794932 | 123 |
| 559 | 3300042876 | Ga0451577_0017795 | Ga0451577_0017795_3362_3736 | 123 |
| 560 | 3300044712 | Ga0453684_0885089 | Ga0453684_0885089_195_569 | 123 |
| 561 | 3300046517 | Ga0495630_0173378 | Ga0495630_0173378_1051_1422 | 123 |
| 562 | 3300046642 | Ga0495634_0500425 | Ga0495634_0500425_53_424 | 123 |
| 563 | 3300047319 | Ga0495674_0222354 | Ga0495674_0222354_56_427 | 123 |
| 564 | 3300049569 | Ga0501032_0031070 | Ga0501032_0031070_2539_2913 | 123 |
| 565 | 3300049571 | Ga0501034_0244563 | Ga0501034_0244563_1329_1703 | 123 |
| 566 | 3300049571 | Ga0501034_0303925 | Ga0501034_0303925_240_614 | 123 |
| 567 | 3300049572 | Ga0501036_0670469 | Ga0501036_0670469_430_804 | 123 |
| 568 | 3300049581 | Ga0501047_0144031 | Ga0501047_0144031_1008_1382 | 123 |
| 569 | 3300049742 | Ga0501080_1605619 | Ga0501080_1605619_60_434 | 123 |
| 570 | 3300050493 | nmdc:mga0k408_72214_c1 | nmdc:mga0k408_72214_c1_1100_1483 | 123 |
| 571 | 3300050513 | nmdc:mga0rr50_1712549_c1 | nmdc:mga0rr50_1712549_c1_45_416 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ff4-assembly1.cif.gz_A | crystal structure of uncharacterized protein chu_1412 | 0.9774 | 4 | 123 |
| 3ff4-assembly1.cif.gz_A | crystal structure of uncharacterized protein chu_1412 | 0.9617 | 4 | 123 |
| 1iul-assembly1.cif.gz_A | the structure of cell-free id.343 from thermus thermophilus | 0.8691 | 5 | 123 |
| 2d5a-assembly1.cif.gz_A | hypothetical protein from pyrococcus horikoshii ot3 | 0.8671 | 5 | 120 |
| 1iul-assembly1.cif.gz_A | the structure of cell-free id.343 from thermus thermophilus | 0.837 | 5 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ff4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9695 | 4 | 123 | 3.40.50.720 |
| 3ff4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9616 | 4 | 123 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8691 | 5 | 123 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.837 | 5 | 123 | 3.40.50.720 |
| 1y81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8268 | 4 | 116 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5SU64-F1-model_v4 | CoA-binding domain-containing protein | 1.002 | 6 | 123 |
|
| AF-A0A4Q0AZ43-F1-model_v4 | CoA-binding protein | 1 | 6 | 123 |
|
| AF-A0A4R1HVA8-F1-model_v4 | deleted | 1 | 4 | 123 |
|
| AF-A0A066WXJ3-F1-model_v4 | CoA-binding protein | 0.9993 | 4 | 123 |
|
| AF-A0A6I3LY05-F1-model_v4 | CoA-binding protein | 0.9988 | 4 | 123 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar