F465004

General Info

Members Datasets Scaffolds Average Seq Length
571 266 571 122

Family's Representative Sequence

Representative Sequence 3300049765|Ga0501268_033164|Ga0501268_033164_209_565
Length 118
Sequence MAEKKTVVLGASDNPSRYSYLAVRKLQANHHPVVAIGKRVGDTDIVTDHNPVDSVDTITLYLNPMNQREYYDYILSLNPKRIIFNPGTENDELMKRAKENGIEPVVGCTLVMLSTGQY

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
172 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
176 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
182 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
183 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
203 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
219 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
220 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
221 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
222 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
223 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
224 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
225 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
226 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
227 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
228 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
229 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
230 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
231 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
234 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
235 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
236 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
237 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
240 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
248 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
249 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
250 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
255 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 0.7
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10028448 3300002077 Unclassified 1077
2 JGI25153J46596_10048619 3300003215 Bacteria 1237
3 rootL2_10200952 3300003322 Bacteria 4645
4 JGI25160J50197_1005846 3300003354 Bacteria 5065
5 Ga0055528_1000307 3300003790 Bacteria 41483
6 Ga0055530_10001712 3300003791 Bacteria 15455
7 Ga0055543_1017342 3300004625 Bacteria 1356
8 Ga0065165_1000722 3300005262 Bacteria 46444
9 Ga0065714_10182733 3300005288 Bacteria 956
10 Ga0065704_10089928 3300005289 Unclassified 2823
11 Ga0065704_10103610 3300005289 Unclassified 2167
12 Ga0065712_10002222 3300005290 Bacteria 8378
13 Ga0065712_10043539 3300005290 Bacteria 672
14 Ga0065712_10256598 3300005290 Bacteria 946
15 Ga0065715_10005986 3300005293 Bacteria 5971
16 Ga0065715_10365032 3300005293 Bacteria 929
17 Ga0065707_10013258 3300005295 Unclassified 1632
18 Ga0070658_10001648 3300005327 Bacteria 18875
19 Ga0070658_11213680 3300005327 Bacteria 656
20 Ga0070676_10001113 3300005328 Bacteria 13439
21 Ga0070676_10837650 3300005328 Bacteria 681
22 Ga0070690_100266254 3300005330 Bacteria 1217
23 Ga0070690_101193792 3300005330 Bacteria 607
24 Ga0070670_100025113 3300005331 Bacteria 5127
25 Ga0070670_100041225 3300005331 Bacteria 3968
26 Ga0070670_100431519 3300005331 Bacteria 1166
27 Ga0070670_101693224 3300005331 Bacteria 582
28 Ga0070677_10057798 3300005333 Bacteria 1591
29 Ga0068869_100007522 3300005334 Bacteria 6969
30 Ga0068869_100033589 3300005334 Bacteria 3622
31 Ga0068869_100131493 3300005334 Unclassified 1924
32 Ga0068869_100141613 3300005334 Bacteria 1857
33 Ga0068869_100230690 3300005334 Bacteria 1471
34 Ga0070666_10000358 3300005335 Bacteria 28682
35 Ga0070666_10450397 3300005335 Unclassified 929
36 Ga0070666_10687081 3300005335 Bacteria 750
37 Ga0068868_100000187 3300005338 Bacteria 41327
38 Ga0068868_100105822 3300005338 Bacteria 2282
39 Ga0068868_100807160 3300005338 Unclassified 847
40 Ga0068868_100994554 3300005338 Bacteria 767
41 Ga0068868_101604535 3300005338 Bacteria 611
42 Ga0070660_100706540 3300005339 Unclassified 845
43 Ga0070689_100013993 3300005340 Bacteria 5822
44 Ga0070689_100018385 3300005340 Bacteria 5147
45 Ga0070689_100568876 3300005340 Bacteria 978
46 Ga0070687_100011391 3300005343 Bacteria 3889
47 Ga0070687_100697830 3300005343 Bacteria 708
48 Ga0070687_101438584 3300005343 Unclassified 516
49 Ga0070661_100466500 3300005344 Bacteria 1006
50 Ga0070668_100003714 3300005347 Bacteria 11263
51 Ga0070668_100106593 3300005347 Bacteria 2227
52 Ga0070668_101506977 3300005347 Unclassified 615
53 Ga0070669_100004109 3300005353 Bacteria 10555
54 Ga0070669_100066435 3300005353 Bacteria 2658
55 Ga0070669_100390225 3300005353 Bacteria 1137
56 Ga0070669_100891519 3300005353 Bacteria 759
57 Ga0070669_101251971 3300005353 Bacteria 642
58 Ga0070675_100007290 3300005354 Bacteria 8533
59 Ga0070675_100070045 3300005354 Bacteria 2906
60 Ga0070675_100323287 3300005354 Bacteria 1363
61 Ga0070675_100419440 3300005354 Bacteria 1196
62 Ga0070675_100611429 3300005354 Bacteria 989
63 Ga0070675_100620078 3300005354 Bacteria 982
64 Ga0070675_100996146 3300005354 Bacteria 769
65 Ga0070675_102046537 3300005354 Unclassified 528
66 Ga0070671_100266299 3300005355 Bacteria 1456
67 Ga0070674_100372952 3300005356 Unclassified 1159
68 Ga0070674_100614442 3300005356 Unclassified 920
69 Ga0070674_100672004 3300005356 Bacteria 882
70 Ga0070673_100000124 3300005364 Bacteria 35840
71 Ga0070673_100020821 3300005364 Bacteria 4738
72 Ga0070673_100225863 3300005364 Bacteria 1623
73 Ga0070673_100256834 3300005364 Bacteria 1525
74 Ga0070673_100630659 3300005364 Bacteria 980
75 Ga0070688_100021022 3300005365 Unclassified 3805
76 Ga0070688_100024251 3300005365 Bacteria 3576
77 Ga0070688_100110762 3300005365 Unclassified 1825
78 Ga0070688_100261637 3300005365 Bacteria 1236
79 Ga0070667_100000980 3300005367 Bacteria 26248
80 Ga0070667_100295443 3300005367 Bacteria 1458
81 Ga0070667_100504135 3300005367 Bacteria 1110
82 Ga0070701_10197861 3300005438 Unclassified 1186
83 Ga0070701_10233378 3300005438 Bacteria 1103
84 Ga0070705_100670508 3300005440 Bacteria 811
85 Ga0070700_100047150 3300005441 Bacteria 2666
86 Ga0070700_100173095 3300005441 Bacteria 1496
87 Ga0070700_101304083 3300005441 Bacteria 610
88 Ga0070694_100988799 3300005444 Bacteria 698
89 Ga0070663_100087774 3300005455 Bacteria 2299
90 Ga0070663_100794034 3300005455 Unclassified 811
91 Ga0070678_100086792 3300005456 Unclassified 2388
92 Ga0070678_100614875 3300005456 Bacteria 971
93 Ga0070662_100010835 3300005457 Bacteria 6003
94 Ga0070662_100577376 3300005457 Bacteria 944
95 Ga0068867_100022992 3300005459 Bacteria 4461
96 Ga0068867_100953814 3300005459 Bacteria 775
97 Ga0068867_100970919 3300005459 Bacteria 769
98 Ga0070685_10002080 3300005466 Bacteria 10351
99 Ga0070685_10004179 3300005466 Bacteria 7282
100 Ga0070685_10254127 3300005466 Bacteria 1165
101 Ga0070685_10706994 3300005466 Unclassified 735
102 Ga0070698_100001241 3300005471 Bacteria 28439
103 Ga0070698_100024064 3300005471 Bacteria 6357
104 Ga0070698_100055572 3300005471 Bacteria 4013
105 Ga0070698_100239629 3300005471 Bacteria 1747
106 Ga0070699_100150518 3300005518 Bacteria 2058
107 Ga0070684_100259776 3300005535 Bacteria 1589
108 Ga0068853_100002569 3300005539 Bacteria 13648
109 Ga0068853_100033328 3300005539 Bacteria 4369
110 Ga0070672_100000105 3300005543 Bacteria 41868
111 Ga0070672_100030184 3300005543 Bacteria 4070
112 Ga0070672_100048718 3300005543 Unclassified 3294
113 Ga0070672_100706635 3300005543 Bacteria 883
114 Ga0070672_101413943 3300005543 Unclassified 622
115 Ga0070686_100042427 3300005544 Bacteria 2849
116 Ga0070686_100140349 3300005544 Unclassified 1681
117 Ga0070665_100000635 3300005548 Bacteria 47836
118 Ga0070665_100707600 3300005548 Bacteria 1020
119 Ga0068855_100072463 3300005563 Bacteria 4004
120 Ga0070664_100587894 3300005564 Bacteria 1032
121 Ga0068857_100411900 3300005577 Unclassified 1259
122 Ga0068854_100069273 3300005578 Bacteria 2575
123 Ga0068854_100146313 3300005578 Bacteria 1818
124 Ga0068854_100237692 3300005578 Bacteria 1449
125 Ga0068856_100125471 3300005614 Unclassified 2570
126 Ga0068856_100633016 3300005614 Bacteria 1090
127 Ga0070702_100132063 3300005615 Bacteria 1578
128 Ga0068852_100043934 3300005616 Bacteria 3792
129 Ga0068852_100553120 3300005616 Unclassified 1151
130 Ga0068859_100016832 3300005617 Bacteria 7339
131 Ga0068859_100099276 3300005617 Unclassified 2967
132 Ga0068859_100158567 3300005617 Bacteria 2341
133 Ga0068859_100456253 3300005617 Bacteria 1374
134 Ga0068859_100561632 3300005617 Bacteria 1235
135 Ga0068859_102028218 3300005617 Bacteria 635
136 Ga0068859_102467620 3300005617 Bacteria 573
137 Ga0068864_100006131 3300005618 Bacteria 9864
138 Ga0068864_100136114 3300005618 Bacteria 2212
139 Ga0068864_100136404 3300005618 Bacteria 2210
140 Ga0068864_101454835 3300005618 Unclassified 688
141 Ga0068864_101998794 3300005618 Bacteria 586
142 Ga0068861_100023393 3300005719 Bacteria 4455
143 Ga0068861_100033187 3300005719 Bacteria 3806
144 Ga0068861_100094835 3300005719 Bacteria 2362
145 Ga0068861_100413277 3300005719 Bacteria 1200
146 Ga0068861_100800181 3300005719 Bacteria 885
147 Ga0068861_100884973 3300005719 Bacteria 845
148 Ga0068851_10016169 3300005834 Bacteria 3566
149 Ga0068851_10528380 3300005834 Bacteria 710
150 Ga0068870_10168364 3300005840 Bacteria 1305
151 Ga0068870_10236799 3300005840 Bacteria 1125
152 Ga0068870_10399345 3300005840 Bacteria 894
153 Ga0068870_11461334 3300005840 Unclassified 502
154 Ga0068863_100001976 3300005841 Bacteria 20394
155 Ga0068863_100007551 3300005841 Bacteria 10635
156 Ga0068863_100669684 3300005841 Bacteria 1030
157 Ga0068863_100671912 3300005841 Bacteria 1028
158 Ga0068858_100010584 3300005842 Bacteria 8734
159 Ga0068858_100053682 3300005842 Bacteria 3728
160 Ga0068858_100222894 3300005842 Unclassified 1786
161 Ga0068858_101256789 3300005842 Bacteria 728
162 Ga0068858_101635994 3300005842 Bacteria 636
163 Ga0068860_100001418 3300005843 Bacteria 25953
164 Ga0068860_100003309 3300005843 Bacteria 16586
165 Ga0068860_100744040 3300005843 Bacteria 992
166 Ga0068860_101248065 3300005843 Unclassified 764
167 Ga0068862_100002509 3300005844 Bacteria 16247
168 Ga0068862_100385177 3300005844 Bacteria 1308
169 Ga0068862_100543410 3300005844 Bacteria 1109
170 Ga0068862_101410931 3300005844 Bacteria 700
171 Ga0081539_10236136 3300005985 Bacteria 821
172 Ga0097621_100001817 3300006237 Bacteria 14674
173 Ga0097621_100199891 3300006237 Bacteria 1735
174 Ga0097621_100452739 3300006237 Unclassified 1157
175 Ga0097621_100506023 3300006237 Bacteria 1095
176 Ga0097621_100551417 3300006237 Bacteria 1049
177 Ga0097621_101553916 3300006237 Bacteria 629
178 Ga0068871_100009967 3300006358 Bacteria 6904
179 Ga0068871_100010690 3300006358 Bacteria 6711
180 Ga0068871_100375072 3300006358 Bacteria 1263
181 Ga0068871_102188288 3300006358 Unclassified 527
182 Ga0075428_100040899 3300006844 Bacteria 5098
183 Ga0075428_100672582 3300006844 Bacteria 1103
184 Ga0075430_100239773 3300006846 Unclassified 1503
185 Ga0075431_100299054 3300006847 Unclassified 1626
186 Ga0075429_100015826 3300006880 Bacteria 6532
187 Ga0075429_100477090 3300006880 Bacteria 1093
188 Ga0075429_100609099 3300006880 Bacteria 957
189 Ga0068865_100017646 3300006881 Bacteria 4594
190 Ga0068865_100689512 3300006881 Bacteria 872
191 Ga0068865_101481619 3300006881 Unclassified 608
192 Ga0097620_100016833 3300006931 Bacteria 7339
193 Ga0097620_100099279 3300006931 Unclassified 2967
194 Ga0097620_100158567 3300006931 Bacteria 2341
195 Ga0097620_100456237 3300006931 Bacteria 1374
196 Ga0097620_100561621 3300006931 Bacteria 1235
197 Ga0097620_102028669 3300006931 Bacteria 635
198 Ga0097620_102467663 3300006931 Bacteria 573
199 Ga0075435_101359135 3300007076 Unclassified 622
200 Ga0105240_10000746 3300009093 Bacteria 59393
201 Ga0105240_10076297 3300009093 Bacteria 4132
202 Ga0105240_11726909 3300009093 Bacteria 653
203 Ga0111539_10006668 3300009094 Bacteria 14871
204 Ga0111539_10117592 3300009094 Bacteria 3116
205 Ga0111539_10175593 3300009094 Bacteria 2503
206 Ga0111539_10178539 3300009094 Bacteria 2480
207 Ga0111539_10258394 3300009094 Bacteria 2028
208 Ga0111539_10992133 3300009094 Bacteria 976
209 Ga0111539_13314173 3300009094 Bacteria 518
210 Ga0105245_10123697 3300009098 Bacteria 2419
211 Ga0105247_10001867 3300009101 Bacteria 14743
212 Ga0105247_10017539 3300009101 Bacteria 4294
213 Ga0105247_10133032 3300009101 Bacteria 1623
214 Ga0114129_10005331 3300009147 Bacteria 18156
215 Ga0114129_11906917 3300009147 Unclassified 720
216 Ga0105243_10662056 3300009148 Unclassified 1013
217 Ga0105241_10008820 3300009174 Bacteria 7410
218 Ga0105241_10372697 3300009174 Unclassified 1245
219 Ga0105242_10018508 3300009176 Bacteria 5447
220 Ga0105242_10341964 3300009176 Unclassified 1379
221 Ga0105242_12284291 3300009176 Bacteria 587
222 Ga0105248_10025712 3300009177 Bacteria 6548
223 Ga0105248_10906132 3300009177 Unclassified 996
224 Ga0105237_10800921 3300009545 Bacteria 949
225 Ga0105238_10097951 3300009551 Bacteria 2917
226 Ga0105249_10002678 3300009553 Bacteria 15401
227 Ga0105249_10020437 3300009553 Bacteria 5919
228 Ga0105249_10026181 3300009553 Bacteria 5253
229 Ga0105249_10031914 3300009553 Bacteria 4765
230 Ga0105249_10037534 3300009553 Bacteria 4397
231 Ga0105249_10356050 3300009553 Bacteria 1484
232 Ga0105239_10071591 3300010375 Bacteria 3809
233 Ga0105239_10141040 3300010375 Bacteria 2685
234 Ga0105239_13361620 3300010375 Bacteria 520
235 Ga0105246_11101908 3300011119 Unclassified 725
236 Ga0157369_10247260 3300013105 Bacteria 1862
237 Ga0157369_12235688 3300013105 Unclassified 554
238 Ga0157374_10002980 3300013296 Bacteria 14179
239 Ga0157374_10852005 3300013296 Unclassified 928
240 Ga0157378_10013251 3300013297 Bacteria 7209
241 Ga0157378_10263310 3300013297 Bacteria 1655
242 Ga0157378_10452024 3300013297 Unclassified 1275
243 Ga0163162_10000312 3300013306 Bacteria 45022
244 Ga0163162_10004060 3300013306 Bacteria 14047
245 Ga0163162_10153332 3300013306 Bacteria 2422
246 Ga0163162_10818473 3300013306 Bacteria 1048
247 Ga0163162_11258459 3300013306 Bacteria 840
248 Ga0163162_12210654 3300013306 Unclassified 632
249 Ga0157372_10073469 3300013307 Bacteria 3855
250 Ga0157372_10332960 3300013307 Bacteria 1768
251 Ga0157372_10571310 3300013307 Bacteria 1318
252 Ga0157372_11919917 3300013307 Bacteria 681
253 Ga0157372_12929480 3300013307 Bacteria 546
254 Ga0157375_10002871 3300013308 Bacteria 14932
255 Ga0157375_10005226 3300013308 Bacteria 11266
256 Ga0157375_10055440 3300013308 Bacteria 3908
257 Ga0157375_10058124 3300013308 Bacteria 3825
258 Ga0157375_10155653 3300013308 Bacteria 2424
259 Ga0157375_11661213 3300013308 Unclassified 756
260 Ga0163163_10000346 3300014325 Bacteria 44619
261 Ga0163163_10043685 3300014325 Bacteria 4395
262 Ga0163163_10057583 3300014325 Bacteria 3843
263 Ga0163163_10201063 3300014325 Bacteria 2041
264 Ga0163163_10299526 3300014325 Bacteria 1660
265 Ga0163163_12512623 3300014325 Unclassified 573
266 Ga0157380_10013625 3300014326 Bacteria 5934
267 Ga0157380_10017475 3300014326 Bacteria 5307
268 Ga0157380_10040584 3300014326 Bacteria 3626
269 Ga0157380_10142780 3300014326 Bacteria 2059
270 Ga0157380_10369636 3300014326 Unclassified 1349
271 Ga0157380_10497993 3300014326 Bacteria 1183
272 Ga0157380_10927474 3300014326 Unclassified 899
273 Ga0157380_12881230 3300014326 Bacteria 547
274 Ga0157380_13272438 3300014326 Unclassified 518
275 Ga0157377_10020800 3300014745 Bacteria 3443
276 Ga0157377_10030434 3300014745 Bacteria 2924
277 Ga0157377_10419857 3300014745 Unclassified 916
278 Ga0157379_10000242 3300014968 Bacteria 42795
279 Ga0157379_10480804 3300014968 Bacteria 1149
280 Ga0157379_10791003 3300014968 Bacteria 895
281 Ga0157379_10925384 3300014968 Bacteria 828
282 Ga0157376_10002821 3300014969 Bacteria 11880
283 Ga0157376_10229136 3300014969 Bacteria 1725
284 Ga0157376_10290128 3300014969 Bacteria 1544
285 Ga0157376_10754551 3300014969 Unclassified 982
286 Ga0163161_10039298 3300017792 Unclassified 3396
287 Ga0163161_10116704 3300017792 Bacteria 2001
288 Ga0163161_10124184 3300017792 Bacteria 1942
289 Ga0163161_10134524 3300017792 Bacteria 1867
290 Ga0209673_1000242 3300025273 Bacteria 104669
291 Ga0209564_1015069 3300025295 Bacteria 3169
292 Ga0209758_1010949 3300025297 Bacteria 5334
293 Ga0209050_1000298 3300025298 Bacteria 104315
294 Ga0207426_1001104 3300025302 Bacteria 24841
295 Ga0209257_1007367 3300025304 Bacteria 6667
296 Ga0207697_10085949 3300025315 Bacteria 1329
297 Ga0207697_10510406 3300025315 Bacteria 530
298 Ga0207656_10004467 3300025321 Bacteria 4888
299 Ga0207682_10022153 3300025893 Bacteria 2502
300 Ga0207642_10547664 3300025899 Bacteria 714
301 Ga0207710_10001574 3300025900 Bacteria 11207
302 Ga0207688_10234220 3300025901 Bacteria 1109
303 Ga0207680_10003927 3300025903 Bacteria 7016
304 Ga0207680_10259804 3300025903 Bacteria 1202
305 Ga0207647_10227495 3300025904 Bacteria 1074
306 Ga0207645_10001794 3300025907 Bacteria 17325
307 Ga0207645_10006873 3300025907 Bacteria 8118
308 Ga0207643_10004498 3300025908 Bacteria 7493
309 Ga0207643_10061552 3300025908 Bacteria 2144
310 Ga0207643_10118908 3300025908 Unclassified 1563
311 Ga0207705_10017600 3300025909 Bacteria 5114
312 Ga0207654_10070468 3300025911 Bacteria 2076
313 Ga0207707_11463064 3300025912 Bacteria 543
314 Ga0207695_10000647 3300025913 Bacteria 69264
315 Ga0207695_10261753 3300025913 Bacteria 1627
316 Ga0207662_10011142 3300025918 Bacteria 4976
317 Ga0207662_10048615 3300025918 Bacteria 2513
318 Ga0207646_11191288 3300025922 Bacteria 668
319 Ga0207681_10017038 3300025923 Unclassified 4558
320 Ga0207681_10057500 3300025923 Bacteria 2658
321 Ga0207650_10094765 3300025925 Bacteria 2288
322 Ga0207650_10279214 3300025925 Bacteria 1360
323 Ga0207650_10463838 3300025925 Bacteria 1055
324 Ga0207659_10144909 3300025926 Bacteria 1848
325 Ga0207659_10250390 3300025926 Bacteria 1437
326 Ga0207659_10294927 3300025926 Bacteria 1330
327 Ga0207659_10829355 3300025926 Bacteria 795
328 Ga0207659_11386765 3300025926 Bacteria 603
329 Ga0207659_11470757 3300025926 Unclassified 583
330 Ga0207687_10331509 3300025927 Unclassified 1235
331 Ga0207644_10044561 3300025931 Bacteria 3152
332 Ga0207706_10031804 3300025933 Bacteria 4699
333 Ga0207706_10036781 3300025933 Unclassified 4348
334 Ga0207706_10454890 3300025933 Bacteria 1107
335 Ga0207706_10546629 3300025933 Bacteria 997
336 Ga0207686_10001766 3300025934 Bacteria 12028
337 Ga0207709_10581915 3300025935 Unclassified 884
338 Ga0207670_10002352 3300025936 Bacteria 9907
339 Ga0207670_10020981 3300025936 Bacteria 4023
340 Ga0207670_10344666 3300025936 Unclassified 1178
341 Ga0207669_11102418 3300025937 Unclassified 670
342 Ga0207704_10381769 3300025938 Bacteria 1106
343 Ga0207704_10441076 3300025938 Unclassified 1037
344 Ga0207704_10845247 3300025938 Unclassified 767
345 Ga0207691_10000012 3300025940 Bacteria 147942
346 Ga0207691_10001776 3300025940 Bacteria 21223
347 Ga0207691_10026934 3300025940 Bacteria 5393
348 Ga0207691_10218251 3300025940 Bacteria 1654
349 Ga0207691_11043248 3300025940 Bacteria 681
350 Ga0207711_10088381 3300025941 Bacteria 2721
351 Ga0207711_11992990 3300025941 Unclassified 523
352 Ga0207689_10046539 3300025942 Bacteria 3585
353 Ga0207689_10269254 3300025942 Bacteria 1410
354 Ga0207679_10054424 3300025945 Bacteria 2946
355 Ga0207667_10698113 3300025949 Bacteria 1017
356 Ga0207651_10000216 3300025960 Bacteria 24808
357 Ga0207651_10057394 3300025960 Bacteria 2685
358 Ga0207651_10128181 3300025960 Bacteria 1937
359 Ga0207651_10346578 3300025960 Bacteria 1249
360 Ga0207651_10752529 3300025960 Bacteria 861
361 Ga0207712_10006134 3300025961 Bacteria 7578
362 Ga0207712_10011299 3300025961 Bacteria 5684
363 Ga0207712_10012082 3300025961 Bacteria 5513
364 Ga0207712_10364743 3300025961 Bacteria 1204
365 Ga0207668_10001361 3300025972 Bacteria 14445
366 Ga0207668_10283661 3300025972 Bacteria 1359
367 Ga0207668_10935222 3300025972 Bacteria 773
368 Ga0207668_11964447 3300025972 Bacteria 527
369 Ga0207640_10128000 3300025981 Bacteria 1831
370 Ga0207640_10642371 3300025981 Unclassified 903
371 Ga0207658_10000374 3300025986 Bacteria 43784
372 Ga0207658_10150153 3300025986 Bacteria 1897
373 Ga0207658_10262861 3300025986 Bacteria 1471
374 Ga0207677_10000984 3300026023 Bacteria 15691
375 Ga0207677_10060994 3300026023 Unclassified 2609
376 Ga0207677_10116924 3300026023 Bacteria 1998
377 Ga0207677_10884259 3300026023 Unclassified 804
378 Ga0207677_11508154 3300026023 Bacteria 621
379 Ga0207703_10019138 3300026035 Bacteria 5348
380 Ga0207703_10078395 3300026035 Bacteria 2745
381 Ga0207703_10513343 3300026035 Unclassified 1126
382 Ga0207639_10016498 3300026041 Bacteria 5229
383 Ga0207639_11209399 3300026041 Bacteria 709
384 Ga0207708_10393671 3300026075 Bacteria 1144
385 Ga0207708_10619445 3300026075 Bacteria 918
386 Ga0207641_10000549 3300026088 Bacteria 42051
387 Ga0207641_10007761 3300026088 Bacteria 8917
388 Ga0207641_10127104 3300026088 Bacteria 2284
389 Ga0207641_10188413 3300026088 Bacteria 1894
390 Ga0207641_10309805 3300026088 Bacteria 1494
391 Ga0207641_10586385 3300026088 Bacteria 1090
392 Ga0207648_10012970 3300026089 Bacteria 7778
393 Ga0207648_10253340 3300026089 Bacteria 1570
394 Ga0207648_10399598 3300026089 Bacteria 1245
395 Ga0207648_10403188 3300026089 Bacteria 1239
396 Ga0207676_10017316 3300026095 Bacteria 5223
397 Ga0207676_10058856 3300026095 Bacteria 3032
398 Ga0207676_10086780 3300026095 Bacteria 2557
399 Ga0207674_10168304 3300026116 Bacteria 2145
400 Ga0207674_10386433 3300026116 Unclassified 1353
401 Ga0207675_100002745 3300026118 Bacteria 17311
402 Ga0207675_100082732 3300026118 Bacteria 3011
403 Ga0207675_100314173 3300026118 Bacteria 1529
404 Ga0207675_100886530 3300026118 Bacteria 908
405 Ga0207675_100905029 3300026118 Bacteria 899
406 Ga0207675_101240568 3300026118 Unclassified 766
407 Ga0207683_10038720 3300026121 Bacteria 4158
408 Ga0207683_10047913 3300026121 Bacteria 3742
409 Ga0207683_10131329 3300026121 Unclassified 2253
410 Ga0207683_10655878 3300026121 Bacteria 972
411 Ga0207698_10009340 3300026142 Bacteria 6249
412 Ga0207698_10734721 3300026142 Bacteria 985
413 Ga0207428_10040954 3300027907 Bacteria 3752
414 Ga0207428_10166363 3300027907 Bacteria 1672
415 Ga0207428_10895158 3300027907 Bacteria 627
416 Ga0268266_10005379 3300028379 Bacteria 11960
417 Ga0268265_10022623 3300028380 Bacteria 4419
418 Ga0268265_10054023 3300028380 Bacteria 3045
419 Ga0268265_10481603 3300028380 Bacteria 1165
420 Ga0268264_10003975 3300028381 Bacteria 12651
421 Ga0268264_10050397 3300028381 Bacteria 3467
422 Ga0268264_10348450 3300028381 Bacteria 1409
423 Ga0268264_11693305 3300028381 Bacteria 643
424 Ga0268264_11965261 3300028381 Unclassified 594
425 Ga0265327_10016784 3300031251 Bacteria 4628
426 Ga0265327_10025288 3300031251 Bacteria 3466
427 Ga0265327_10079493 3300031251 Bacteria 1623
428 Ga0307408_101157596 3300031548 Bacteria 720
429 Ga0307516_10254821 3300031730 Unclassified 1448
430 Ga0307413_10096242 3300031824 Bacteria 1943
431 Ga0307413_10480622 3300031824 Unclassified 993
432 Ga0307406_10790915 3300031901 Bacteria 800
433 Ga0307414_10832410 3300032004 Unclassified 843
434 Ga0307414_10920717 3300032004 Bacteria 802
435 Ga0307411_10828499 3300032005 Bacteria 817
436 Ga0307415_100117466 3300032126 Bacteria 1987
437 Ga0373937_0552868 3300036401 Bacteria 1093
438 Ga0395905_0000880 3300037471 Bacteria 39152
439 Ga0395905_0039564 3300037471 Bacteria 4424
440 Ga0436365_1760299 3300039437 Unclassified 755
441 Ga0439439_0018629 3300041406 Bacteria 1717
442 Ga0439453_0059931 3300041408 Bacteria 786
443 Ga0439465_0064822 3300041413 Bacteria 1216
444 Ga0451791_1774381 3300041451 Unclassified 765
445 Ga0451798_1146056 3300041458 Bacteria 518
446 Ga0451837_0296872 3300041494 Bacteria 592
447 Ga0451839_0566319 3300041496 Bacteria 947
448 Ga0439445_0150918 3300042004 Bacteria 676
449 Ga0439449_0064504 3300042007 Bacteria 1351
450 Ga0439457_006726 3300042014 Bacteria 2793
451 Ga0439457_018711 3300042014 Unclassified 1539
452 Ga0450923_014686 3300042125 Bacteria 1456
453 Ga0450896_009261 3300042133 Bacteria 1371
454 Ga0450898_005828 3300042134 Unclassified 1876
455 Ga0439446_0074793 3300042156 Bacteria 1041
456 Ga0439434_0228952 3300042435 Bacteria 632
457 Ga0439444_0004901 3300042437 Bacteria 1964
458 Ga0451577_0017795 3300042876 Bacteria 6558
459 Ga0451577_0474241 3300042876 Unclassified 1136
460 Ga0453684_0164175 3300044712 Bacteria 2624
461 Ga0453684_0885089 3300044712 Unclassified 957
462 Ga0466970_0005316 3300044765 Bacteria 6382
463 Ga0495594_0187864 3300046499 Unclassified 1177
464 Ga0495630_0173378 3300046517 Unclassified 1644
465 Ga0495663_0082900 3300046525 Bacteria 1035
466 Ga0495598_0091182 3300046537 Bacteria 994
467 Ga0495621_0021199 3300046539 Bacteria 2140
468 Ga0495668_0000242 3300046616 Bacteria 78022
469 Ga0495634_0500425 3300046642 Bacteria 712
470 Ga0495600_0493818 3300046809 Bacteria 753
471 Ga0495674_0222354 3300047319 Bacteria 1560
472 Ga0495677_0411487 3300047445 Bacteria 535
473 Ga0496104_0575647 3300048907 Bacteria 1037
474 Ga0496109_0057555 3300048912 Bacteria 3549
475 Ga0501291_145651 3300049514 Unclassified 531
476 Ga0501292_004172 3300049515 Bacteria 1963
477 Ga0501292_027337 3300049515 Bacteria 945
478 Ga0501032_0006362 3300049569 Bacteria 8705
479 Ga0501032_0016376 3300049569 Bacteria 5216
480 Ga0501032_0031070 3300049569 Bacteria 3663
481 Ga0501034_0006235 3300049571 Bacteria 12837
482 Ga0501034_0081604 3300049571 Unclassified 3236
483 Ga0501034_0244563 3300049571 Bacteria 1739
484 Ga0501034_0303925 3300049571 Unclassified 1531
485 Ga0501034_0431823 3300049571 Unclassified 1237
486 Ga0501036_0017337 3300049572 Bacteria 6019
487 Ga0501036_0670469 3300049572 Unclassified 858
488 Ga0501038_0041309 3300049574 Bacteria 4022
489 Ga0501038_0322934 3300049574 Bacteria 1207
490 Ga0501039_0012185 3300049575 Bacteria 6555
491 Ga0501043_0004908 3300049579 Bacteria 10810
492 Ga0501043_0079534 3300049579 Bacteria 2576
493 Ga0501043_1329545 3300049579 Unclassified 501
494 Ga0501046_0003782 3300049580 Bacteria 13851
495 Ga0501046_0715626 3300049580 Unclassified 705
496 Ga0501047_0019301 3300049581 Bacteria 6540
497 Ga0501047_0063478 3300049581 Bacteria 3563
498 Ga0501047_0144031 3300049581 Bacteria 2261
499 Ga0501048_0060437 3300049582 Bacteria 2685
500 Ga0501067_0469522 3300049583 Bacteria 703
501 Ga0501069_0115940 3300049585 Bacteria 1528
502 Ga0501070_0008000 3300049586 Bacteria 8953
503 Ga0501073_0006191 3300049589 Bacteria 8928
504 Ga0501074_0008812 3300049590 Bacteria 7313
505 Ga0501198_001549 3300049649 Bacteria 3025
506 Ga0501202_192313 3300049652 Bacteria 555
507 Ga0501207_006685 3300049654 Bacteria 1627
508 Ga0501209_191335 3300049656 Bacteria 627
509 Ga0501217_000662 3300049661 Bacteria 5835
510 Ga0501217_016471 3300049661 Bacteria 1694
511 Ga0501223_001821 3300049663 Bacteria 4814
512 Ga0501223_125529 3300049663 Bacteria 544
513 Ga0501224_000573 3300049664 Bacteria 4517
514 Ga0501228_028460 3300049666 Bacteria 672
515 Ga0501230_025057 3300049667 Bacteria 1073
516 Ga0501233_008589 3300049668 Bacteria 1973
517 Ga0501240_004003 3300049673 Bacteria 1682
518 Ga0501242_015403 3300049674 Bacteria 953
519 Ga0501243_002316 3300049675 Bacteria 2779
520 Ga0501246_051710 3300049676 Unclassified 515
521 Ga0501249_054667 3300049679 Bacteria 919
522 Ga0501251_002823 3300049681 Bacteria 1704
523 Ga0501252_015849 3300049682 Bacteria 944
524 Ga0501252_077554 3300049682 Bacteria 545
525 Ga0501253_023066 3300049683 Bacteria 1115
526 Ga0501255_011460 3300049684 Bacteria 1022
527 Ga0501256_001315 3300049685 Bacteria 1811
528 Ga0501257_030627 3300049686 Bacteria 1296
529 Ga0501259_000701 3300049688 Bacteria 5410
530 Ga0501259_031059 3300049688 Bacteria 1009
531 Ga0501221_000086 3300049704 Bacteria 10739
532 Ga0501221_253031 3300049704 Bacteria 507
533 Ga0501225_0007974 3300049705 Bacteria 3051
534 Ga0501234_020266 3300049707 Bacteria 1057
535 Ga0501234_093916 3300049707 Bacteria 540
536 Ga0501245_000771 3300049708 Bacteria 3999
537 Ga0501245_099573 3300049708 Bacteria 587
538 Ga0501079_0712128 3300049741 Bacteria 790
539 Ga0501080_0053288 3300049742 Bacteria 3765
540 Ga0501080_1605619 3300049742 Bacteria 551
541 Ga0501083_0135584 3300049744 Bacteria 1613
542 Ga0501241_015454 3300049758 Bacteria 1389
543 Ga0501265_008678 3300049762 Bacteria 1216
544 Ga0501268_002840 3300049765 Bacteria 2319
545 Ga0501268_033164 3300049765 Bacteria 944
546 Ga0501270_124184 3300049767 Bacteria 565
547 Ga0501283_049519 3300049779 Bacteria 742
548 Ga0501035_0005857 3300049822 Bacteria 11590
549 Ga0501035_0017112 3300049822 Bacteria 6680
550 Ga0501035_0326276 3300049822 Bacteria 1289
551 Ga0501044_0009331 3300049823 Bacteria 10705
552 Ga0501044_0297995 3300049823 Bacteria 1542
553 Ga0501204_046342 3300049850 Bacteria 653
554 Ga0501212_026447 3300049851 Bacteria 920
555 nmdc:mga0k408_72214_c1 3300050493 Bacteria 2015
556 nmdc:mga05p37_126978_c1 3300050507 Unclassified 3131
557 nmdc:mga05p37_2034069_c1 3300050507 Bacteria 542
558 nmdc:mga09592_15108_c1 3300050508 Bacteria 6308
559 nmdc:mga09592_1676305_c1 3300050508 Unclassified 513
560 nmdc:mga0qj67_242207_c1 3300050509 Unclassified 1463
561 nmdc:mga06r32_18180_c1 3300050510 Bacteria 6431
562 nmdc:mga08y16_195739_c1 3300050511 Bacteria 2095
563 nmdc:mga08y16_20692_c1 3300050511 Bacteria 6944
564 nmdc:mga08y16_248913_c1 3300050511 Bacteria 1836
565 nmdc:mga08y16_583919_c1 3300050511 Bacteria 1128
566 nmdc:mga08y16_621409_c1 3300050511 Bacteria 1087
567 nmdc:mga0rr50_1712549_c1 3300050513 Unclassified 530
568 Ga0500618_022626 3300053125 Bacteria 1526
569 Ga0500568_0003666 3300053139 Bacteria 8443
570 Ga0500573_0544617 3300053140 Bacteria 515
571 Ga0501082_0020131 3300060353 Bacteria 5750

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006358 Ga0068871_102188288 Ga0068871_1021882881 114
2 3300005614 Ga0068856_100633016 Ga0068856_1006330162 118
3 3300049765 Ga0501268_033164 Ga0501268_033164_209_565 118
4 3300005338 Ga0068868_100807160 Ga0068868_1008071601 119
5 3300005843 Ga0068860_100003309 Ga0068860_1000033096 119
6 3300006237 Ga0097621_100551417 Ga0097621_1005514172 119
7 3300009545 Ga0105237_10800921 Ga0105237_108009212 119
8 3300010375 Ga0105239_10071591 Ga0105239_100715916 119
9 3300013296 Ga0157374_10852005 Ga0157374_108520051 119
10 3300013306 Ga0163162_10004060 Ga0163162_100040605 119
11 3300014968 Ga0157379_10925384 Ga0157379_109253842 119
12 3300026023 Ga0207677_10884259 Ga0207677_108842592 119
13 3300028381 Ga0268264_10050397 Ga0268264_100503971 119
14 3300031251 Ga0265327_10016784 Ga0265327_100167844 119
15 3300031548 Ga0307408_101157596 Ga0307408_1011575962 119
16 3300039437 Ga0436365_1760299 Ga0436365_1760299_11_370 119
17 3300049571 Ga0501034_0431823 Ga0501034_0431823_601_960 119
18 3300049682 Ga0501252_077554 Ga0501252_077554_56_415 119
19 3300049779 Ga0501283_049519 Ga0501283_049519_348_707 119
20 3300053125 Ga0500618_022626 Ga0500618_022626_1077_1436 119
21 3300053140 Ga0500573_0544617 Ga0500573_0544617_121_480 119
22 3300005327 Ga0070658_11213680 Ga0070658_112136801 120
23 3300013105 Ga0157369_10247260 Ga0157369_102472602 120
24 3300013307 Ga0157372_10073469 Ga0157372_100734692 120
25 3300041451 Ga0451791_1774381 Ga0451791_1774381_153_515 120
26 3300042876 Ga0451577_0474241 Ga0451577_0474241_298_660 120
27 3300044712 Ga0453684_0164175 Ga0453684_0164175_2136_2498 120
28 3300046616 Ga0495668_0000242 Ga0495668_0000242_335_697 120
29 3300049569 Ga0501032_0016376 Ga0501032_0016376_2885_3247 120
30 3300049571 Ga0501034_0081604 Ga0501034_0081604_2127_2489 120
31 3300049574 Ga0501038_0322934 Ga0501038_0322934_32_394 120
32 3300049579 Ga0501043_0079534 Ga0501043_0079534_978_1340 120
33 3300049822 Ga0501035_0326276 Ga0501035_0326276_131_493 120
34 3300049823 Ga0501044_0297995 Ga0501044_0297995_1010_1372 120
35 3300005327 Ga0070658_10001648 Ga0070658_100016489 121
36 3300005328 Ga0070676_10001113 Ga0070676_1000111310 121
37 3300005334 Ga0068869_100007522 Ga0068869_1000075228 121
38 3300005334 Ga0068869_100131493 Ga0068869_1001314933 121
39 3300005335 Ga0070666_10000358 Ga0070666_100003586 121
40 3300005338 Ga0068868_100000187 Ga0068868_10000018734 121
41 3300005338 Ga0068868_101604535 Ga0068868_1016045352 121
42 3300005339 Ga0070660_100706540 Ga0070660_1007065401 121
43 3300005340 Ga0070689_100568876 Ga0070689_1005688762 121
44 3300005344 Ga0070661_100466500 Ga0070661_1004665002 121
45 3300005347 Ga0070668_100003714 Ga0070668_1000037147 121
46 3300005353 Ga0070669_100066435 Ga0070669_1000664352 121
47 3300005354 Ga0070675_100323287 Ga0070675_1003232872 121
48 3300005356 Ga0070674_100672004 Ga0070674_1006720042 121
49 3300005364 Ga0070673_100000124 Ga0070673_1000001247 121
50 3300005367 Ga0070667_100000980 Ga0070667_1000009807 121
51 3300005367 Ga0070667_100504135 Ga0070667_1005041352 121
52 3300005455 Ga0070663_100087774 Ga0070663_1000877743 121
53 3300005456 Ga0070678_100614875 Ga0070678_1006148752 121
54 3300005457 Ga0070662_100010835 Ga0070662_1000108357 121
55 3300005459 Ga0068867_100022992 Ga0068867_1000229926 121
56 3300005466 Ga0070685_10254127 Ga0070685_102541272 121
57 3300005535 Ga0070684_100259776 Ga0070684_1002597762 121
58 3300005539 Ga0068853_100002569 Ga0068853_1000025699 121
59 3300005543 Ga0070672_100000105 Ga0070672_10000010530 121
60 3300005548 Ga0070665_100000635 Ga0070665_10000063530 121
61 3300005563 Ga0068855_100072463 Ga0068855_1000724636 121
62 3300005564 Ga0070664_100587894 Ga0070664_1005878943 121
63 3300005577 Ga0068857_100411900 Ga0068857_1004119002 121
64 3300005578 Ga0068854_100069273 Ga0068854_1000692733 121
65 3300005614 Ga0068856_100125471 Ga0068856_1001254714 121
66 3300005616 Ga0068852_100043934 Ga0068852_1000439345 121
67 3300005616 Ga0068852_100553120 Ga0068852_1005531202 121
68 3300005617 Ga0068859_100016832 Ga0068859_1000168327 121
69 3300005618 Ga0068864_100006131 Ga0068864_1000061312 121
70 3300005719 Ga0068861_100094835 Ga0068861_1000948351 121
71 3300005834 Ga0068851_10016169 Ga0068851_100161696 121
72 3300005840 Ga0068870_11461334 Ga0068870_114613342 121
73 3300005841 Ga0068863_100001976 Ga0068863_1000019765 121
74 3300005841 Ga0068863_100671912 Ga0068863_1006719121 121
75 3300005842 Ga0068858_100010584 Ga0068858_1000105847 121
76 3300005842 Ga0068858_100053682 Ga0068858_1000536824 121
77 3300005843 Ga0068860_100001418 Ga0068860_10000141819 121
78 3300005844 Ga0068862_100543410 Ga0068862_1005434102 121
79 3300005844 Ga0068862_101410931 Ga0068862_1014109311 121
80 3300006237 Ga0097621_100001817 Ga0097621_1000018175 121
81 3300006358 Ga0068871_100009967 Ga0068871_1000099679 121
82 3300006881 Ga0068865_100689512 Ga0068865_1006895122 121
83 3300006881 Ga0068865_101481619 Ga0068865_1014816192 121
84 3300006931 Ga0097620_100016833 Ga0097620_1000168334 121
85 3300009093 Ga0105240_10076297 Ga0105240_100762972 121
86 3300009098 Ga0105245_10123697 Ga0105245_101236973 121
87 3300009101 Ga0105247_10017539 Ga0105247_100175396 121
88 3300009148 Ga0105243_10662056 Ga0105243_106620562 121
89 3300009174 Ga0105241_10008820 Ga0105241_100088209 121
90 3300009174 Ga0105241_10372697 Ga0105241_103726972 121
91 3300009176 Ga0105242_10341964 Ga0105242_103419642 121
92 3300009177 Ga0105248_10025712 Ga0105248_100257128 121
93 3300009551 Ga0105238_10097951 Ga0105238_100979512 121
94 3300009553 Ga0105249_10002678 Ga0105249_1000267814 121
95 3300009553 Ga0105249_10020437 Ga0105249_100204375 121
96 3300010375 Ga0105239_10141040 Ga0105239_101410403 121
97 3300013105 Ga0157369_12235688 Ga0157369_122356881 121
98 3300013296 Ga0157374_10002980 Ga0157374_100029807 121
99 3300013297 Ga0157378_10013251 Ga0157378_100132517 121
100 3300013306 Ga0163162_10000312 Ga0163162_1000031230 121
101 3300013307 Ga0157372_10332960 Ga0157372_103329602 121
102 3300013307 Ga0157372_11919917 Ga0157372_119199172 121
103 3300013308 Ga0157375_10002871 Ga0157375_100028719 121
104 3300014325 Ga0163163_10000346 Ga0163163_1000034622 121
105 3300014325 Ga0163163_10057583 Ga0163163_100575833 121
106 3300014968 Ga0157379_10000242 Ga0157379_1000024216 121
107 3300014969 Ga0157376_10002821 Ga0157376_100028218 121
108 3300014969 Ga0157376_10229136 Ga0157376_102291363 121
109 3300017792 Ga0163161_10116704 Ga0163161_101167043 121
110 3300025321 Ga0207656_10004467 Ga0207656_100044672 121
111 3300025903 Ga0207680_10003927 Ga0207680_100039276 121
112 3300025904 Ga0207647_10227495 Ga0207647_102274952 121
113 3300025907 Ga0207645_10001794 Ga0207645_100017947 121
114 3300025909 Ga0207705_10017600 Ga0207705_100176002 121
115 3300025911 Ga0207654_10070468 Ga0207654_100704684 121
116 3300025912 Ga0207707_11463064 Ga0207707_114630641 121
117 3300025913 Ga0207695_10261753 Ga0207695_102617533 121
118 3300025923 Ga0207681_10057500 Ga0207681_100575002 121
119 3300025926 Ga0207659_10294927 Ga0207659_102949272 121
120 3300025927 Ga0207687_10331509 Ga0207687_103315092 121
121 3300025933 Ga0207706_10031804 Ga0207706_100318043 121
122 3300025935 Ga0207709_10581915 Ga0207709_105819152 121
123 3300025938 Ga0207704_10381769 Ga0207704_103817691 121
124 3300025938 Ga0207704_10441076 Ga0207704_104410762 121
125 3300025940 Ga0207691_10000012 Ga0207691_1000001266 121
126 3300025941 Ga0207711_10088381 Ga0207711_100883811 121
127 3300025945 Ga0207679_10054424 Ga0207679_100544242 121
128 3300025949 Ga0207667_10698113 Ga0207667_106981132 121
129 3300025960 Ga0207651_10000216 Ga0207651_100002167 121
130 3300025961 Ga0207712_10011299 Ga0207712_100112997 121
131 3300025972 Ga0207668_10001361 Ga0207668_100013619 121
132 3300025981 Ga0207640_10642371 Ga0207640_106423712 121
133 3300025986 Ga0207658_10000374 Ga0207658_1000037435 121
134 3300025986 Ga0207658_10150153 Ga0207658_101501532 121
135 3300026023 Ga0207677_10000984 Ga0207677_100009847 121
136 3300026023 Ga0207677_11508154 Ga0207677_115081541 121
137 3300026035 Ga0207703_10019138 Ga0207703_100191386 121
138 3300026035 Ga0207703_10078395 Ga0207703_100783952 121
139 3300026041 Ga0207639_10016498 Ga0207639_100164985 121
140 3300026088 Ga0207641_10007761 Ga0207641_100077615 121
141 3300026088 Ga0207641_10309805 Ga0207641_103098053 121
142 3300026089 Ga0207648_10012970 Ga0207648_100129702 121
143 3300026095 Ga0207676_10017316 Ga0207676_100173167 121
144 3300026095 Ga0207676_10058856 Ga0207676_100588565 121
145 3300026116 Ga0207674_10386433 Ga0207674_103864331 121
146 3300026121 Ga0207683_10655878 Ga0207683_106558782 121
147 3300026142 Ga0207698_10009340 Ga0207698_100093407 121
148 3300028379 Ga0268266_10005379 Ga0268266_100053797 121
149 3300028380 Ga0268265_10481603 Ga0268265_104816032 121
150 3300028381 Ga0268264_10003975 Ga0268264_100039758 121
151 3300031730 Ga0307516_10254821 Ga0307516_102548212 121
152 3300041494 Ga0451837_0296872 Ga0451837_0296872_105_470 121
153 3300048907 Ga0496104_0575647 Ga0496104_0575647_328_693 121
154 3300048912 Ga0496109_0057555 Ga0496109_0057555_486_851 121
155 3300049579 Ga0501043_1329545 Ga0501043_1329545_116_481 121
156 3300049580 Ga0501046_0715626 Ga0501046_0715626_166_531 121
157 3300049581 Ga0501047_0063478 Ga0501047_0063478_652_1017 121
158 3300049708 Ga0501245_099573 Ga0501245_099573_105_470 121
159 3300049822 Ga0501035_0017112 Ga0501035_0017112_3288_3653 121
160 3300053139 Ga0500568_0003666 Ga0500568_0003666_5831_6196 121
161 3300003322 rootL2_10200952 rootL2_102009523 122
162 3300005288 Ga0065714_10182733 Ga0065714_101827332 122
163 3300005289 Ga0065704_10089928 Ga0065704_100899282 122
164 3300005289 Ga0065704_10103610 Ga0065704_101036102 122
165 3300005290 Ga0065712_10002222 Ga0065712_100022227 122
166 3300005290 Ga0065712_10043539 Ga0065712_100435391 122
167 3300005290 Ga0065712_10256598 Ga0065712_102565981 122
168 3300005293 Ga0065715_10005986 Ga0065715_100059865 122
169 3300005293 Ga0065715_10365032 Ga0065715_103650322 122
170 3300005295 Ga0065707_10013258 Ga0065707_100132582 122
171 3300005328 Ga0070676_10837650 Ga0070676_108376501 122
172 3300005330 Ga0070690_101193792 Ga0070690_1011937921 122
173 3300005331 Ga0070670_100025113 Ga0070670_1000251137 122
174 3300005331 Ga0070670_100041225 Ga0070670_1000412252 122
175 3300005331 Ga0070670_100431519 Ga0070670_1004315191 122
176 3300005331 Ga0070670_101693224 Ga0070670_1016932241 122
177 3300005333 Ga0070677_10057798 Ga0070677_100577981 122
178 3300005334 Ga0068869_100033589 Ga0068869_1000335896 122
179 3300005334 Ga0068869_100230690 Ga0068869_1002306902 122
180 3300005335 Ga0070666_10687081 Ga0070666_106870811 122
181 3300005338 Ga0068868_100994554 Ga0068868_1009945542 122
182 3300005340 Ga0070689_100013993 Ga0070689_1000139933 122
183 3300005340 Ga0070689_100018385 Ga0070689_1000183853 122
184 3300005343 Ga0070687_100697830 Ga0070687_1006978301 122
185 3300005343 Ga0070687_101438584 Ga0070687_1014385841 122
186 3300005347 Ga0070668_100106593 Ga0070668_1001065933 122
187 3300005347 Ga0070668_101506977 Ga0070668_1015069772 122
188 3300005353 Ga0070669_100004109 Ga0070669_1000041099 122
189 3300005353 Ga0070669_100891519 Ga0070669_1008915191 122
190 3300005353 Ga0070669_101251971 Ga0070669_1012519711 122
191 3300005354 Ga0070675_100007290 Ga0070675_1000072902 122
192 3300005354 Ga0070675_100070045 Ga0070675_1000700453 122
193 3300005354 Ga0070675_100419440 Ga0070675_1004194402 122
194 3300005354 Ga0070675_100620078 Ga0070675_1006200782 122
195 3300005354 Ga0070675_100996146 Ga0070675_1009961461 122
196 3300005354 Ga0070675_102046537 Ga0070675_1020465371 122
197 3300005356 Ga0070674_100372952 Ga0070674_1003729522 122
198 3300005356 Ga0070674_100614442 Ga0070674_1006144422 122
199 3300005364 Ga0070673_100020821 Ga0070673_1000208212 122
200 3300005364 Ga0070673_100256834 Ga0070673_1002568343 122
201 3300005364 Ga0070673_100630659 Ga0070673_1006306591 122
202 3300005365 Ga0070688_100021022 Ga0070688_1000210225 122
203 3300005365 Ga0070688_100024251 Ga0070688_1000242514 122
204 3300005365 Ga0070688_100110762 Ga0070688_1001107622 122
205 3300005365 Ga0070688_100261637 Ga0070688_1002616372 122
206 3300005367 Ga0070667_100295443 Ga0070667_1002954431 122
207 3300005438 Ga0070701_10233378 Ga0070701_102333782 122
208 3300005440 Ga0070705_100670508 Ga0070705_1006705082 122
209 3300005441 Ga0070700_100047150 Ga0070700_1000471504 122
210 3300005441 Ga0070700_100173095 Ga0070700_1001730951 122
211 3300005444 Ga0070694_100988799 Ga0070694_1009887992 122
212 3300005459 Ga0068867_100953814 Ga0068867_1009538141 122
213 3300005459 Ga0068867_100970919 Ga0068867_1009709191 122
214 3300005466 Ga0070685_10002080 Ga0070685_100020809 122
215 3300005466 Ga0070685_10004179 Ga0070685_100041797 122
216 3300005471 Ga0070698_100001241 Ga0070698_10000124125 122
217 3300005471 Ga0070698_100024064 Ga0070698_1000240645 122
218 3300005471 Ga0070698_100055572 Ga0070698_1000555724 122
219 3300005471 Ga0070698_100239629 Ga0070698_1002396293 122
220 3300005518 Ga0070699_100150518 Ga0070699_1001505181 122
221 3300005543 Ga0070672_100030184 Ga0070672_1000301846 122
222 3300005543 Ga0070672_100706635 Ga0070672_1007066352 122
223 3300005543 Ga0070672_101413943 Ga0070672_1014139431 122
224 3300005544 Ga0070686_100140349 Ga0070686_1001403492 122
225 3300005578 Ga0068854_100146313 Ga0068854_1001463133 122
226 3300005615 Ga0070702_100132063 Ga0070702_1001320632 122
227 3300005617 Ga0068859_100099276 Ga0068859_1000992762 122
228 3300005617 Ga0068859_100158567 Ga0068859_1001585673 122
229 3300005617 Ga0068859_100456253 Ga0068859_1004562531 122
230 3300005617 Ga0068859_100561632 Ga0068859_1005616322 122
231 3300005617 Ga0068859_102028218 Ga0068859_1020282181 122
232 3300005617 Ga0068859_102467620 Ga0068859_1024676201 122
233 3300005618 Ga0068864_100136114 Ga0068864_1001361141 122
234 3300005618 Ga0068864_100136404 Ga0068864_1001364043 122
235 3300005719 Ga0068861_100023393 Ga0068861_1000233933 122
236 3300005719 Ga0068861_100033187 Ga0068861_1000331875 122
237 3300005719 Ga0068861_100413277 Ga0068861_1004132772 122
238 3300005719 Ga0068861_100884973 Ga0068861_1008849731 122
239 3300005840 Ga0068870_10168364 Ga0068870_101683642 122
240 3300005840 Ga0068870_10399345 Ga0068870_103993452 122
241 3300005841 Ga0068863_100007551 Ga0068863_1000075518 122
242 3300005841 Ga0068863_100669684 Ga0068863_1006696843 122
243 3300005842 Ga0068858_100222894 Ga0068858_1002228942 122
244 3300005842 Ga0068858_101635994 Ga0068858_1016359941 122
245 3300005843 Ga0068860_100744040 Ga0068860_1007440401 122
246 3300005844 Ga0068862_100002509 Ga0068862_10000250910 122
247 3300005844 Ga0068862_100385177 Ga0068862_1003851772 122
248 3300005985 Ga0081539_10236136 Ga0081539_102361362 122
249 3300006237 Ga0097621_100199891 Ga0097621_1001998911 122
250 3300006237 Ga0097621_100506023 Ga0097621_1005060232 122
251 3300006237 Ga0097621_101553916 Ga0097621_1015539161 122
252 3300006358 Ga0068871_100010690 Ga0068871_1000106907 122
253 3300006358 Ga0068871_100375072 Ga0068871_1003750722 122
254 3300006844 Ga0075428_100040899 Ga0075428_1000408997 122
255 3300006844 Ga0075428_100672582 Ga0075428_1006725822 122
256 3300006846 Ga0075430_100239773 Ga0075430_1002397732 122
257 3300006847 Ga0075431_100299054 Ga0075431_1002990542 122
258 3300006880 Ga0075429_100015826 Ga0075429_1000158269 122
259 3300006880 Ga0075429_100477090 Ga0075429_1004770902 122
260 3300006880 Ga0075429_100609099 Ga0075429_1006090992 122
261 3300006881 Ga0068865_100017646 Ga0068865_1000176461 122
262 3300006931 Ga0097620_100099279 Ga0097620_1000992793 122
263 3300006931 Ga0097620_100158567 Ga0097620_1001585673 122
264 3300006931 Ga0097620_100456237 Ga0097620_1004562371 122
265 3300006931 Ga0097620_100561621 Ga0097620_1005616212 122
266 3300006931 Ga0097620_102028669 Ga0097620_1020286691 122
267 3300006931 Ga0097620_102467663 Ga0097620_1024676631 122
268 3300009094 Ga0111539_10006668 Ga0111539_1000666814 122
269 3300009094 Ga0111539_10117592 Ga0111539_101175924 122
270 3300009094 Ga0111539_10175593 Ga0111539_101755933 122
271 3300009094 Ga0111539_10178539 Ga0111539_101785393 122
272 3300009094 Ga0111539_10258394 Ga0111539_102583943 122
273 3300009094 Ga0111539_10992133 Ga0111539_109921332 122
274 3300009094 Ga0111539_13314173 Ga0111539_133141731 122
275 3300009101 Ga0105247_10001867 Ga0105247_1000186715 122
276 3300009101 Ga0105247_10133032 Ga0105247_101330322 122
277 3300009147 Ga0114129_10005331 Ga0114129_1000533111 122
278 3300009147 Ga0114129_11906917 Ga0114129_119069172 122
279 3300009176 Ga0105242_10018508 Ga0105242_100185084 122
280 3300009176 Ga0105242_12284291 Ga0105242_122842911 122
281 3300009553 Ga0105249_10026181 Ga0105249_100261813 122
282 3300009553 Ga0105249_10031914 Ga0105249_100319145 122
283 3300009553 Ga0105249_10037534 Ga0105249_100375346 122
284 3300009553 Ga0105249_10356050 Ga0105249_103560501 122
285 3300010375 Ga0105239_13361620 Ga0105239_133616201 122
286 3300013297 Ga0157378_10452024 Ga0157378_104520242 122
287 3300013306 Ga0163162_10818473 Ga0163162_108184732 122
288 3300013306 Ga0163162_11258459 Ga0163162_112584592 122
289 3300013307 Ga0157372_10571310 Ga0157372_105713103 122
290 3300013307 Ga0157372_12929480 Ga0157372_129294801 122
291 3300013308 Ga0157375_10055440 Ga0157375_100554404 122
292 3300013308 Ga0157375_10058124 Ga0157375_100581244 122
293 3300013308 Ga0157375_11661213 Ga0157375_116612132 122
294 3300014325 Ga0163163_10201063 Ga0163163_102010633 122
295 3300014325 Ga0163163_12512623 Ga0163163_125126231 122
296 3300014326 Ga0157380_10013625 Ga0157380_100136254 122
297 3300014326 Ga0157380_10017475 Ga0157380_100174754 122
298 3300014326 Ga0157380_10040584 Ga0157380_100405846 122
299 3300014326 Ga0157380_10497993 Ga0157380_104979932 122
300 3300014326 Ga0157380_13272438 Ga0157380_132724381 122
301 3300014745 Ga0157377_10020800 Ga0157377_100208005 122
302 3300014745 Ga0157377_10030434 Ga0157377_100304342 122
303 3300014968 Ga0157379_10480804 Ga0157379_104808042 122
304 3300014968 Ga0157379_10791003 Ga0157379_107910032 122
305 3300014969 Ga0157376_10290128 Ga0157376_102901282 122
306 3300014969 Ga0157376_10754551 Ga0157376_107545511 122
307 3300017792 Ga0163161_10039298 Ga0163161_100392983 122
308 3300017792 Ga0163161_10124184 Ga0163161_101241842 122
309 3300017792 Ga0163161_10134524 Ga0163161_101345242 122
310 3300025315 Ga0207697_10085949 Ga0207697_100859492 122
311 3300025315 Ga0207697_10510406 Ga0207697_105104062 122
312 3300025893 Ga0207682_10022153 Ga0207682_100221532 122
313 3300025899 Ga0207642_10547664 Ga0207642_105476641 122
314 3300025900 Ga0207710_10001574 Ga0207710_1000157412 122
315 3300025908 Ga0207643_10004498 Ga0207643_100044986 122
316 3300025908 Ga0207643_10061552 Ga0207643_100615523 122
317 3300025918 Ga0207662_10011142 Ga0207662_100111423 122
318 3300025922 Ga0207646_11191288 Ga0207646_111912881 122
319 3300025923 Ga0207681_10017038 Ga0207681_100170386 122
320 3300025925 Ga0207650_10094765 Ga0207650_100947652 122
321 3300025925 Ga0207650_10463838 Ga0207650_104638382 122
322 3300025926 Ga0207659_10144909 Ga0207659_101449092 122
323 3300025926 Ga0207659_10250390 Ga0207659_102503902 122
324 3300025926 Ga0207659_10829355 Ga0207659_108293551 122
325 3300025926 Ga0207659_11386765 Ga0207659_113867651 122
326 3300025926 Ga0207659_11470757 Ga0207659_114707571 122
327 3300025933 Ga0207706_10036781 Ga0207706_100367816 122
328 3300025933 Ga0207706_10454890 Ga0207706_104548902 122
329 3300025934 Ga0207686_10001766 Ga0207686_100017663 122
330 3300025936 Ga0207670_10002352 Ga0207670_100023525 122
331 3300025936 Ga0207670_10020981 Ga0207670_100209813 122
332 3300025937 Ga0207669_11102418 Ga0207669_111024181 122
333 3300025940 Ga0207691_10001776 Ga0207691_1000177611 122
334 3300025940 Ga0207691_10218251 Ga0207691_102182513 122
335 3300025942 Ga0207689_10046539 Ga0207689_100465394 122
336 3300025960 Ga0207651_10057394 Ga0207651_100573942 122
337 3300025960 Ga0207651_10128181 Ga0207651_101281813 122
338 3300025960 Ga0207651_10752529 Ga0207651_107525292 122
339 3300025961 Ga0207712_10006134 Ga0207712_100061349 122
340 3300025961 Ga0207712_10012082 Ga0207712_100120822 122
341 3300025961 Ga0207712_10364743 Ga0207712_103647431 122
342 3300025972 Ga0207668_10283661 Ga0207668_102836613 122
343 3300025972 Ga0207668_10935222 Ga0207668_109352221 122
344 3300025972 Ga0207668_11964447 Ga0207668_119644471 122
345 3300025981 Ga0207640_10128000 Ga0207640_101280002 122
346 3300025986 Ga0207658_10262861 Ga0207658_102628612 122
347 3300026023 Ga0207677_10116924 Ga0207677_101169242 122
348 3300026041 Ga0207639_11209399 Ga0207639_112093992 122
349 3300026075 Ga0207708_10393671 Ga0207708_103936712 122
350 3300026075 Ga0207708_10619445 Ga0207708_106194451 122
351 3300026088 Ga0207641_10000549 Ga0207641_100005499 122
352 3300026088 Ga0207641_10188413 Ga0207641_101884132 122
353 3300026088 Ga0207641_10586385 Ga0207641_105863851 122
354 3300026089 Ga0207648_10253340 Ga0207648_102533403 122
355 3300026089 Ga0207648_10399598 Ga0207648_103995982 122
356 3300026095 Ga0207676_10086780 Ga0207676_100867803 122
357 3300026116 Ga0207674_10168304 Ga0207674_101683043 122
358 3300026118 Ga0207675_100002745 Ga0207675_1000027458 122
359 3300026118 Ga0207675_100082732 Ga0207675_1000827324 122
360 3300026118 Ga0207675_100886530 Ga0207675_1008865302 122
361 3300026118 Ga0207675_100905029 Ga0207675_1009050291 122
362 3300026118 Ga0207675_101240568 Ga0207675_1012405682 122
363 3300026121 Ga0207683_10038720 Ga0207683_100387202 122
364 3300027907 Ga0207428_10040954 Ga0207428_100409542 122
365 3300027907 Ga0207428_10166363 Ga0207428_101663633 122
366 3300027907 Ga0207428_10895158 Ga0207428_108951581 122
367 3300028380 Ga0268265_10022623 Ga0268265_100226232 122
368 3300028380 Ga0268265_10054023 Ga0268265_100540233 122
369 3300028381 Ga0268264_10348450 Ga0268264_103484502 122
370 3300028381 Ga0268264_11693305 Ga0268264_116933051 122
371 3300031824 Ga0307413_10096242 Ga0307413_100962423 122
372 3300031824 Ga0307413_10480622 Ga0307413_104806222 122
373 3300031901 Ga0307406_10790915 Ga0307406_107909152 122
374 3300032004 Ga0307414_10832410 Ga0307414_108324102 122
375 3300032004 Ga0307414_10920717 Ga0307414_109207171 122
376 3300032005 Ga0307411_10828499 Ga0307411_108284992 122
377 3300032126 Ga0307415_100117466 Ga0307415_1001174661 122
378 3300036401 Ga0373937_0552868 Ga0373937_0552868_354_722 122
379 3300037471 Ga0395905_0000880 Ga0395905_0000880_25265_25684 122
380 3300037471 Ga0395905_0039564 Ga0395905_0039564_2304_2672 122
381 3300041406 Ga0439439_0018629 Ga0439439_0018629_497_865 122
382 3300041408 Ga0439453_0059931 Ga0439453_0059931_195_563 122
383 3300041413 Ga0439465_0064822 Ga0439465_0064822_411_779 122
384 3300041458 Ga0451798_1146056 Ga0451798_1146056_40_408 122
385 3300041496 Ga0451839_0566319 Ga0451839_0566319_284_652 122
386 3300042004 Ga0439445_0150918 Ga0439445_0150918_143_511 122
387 3300042007 Ga0439449_0064504 Ga0439449_0064504_653_1021 122
388 3300042014 Ga0439457_006726 Ga0439457_006726_2167_2544 122
389 3300042014 Ga0439457_018711 Ga0439457_018711_760_1128 122
390 3300042125 Ga0450923_014686 Ga0450923_014686_157_525 122
391 3300042133 Ga0450896_009261 Ga0450896_009261_82_450 122
392 3300042134 Ga0450898_005828 Ga0450898_005828_1340_1708 122
393 3300042156 Ga0439446_0074793 Ga0439446_0074793_462_830 122
394 3300042435 Ga0439434_0228952 Ga0439434_0228952_28_396 122
395 3300042437 Ga0439444_0004901 Ga0439444_0004901_1398_1766 122
396 3300044765 Ga0466970_0005316 Ga0466970_0005316_1896_2276 122
397 3300046499 Ga0495594_0187864 Ga0495594_0187864_384_752 122
398 3300046525 Ga0495663_0082900 Ga0495663_0082900_311_679 122
399 3300046537 Ga0495598_0091182 Ga0495598_0091182_542_910 122
400 3300046539 Ga0495621_0021199 Ga0495621_0021199_1541_1909 122
401 3300046809 Ga0495600_0493818 Ga0495600_0493818_95_463 122
402 3300047445 Ga0495677_0411487 Ga0495677_0411487_50_418 122
403 3300049514 Ga0501291_145651 Ga0501291_145651_73_441 122
404 3300049515 Ga0501292_004172 Ga0501292_004172_1106_1474 122
405 3300049515 Ga0501292_027337 Ga0501292_027337_94_462 122
406 3300049569 Ga0501032_0006362 Ga0501032_0006362_7049_7417 122
407 3300049571 Ga0501034_0006235 Ga0501034_0006235_9537_9905 122
408 3300049572 Ga0501036_0017337 Ga0501036_0017337_2970_3338 122
409 3300049574 Ga0501038_0041309 Ga0501038_0041309_1627_1995 122
410 3300049575 Ga0501039_0012185 Ga0501039_0012185_1574_1942 122
411 3300049579 Ga0501043_0004908 Ga0501043_0004908_5872_6240 122
412 3300049580 Ga0501046_0003782 Ga0501046_0003782_2136_2504 122
413 3300049581 Ga0501047_0019301 Ga0501047_0019301_5350_5718 122
414 3300049582 Ga0501048_0060437 Ga0501048_0060437_200_568 122
415 3300049583 Ga0501067_0469522 Ga0501067_0469522_94_462 122
416 3300049585 Ga0501069_0115940 Ga0501069_0115940_962_1330 122
417 3300049586 Ga0501070_0008000 Ga0501070_0008000_1746_2114 122
418 3300049589 Ga0501073_0006191 Ga0501073_0006191_7601_7969 122
419 3300049590 Ga0501074_0008812 Ga0501074_0008812_5731_6099 122
420 3300049649 Ga0501198_001549 Ga0501198_001549_615_983 122
421 3300049652 Ga0501202_192313 Ga0501202_192313_147_515 122
422 3300049654 Ga0501207_006685 Ga0501207_006685_417_785 122
423 3300049656 Ga0501209_191335 Ga0501209_191335_96_464 122
424 3300049661 Ga0501217_000662 Ga0501217_000662_1753_2121 122
425 3300049661 Ga0501217_016471 Ga0501217_016471_826_1194 122
426 3300049663 Ga0501223_001821 Ga0501223_001821_444_812 122
427 3300049663 Ga0501223_125529 Ga0501223_125529_119_487 122
428 3300049664 Ga0501224_000573 Ga0501224_000573_651_1019 122
429 3300049666 Ga0501228_028460 Ga0501228_028460_126_494 122
430 3300049667 Ga0501230_025057 Ga0501230_025057_35_403 122
431 3300049668 Ga0501233_008589 Ga0501233_008589_1294_1662 122
432 3300049673 Ga0501240_004003 Ga0501240_004003_1096_1464 122
433 3300049674 Ga0501242_015403 Ga0501242_015403_318_686 122
434 3300049675 Ga0501243_002316 Ga0501243_002316_1190_1558 122
435 3300049676 Ga0501246_051710 Ga0501246_051710_18_386 122
436 3300049679 Ga0501249_054667 Ga0501249_054667_522_890 122
437 3300049681 Ga0501251_002823 Ga0501251_002823_150_518 122
438 3300049682 Ga0501252_015849 Ga0501252_015849_132_500 122
439 3300049683 Ga0501253_023066 Ga0501253_023066_534_902 122
440 3300049684 Ga0501255_011460 Ga0501255_011460_505_873 122
441 3300049685 Ga0501256_001315 Ga0501256_001315_1401_1769 122
442 3300049686 Ga0501257_030627 Ga0501257_030627_742_1110 122
443 3300049688 Ga0501259_000701 Ga0501259_000701_3361_3729 122
444 3300049688 Ga0501259_031059 Ga0501259_031059_316_684 122
445 3300049704 Ga0501221_000086 Ga0501221_000086_6662_7030 122
446 3300049704 Ga0501221_253031 Ga0501221_253031_102_470 122
447 3300049705 Ga0501225_0007974 Ga0501225_0007974_420_788 122
448 3300049707 Ga0501234_020266 Ga0501234_020266_437_805 122
449 3300049707 Ga0501234_093916 Ga0501234_093916_77_445 122
450 3300049708 Ga0501245_000771 Ga0501245_000771_298_666 122
451 3300049741 Ga0501079_0712128 Ga0501079_0712128_351_719 122
452 3300049742 Ga0501080_0053288 Ga0501080_0053288_99_467 122
453 3300049744 Ga0501083_0135584 Ga0501083_0135584_606_974 122
454 3300049758 Ga0501241_015454 Ga0501241_015454_76_444 122
455 3300049762 Ga0501265_008678 Ga0501265_008678_429_797 122
456 3300049765 Ga0501268_002840 Ga0501268_002840_33_401 122
457 3300049767 Ga0501270_124184 Ga0501270_124184_49_417 122
458 3300049822 Ga0501035_0005857 Ga0501035_0005857_5349_5717 122
459 3300049823 Ga0501044_0009331 Ga0501044_0009331_4603_4971 122
460 3300049850 Ga0501204_046342 Ga0501204_046342_162_530 122
461 3300049851 Ga0501212_026447 Ga0501212_026447_68_436 122
462 3300050507 nmdc:mga05p37_126978_c1 nmdc:mga05p37_126978_c1_65_433 122
463 3300050507 nmdc:mga05p37_2034069_c1 nmdc:mga05p37_2034069_c1_31_399 122
464 3300050508 nmdc:mga09592_15108_c1 nmdc:mga09592_15108_c1_5813_6181 122
465 3300050508 nmdc:mga09592_1676305_c1 nmdc:mga09592_1676305_c1_106_474 122
466 3300050509 nmdc:mga0qj67_242207_c1 nmdc:mga0qj67_242207_c1_617_985 122
467 3300050510 nmdc:mga06r32_18180_c1 nmdc:mga06r32_18180_c1_1549_1917 122
468 3300050511 nmdc:mga08y16_195739_c1 nmdc:mga08y16_195739_c1_742_1110 122
469 3300050511 nmdc:mga08y16_20692_c1 nmdc:mga08y16_20692_c1_3422_3790 122
470 3300050511 nmdc:mga08y16_248913_c1 nmdc:mga08y16_248913_c1_717_1085 122
471 3300050511 nmdc:mga08y16_583919_c1 nmdc:mga08y16_583919_c1_98_466 122
472 3300050511 nmdc:mga08y16_621409_c1 nmdc:mga08y16_621409_c1_612_980 122
473 3300060353 Ga0501082_0020131 Ga0501082_0020131_2215_2583 122
474 3300002077 JGI24744J21845_10028448 JGI24744J21845_100284482 123
475 3300003215 JGI25153J46596_10048619 JGI25153J46596_100486192 123
476 3300003354 JGI25160J50197_1005846 JGI25160J50197_10058463 123
477 3300003790 Ga0055528_1000307 Ga0055528_100030711 123
478 3300003791 Ga0055530_10001712 Ga0055530_100017123 123
479 3300004625 Ga0055543_1017342 Ga0055543_10173422 123
480 3300005262 Ga0065165_1000722 Ga0065165_100072214 123
481 3300005330 Ga0070690_100266254 Ga0070690_1002662543 123
482 3300005334 Ga0068869_100141613 Ga0068869_1001416132 123
483 3300005335 Ga0070666_10450397 Ga0070666_104503971 123
484 3300005338 Ga0068868_100105822 Ga0068868_1001058223 123
485 3300005343 Ga0070687_100011391 Ga0070687_1000113914 123
486 3300005353 Ga0070669_100390225 Ga0070669_1003902251 123
487 3300005354 Ga0070675_100611429 Ga0070675_1006114291 123
488 3300005355 Ga0070671_100266299 Ga0070671_1002662992 123
489 3300005364 Ga0070673_100225863 Ga0070673_1002258632 123
490 3300005438 Ga0070701_10197861 Ga0070701_101978612 123
491 3300005441 Ga0070700_101304083 Ga0070700_1013040831 123
492 3300005455 Ga0070663_100794034 Ga0070663_1007940342 123
493 3300005456 Ga0070678_100086792 Ga0070678_1000867921 123
494 3300005457 Ga0070662_100577376 Ga0070662_1005773761 123
495 3300005466 Ga0070685_10706994 Ga0070685_107069941 123
496 3300005539 Ga0068853_100033328 Ga0068853_1000333283 123
497 3300005543 Ga0070672_100048718 Ga0070672_1000487183 123
498 3300005544 Ga0070686_100042427 Ga0070686_1000424273 123
499 3300005548 Ga0070665_100707600 Ga0070665_1007076002 123
500 3300005578 Ga0068854_100237692 Ga0068854_1002376923 123
501 3300005618 Ga0068864_101454835 Ga0068864_1014548351 123
502 3300005618 Ga0068864_101998794 Ga0068864_1019987941 123
503 3300005719 Ga0068861_100800181 Ga0068861_1008001811 123
504 3300005834 Ga0068851_10528380 Ga0068851_105283801 123
505 3300005840 Ga0068870_10236799 Ga0068870_102367991 123
506 3300005842 Ga0068858_101256789 Ga0068858_1012567892 123
507 3300005843 Ga0068860_101248065 Ga0068860_1012480651 123
508 3300006237 Ga0097621_100452739 Ga0097621_1004527392 123
509 3300007076 Ga0075435_101359135 Ga0075435_1013591351 123
510 3300009093 Ga0105240_10000746 Ga0105240_1000074616 123
511 3300009093 Ga0105240_11726909 Ga0105240_117269091 123
512 3300009177 Ga0105248_10906132 Ga0105248_109061322 123
513 3300011119 Ga0105246_11101908 Ga0105246_111019082 123
514 3300013297 Ga0157378_10263310 Ga0157378_102633102 123
515 3300013306 Ga0163162_10153332 Ga0163162_101533323 123
516 3300013306 Ga0163162_12210654 Ga0163162_122106541 123
517 3300013308 Ga0157375_10005226 Ga0157375_1000522611 123
518 3300013308 Ga0157375_10155653 Ga0157375_101556533 123
519 3300014325 Ga0163163_10043685 Ga0163163_100436856 123
520 3300014325 Ga0163163_10299526 Ga0163163_102995262 123
521 3300014326 Ga0157380_10142780 Ga0157380_101427804 123
522 3300014326 Ga0157380_10369636 Ga0157380_103696362 123
523 3300014326 Ga0157380_10927474 Ga0157380_109274741 123
524 3300014326 Ga0157380_12881230 Ga0157380_128812301 123
525 3300014745 Ga0157377_10419857 Ga0157377_104198572 123
526 3300025273 Ga0209673_1000242 Ga0209673_100024230 123
527 3300025295 Ga0209564_1015069 Ga0209564_10150694 123
528 3300025297 Ga0209758_1010949 Ga0209758_10109495 123
529 3300025298 Ga0209050_1000298 Ga0209050_100029862 123
530 3300025302 Ga0207426_1001104 Ga0207426_10011047 123
531 3300025304 Ga0209257_1007367 Ga0209257_10073676 123
532 3300025901 Ga0207688_10234220 Ga0207688_102342202 123
533 3300025903 Ga0207680_10259804 Ga0207680_102598041 123
534 3300025907 Ga0207645_10006873 Ga0207645_100068739 123
535 3300025908 Ga0207643_10118908 Ga0207643_101189083 123
536 3300025913 Ga0207695_10000647 Ga0207695_1000064733 123
537 3300025918 Ga0207662_10048615 Ga0207662_100486153 123
538 3300025925 Ga0207650_10279214 Ga0207650_102792142 123
539 3300025931 Ga0207644_10044561 Ga0207644_100445614 123
540 3300025933 Ga0207706_10546629 Ga0207706_105466291 123
541 3300025936 Ga0207670_10344666 Ga0207670_103446662 123
542 3300025938 Ga0207704_10845247 Ga0207704_108452472 123
543 3300025940 Ga0207691_10026934 Ga0207691_100269344 123
544 3300025940 Ga0207691_11043248 Ga0207691_110432482 123
545 3300025941 Ga0207711_11992990 Ga0207711_119929901 123
546 3300025942 Ga0207689_10269254 Ga0207689_102692542 123
547 3300025960 Ga0207651_10346578 Ga0207651_103465782 123
548 3300026023 Ga0207677_10060994 Ga0207677_100609943 123
549 3300026035 Ga0207703_10513343 Ga0207703_105133432 123
550 3300026088 Ga0207641_10127104 Ga0207641_101271043 123
551 3300026089 Ga0207648_10403188 Ga0207648_104031883 123
552 3300026118 Ga0207675_100314173 Ga0207675_1003141732 123
553 3300026121 Ga0207683_10047913 Ga0207683_100479135 123
554 3300026121 Ga0207683_10131329 Ga0207683_101313291 123
555 3300026142 Ga0207698_10734721 Ga0207698_107347212 123
556 3300028381 Ga0268264_11965261 Ga0268264_119652611 123
557 3300031251 Ga0265327_10025288 Ga0265327_100252886 123
558 3300031251 Ga0265327_10079493 Ga0265327_100794932 123
559 3300042876 Ga0451577_0017795 Ga0451577_0017795_3362_3736 123
560 3300044712 Ga0453684_0885089 Ga0453684_0885089_195_569 123
561 3300046517 Ga0495630_0173378 Ga0495630_0173378_1051_1422 123
562 3300046642 Ga0495634_0500425 Ga0495634_0500425_53_424 123
563 3300047319 Ga0495674_0222354 Ga0495674_0222354_56_427 123
564 3300049569 Ga0501032_0031070 Ga0501032_0031070_2539_2913 123
565 3300049571 Ga0501034_0244563 Ga0501034_0244563_1329_1703 123
566 3300049571 Ga0501034_0303925 Ga0501034_0303925_240_614 123
567 3300049572 Ga0501036_0670469 Ga0501036_0670469_430_804 123
568 3300049581 Ga0501047_0144031 Ga0501047_0144031_1008_1382 123
569 3300049742 Ga0501080_1605619 Ga0501080_1605619_60_434 123
570 3300050493 nmdc:mga0k408_72214_c1 nmdc:mga0k408_72214_c1_1100_1483 123
571 3300050513 nmdc:mga0rr50_1712549_c1 nmdc:mga0rr50_1712549_c1_45_416 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

4

114

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9774 4 123
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9617 4 123
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.8691 5 123
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.8671 5 120
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.837 5 123
ID Description Score Start End Superfamily
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9695 4 123 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 4 123 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8691 5 123 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.837 5 123 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8268 4 116 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1J5SU64-F1-model_v4 CoA-binding domain-containing protein 1.002 6 123
AF-A0A4Q0AZ43-F1-model_v4 CoA-binding protein 1 6 123
AF-A0A4R1HVA8-F1-model_v4 deleted 1 4 123
AF-A0A066WXJ3-F1-model_v4 CoA-binding protein 0.9993 4 123
AF-A0A6I3LY05-F1-model_v4 CoA-binding protein 0.9988 4 123

Feature Viewer

pLDDT pTM Quality
96.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map