F465005

General Info

Members Datasets Scaffolds Average Seq Length
571 322 1142 324

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_10461_c1|nmdc:mga03n38_10461_c1_151_1266
Length 371
Sequence MACDRPDARRSAALNFPAGQTLRLRARSGFENGRVILAIQKAAPMPQALISRRRFTLAATAAAIIPMPALAQGTWPSKPIRIIVPYTPGGFTDQMARLVQVGLQSRLGQPVVIDNKPGANSLIGVDAIAKAAPDGTTFGVVIAAYAANTTLYPKLPYDPQKDLTGVSLMGVSPLLAAVNVDAPFKTARELIAYARANPGKVSFGSSGNGSAAHLTTELWKSLTQTYMIHIPYRGAVPALTDLMGGQIQLFFDAPTGLINQAKAGKVRLIGVAGDKRLPAVPDVPTFIEQGFAGFTGSTWAGMLAPAGTPRDIVKRMSEEVARIIKSDETRAKLDAMGTFPAGSTPEEFDAFIAAETAKWAKVIRTAGVKAE

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
138 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
155 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
220 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
244 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
249 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
253 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
257 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
260 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
261 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
262 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
265 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
266 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
267 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
268 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
269 2643221570 Acidovorax sp. Root568 Isolate Unclassified
270 2643221596 Acidovorax sp. Root70 Isolate Unclassified
271 2643221609 Acidovorax sp. Root217 Isolate Unclassified
272 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
273 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
274 2643221652 Acidovorax sp. Root402 Isolate Unclassified
275 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
276 2643221658 Variovorax sp. Root411 Isolate Unclassified
277 2643221672 Variovorax sp. Root434 Isolate Unclassified
278 2643221683 Variovorax sp. Root473 Isolate Unclassified
279 2643221736 Bosea sp. Root483D1 Isolate Unclassified
280 2721755523 Delftia sp. HK171 Isolate Unclassified
281 2738541277 Variovorax sp. GV051 Isolate Unclassified
282 2738541307 Variovorax sp. GV008 Isolate Unclassified
283 2738543012 Acidovorax sp. CF301 Isolate Unclassified
284 2738543019 Variovorax sp. GV040 Isolate Unclassified
285 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
286 2816332133 Acidovorax radicis 2721A Isolate Unclassified
287 2818991467 Bosea vestrisii 3192 Isolate Unclassified
288 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
289 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
290 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
291 2841760612 Bosea sp. Tri-49 Isolate Nodule
292 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
293 2842677519 Variovorax sp. R-72495 Isolate Unclassified
294 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
295 2842733646 Variovorax sp. R-72446 Isolate Unclassified
296 2842747753 Variovorax sp. R-72060 Isolate Unclassified
297 2844104063 Bosea sp. Tri-39 Isolate Nodule
298 2851182111 Bosea sp. Tri-44 Isolate Nodule
299 2851246043 Bosea sp. Tri-54 Isolate Nodule
300 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
301 2885198086 Variovorax sp. 679 Isolate Unclassified
302 2885211737 Variovorax sp. 553 Isolate Unclassified
303 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
304 2904456579 Variovorax sp. 2002 Isolate Unclassified
305 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
306 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
307 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
308 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
309 2928070936 Variovorax gossypii 1167 Isolate Unclassified
310 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
311 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
312 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
313 2929520902 Variovorax beijingensis 502 Isolate Unclassified
314 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
315 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
316 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
317 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
318 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
319 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
320 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
321 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
322 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.22
Metatranscriptomes 0.7
Isolates 12.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.75
Nodule 2.45
Rhizoplane 2.63
Rhizosphere 40.98
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_10461_c1 3300050490 Bacteria 1611
2 JGI25155J39150_1000062 3300002704 Bacteria 70719
3 JGI25156J39149_1000012 3300002705 Bacteria 194393
4 JGI25154J39366_1000029 3300002738 Bacteria 194393
5 JGI25157J39369_1000014 3300002741 Bacteria 194393
6 JGI25152J39213_1000673 3300002773 Bacteria 17796
7 JGI25150J39212_1000503 3300002774 Bacteria 16237
8 JGI25159J45721_1000505 3300002987 Bacteria 17796
9 JGI25159J45721_1001997 3300002987 Bacteria 8115
10 JGI25159J45721_1005379 3300002987 Bacteria 4028
11 JGI25151J46595_10001271 3300003187 Bacteria 17818
12 JGI25151J46595_10001929 3300003187 Bacteria 13151
13 JGI25151J46595_10004683 3300003187 Bacteria 7194
14 JGI25153J46596_10000930 3300003215 Bacteria 17796
15 rootH1_10174792 3300003323 Bacteria 1661
16 JGI25160J50197_1000732 3300003354 Bacteria 17980
17 JGI25160J50197_1018065 3300003354 Bacteria 2210
18 JGI25161J50226_1000898 3300003374 Bacteria 10728
19 JGI25161J50226_1003193 3300003374 Bacteria 3861
20 Ga0006562J51391_1125836 3300003578 Bacteria 8135
21 Ga0006562J51391_1125839 3300003578 Bacteria 4150
22 Ga0006562J51391_1183337 3300003578 Bacteria 1810
23 Ga0055526_1000184 3300003771 Bacteria 54504
24 Ga0055526_1001027 3300003771 Bacteria 20402
25 Ga0055526_1002078 3300003771 Bacteria 13756
26 Ga0055537_1000006 3300003773 Bacteria 147020
27 Ga0055537_1000036 3300003773 Bacteria 96045
28 Ga0055537_1000683 3300003773 Bacteria 17796
29 Ga0055537_1014642 3300003773 Bacteria 1413
30 Ga0055524_1000032 3300003775 Bacteria 182182
31 Ga0055524_1000326 3300003775 Bacteria 44488
32 Ga0055524_1000828 3300003775 Bacteria 20395
33 Ga0055524_1001149 3300003775 Bacteria 15943
34 Ga0055536_1000875 3300003781 Bacteria 19566
35 Ga0055536_1001160 3300003781 Bacteria 16475
36 Ga0055536_1002042 3300003781 Bacteria 11558
37 Ga0055536_1002368 3300003781 Bacteria 10652
38 Ga0055536_1023771 3300003781 Bacteria 1793
39 Ga0055534_1000018 3300003784 Bacteria 138136
40 Ga0055534_1000048 3300003784 Bacteria 94388
41 Ga0055534_1000535 3300003784 Bacteria 20395
42 Ga0055534_1001805 3300003784 Bacteria 8041
43 Ga0055534_1001837 3300003784 Bacteria 7925
44 Ga0055534_1007558 3300003784 Bacteria 2573
45 Ga0055528_1000903 3300003790 Bacteria 20020
46 Ga0055528_1001096 3300003790 Bacteria 17796
47 Ga0055528_1024195 3300003790 Bacteria 1828
48 Ga0055528_1030796 3300003790 Bacteria 1413
49 Ga0055530_10000086 3300003791 Bacteria 80109
50 Ga0055530_10007519 3300003791 Bacteria 4567
51 Ga0055540_1000073 3300003792 Bacteria 117148
52 Ga0055540_1000894 3300003792 Bacteria 19665
53 Ga0055540_1001765 3300003792 Bacteria 12335
54 Ga0055540_1003761 3300003792 Bacteria 7157
55 Ga0055540_1004096 3300003792 Bacteria 6751
56 Ga0055540_1004991 3300003792 Bacteria 5769
57 Ga0055531_10001217 3300003794 Bacteria 19681
58 Ga0055531_10002312 3300003794 Bacteria 12878
59 Ga0055531_10004635 3300003794 Bacteria 8258
60 Ga0055531_10038210 3300003794 Bacteria 1444
61 Ga0055543_1000964 3300004625 Bacteria 13096
62 Ga0055543_1002819 3300004625 Bacteria 5495
63 Ga0065165_1000150 3300005262 Bacteria 121992
64 Ga0065165_1001252 3300005262 Bacteria 28771
65 Ga0065165_1006153 3300005262 Bacteria 6415
66 Ga0065165_1007800 3300005262 Bacteria 5158
67 Ga0065165_1010337 3300005262 Bacteria 4047
68 Ga0065165_1031593 3300005262 Bacteria 1671
69 Ga0065714_10007015 3300005288 Bacteria 4249
70 Ga0065704_10088799 3300005289 Bacteria 2910
71 Ga0070658_10090874 3300005327 Bacteria 2516
72 Ga0070676_10021421 3300005328 Bacteria 3619
73 Ga0070668_100156757 3300005347 Bacteria 1845
74 Ga0070668_100205342 3300005347 Bacteria 1619
75 Ga0070669_100244868 3300005353 Bacteria 1426
76 Ga0070675_100019069 3300005354 Bacteria 5465
77 Ga0070674_100254776 3300005356 Bacteria 1380
78 Ga0070667_100028805 3300005367 Bacteria 4624
79 Ga0070678_100043273 3300005456 Bacteria 3206
80 Ga0070678_100105947 3300005456 Bacteria 2190
81 Ga0068867_100033126 3300005459 Bacteria 3739
82 Ga0068853_100085237 3300005539 Unclassified 2769
83 Ga0070672_100071128 3300005543 Bacteria 2766
84 Ga0070665_100315422 3300005548 Bacteria 1567
85 Ga0070664_100047093 3300005564 Bacteria 3643
86 Ga0068857_100104216 3300005577 Bacteria 2547
87 Ga0068857_100127667 3300005577 Bacteria 2292
88 Ga0068854_100062233 3300005578 Bacteria 2705
89 Ga0070702_100247048 3300005615 Bacteria 1207
90 Ga0068852_100130372 3300005616 Bacteria 2315
91 Ga0068863_100170570 3300005841 Bacteria 2087
92 Ga0068863_100284909 3300005841 Bacteria 1601
93 Ga0068860_100196425 3300005843 Bacteria 1954
94 Ga0068862_100032571 3300005844 Bacteria 4404
95 Ga0075365_10015817 3300006038 Bacteria 4571
96 Ga0075365_10027431 3300006038 Bacteria 3624
97 Ga0075365_10072562 3300006038 Bacteria 2319
98 Ga0075368_10009942 3300006042 Bacteria 3432
99 Ga0075368_10081726 3300006042 Bacteria 1315
100 Ga0075363_100049383 3300006048 Bacteria 2240
101 Ga0075363_100188494 3300006048 Bacteria 1176
102 Ga0075364_10021924 3300006051 Bacteria 4029
103 Ga0075364_10029776 3300006051 Bacteria 3502
104 Ga0075432_10010889 3300006058 Bacteria 3087
105 Ga0075362_10001734 3300006177 Bacteria 7079
106 Ga0075362_10004440 3300006177 Bacteria 5043
107 Ga0075362_10110720 3300006177 Bacteria 1292
108 Ga0075366_10009077 3300006195 Bacteria 5544
109 Ga0075366_10012090 3300006195 Bacteria 4888
110 Ga0075366_10021112 3300006195 Bacteria 3786
111 Ga0075366_10040208 3300006195 Bacteria 2765
112 Ga0075366_10172716 3300006195 Bacteria 1312
113 Ga0097621_100377961 3300006237 Bacteria 1265
114 Ga0075370_10005227 3300006353 Bacteria 6422
115 Ga0075370_10007084 3300006353 Bacteria 5692
116 Ga0075370_10035937 3300006353 Bacteria 2782
117 Ga0075370_10041025 3300006353 Bacteria 2612
118 Ga0075370_10113002 3300006353 Bacteria 1578
119 Ga0075430_100000003 3300006846 Bacteria 134093
120 Ga0075430_100031429 3300006846 Bacteria 4506
121 Ga0075431_100023776 3300006847 Bacteria 6272
122 Ga0068865_100215065 3300006881 Bacteria 1500
123 Ga0068865_100298878 3300006881 Bacteria 1288
124 Ga0075436_100025269 3300006914 Bacteria 4086
125 Ga0079104_1000056 3300006946 Bacteria 166276
126 Ga0079104_1001506 3300006946 Bacteria 15478
127 Ga0099826_10000369 3300006948 Bacteria 20858
128 Ga0105250_10082417 3300009092 Bacteria 1304
129 Ga0105240_10153597 3300009093 Bacteria 2740
130 Ga0114129_10324252 3300009147 Bacteria 2047
131 Ga0114129_10693568 3300009147 Bacteria 1309
132 Ga0105243_10000481 3300009148 Bacteria 40913
133 Ga0105243_10009917 3300009148 Bacteria 7243
134 Ga0105243_10020508 3300009148 Bacteria 5011
135 Ga0105243_10181790 3300009148 Bacteria 1829
136 Ga0105243_10330639 3300009148 Bacteria 1392
137 Ga0105242_10001456 3300009176 Bacteria 18628
138 Ga0105237_10236605 3300009545 Bacteria 1827
139 Ga0105239_10705162 3300010375 Bacteria 1154
140 Ga0157347_1001465 3300012502 Bacteria 1856
141 Ga0157373_10018829 3300013100 Bacteria 5024
142 Ga0157370_10008744 3300013104 Bacteria 10889
143 Ga0157370_10244187 3300013104 Bacteria 1661
144 Ga0157370_10244360 3300013104 Bacteria 1661
145 Ga0157369_10108768 3300013105 Bacteria 2948
146 Ga0163162_10400960 3300013306 Bacteria 1504
147 Ga0163163_10255097 3300014325 Bacteria 1805
148 Ga0157380_10056306 3300014326 Bacteria 3126
149 Ga0157380_10073871 3300014326 Bacteria 2766
150 Ga0182008_10003480 3300014497 Bacteria 9499
151 Ga0182008_10009972 3300014497 Bacteria 5102
152 Ga0182008_10081805 3300014497 Bacteria 1590
153 Ga0182008_10125522 3300014497 Bacteria 1278
154 Ga0182006_1016573 3300015261 Bacteria 3142
155 Ga0182006_1051512 3300015261 Bacteria 1583
156 Ga0182006_1054407 3300015261 Bacteria 1531
157 Ga0182007_10000727 3300015262 Bacteria 18605
158 Ga0182007_10000842 3300015262 Bacteria 17012
159 Ga0182007_10025419 3300015262 Bacteria 2064
160 Ga0182005_1017935 3300015265 Bacteria 1958
161 Ga0183362_10010 3300015683 Bacteria 106392
162 Ga0163161_10000162 3300017792 Bacteria 61742
163 Ga0163161_10000578 3300017792 Bacteria 29487
164 Ga0163161_10016574 3300017792 Bacteria 5147
165 Ga0163161_10058890 3300017792 Bacteria 2792
166 Ga0163161_10066035 3300017792 Bacteria 2641
167 Ga0163161_10135423 3300017792 Bacteria 1862
168 Ga0209435_100002 3300025206 Bacteria 794178
169 Ga0209436_102275 3300025208 Bacteria 5914
170 Ga0207425_1000087 3300025245 Bacteria 93219
171 Ga0207425_1004522 3300025245 Bacteria 4141
172 Ga0207425_1007769 3300025245 Bacteria 2799
173 Ga0209646_1000001 3300025246 Bacteria 3092932
174 Ga0209026_1000040 3300025250 Bacteria 277470
175 Ga0209759_1000001 3300025256 Bacteria 2799452
176 Ga0209129_1000007 3300025258 Bacteria 771325
177 Ga0209129_1004712 3300025258 Bacteria 5178
178 Ga0209129_1009567 3300025258 Bacteria 2532
179 Ga0209565_1000016 3300025263 Bacteria 477707
180 Ga0209565_1000038 3300025263 Bacteria 286433
181 Ga0209565_1000075 3300025263 Bacteria 162259
182 Ga0209565_1004633 3300025263 Bacteria 4144
183 Ga0209673_1000066 3300025273 Bacteria 250037
184 Ga0209673_1000073 3300025273 Bacteria 233645
185 Ga0209673_1000080 3300025273 Bacteria 223503
186 Ga0209673_1001092 3300025273 Bacteria 30491
187 Ga0209673_1002586 3300025273 Bacteria 12245
188 Ga0209130_1000131 3300025284 Bacteria 119977
189 Ga0209130_1000137 3300025284 Bacteria 116784
190 Ga0209130_1000187 3300025284 Bacteria 87082
191 Ga0209130_1001901 3300025284 Bacteria 11798
192 Ga0209130_1004592 3300025284 Bacteria 5172
193 Ga0209130_1015649 3300025284 Bacteria 1861
194 Ga0209675_1000074 3300025291 Bacteria 162260
195 Ga0209675_1000080 3300025291 Bacteria 154613
196 Ga0209675_1000102 3300025291 Bacteria 123742
197 Ga0209675_1001656 3300025291 Bacteria 12393
198 Ga0209675_1013064 3300025291 Bacteria 2626
199 Ga0209675_1017546 3300025291 Bacteria 2041
200 Ga0209676_1000005 3300025292 Bacteria 1076001
201 Ga0209676_1000139 3300025292 Bacteria 177886
202 Ga0209676_1000142 3300025292 Bacteria 175752
203 Ga0209676_1000186 3300025292 Bacteria 142440
204 Ga0209676_1001725 3300025292 Bacteria 18773
205 Ga0209676_1004754 3300025292 Bacteria 7410
206 Ga0209676_1004996 3300025292 Bacteria 7108
207 Ga0209025_1000056 3300025294 Bacteria 316188
208 Ga0209025_1000088 3300025294 Bacteria 255087
209 Ga0209025_1000104 3300025294 Bacteria 226895
210 Ga0209025_1001126 3300025294 Bacteria 38269
211 Ga0209025_1001133 3300025294 Bacteria 38135
212 Ga0209025_1021862 3300025294 Bacteria 3420
213 Ga0209025_1027639 3300025294 Bacteria 2807
214 Ga0209564_1000073 3300025295 Bacteria 288080
215 Ga0209564_1000090 3300025295 Bacteria 249298
216 Ga0209564_1000165 3300025295 Bacteria 160244
217 Ga0209564_1013125 3300025295 Bacteria 3546
218 Ga0209564_1026118 3300025295 Bacteria 1940
219 Ga0209758_1000044 3300025297 Bacteria 398448
220 Ga0209758_1007714 3300025297 Bacteria 7226
221 Ga0209050_1000007 3300025298 Bacteria 1187891
222 Ga0209050_1000250 3300025298 Bacteria 115980
223 Ga0209050_1000942 3300025298 Bacteria 37933
224 Ga0209050_1005650 3300025298 Bacteria 7744
225 Ga0209050_1007601 3300025298 Bacteria 6024
226 Ga0209050_1011058 3300025298 Bacteria 4343
227 Ga0209256_1000020 3300025299 Bacteria 542402
228 Ga0209256_1000022 3300025299 Bacteria 481843
229 Ga0209256_1000049 3300025299 Bacteria 310696
230 Ga0209256_1000110 3300025299 Bacteria 182312
231 Ga0207426_1000001 3300025302 Bacteria 1341301
232 Ga0207426_1000031 3300025302 Bacteria 460699
233 Ga0207426_1006487 3300025302 Bacteria 5078
234 Ga0207426_1008494 3300025302 Bacteria 4140
235 Ga0209051_1000029 3300025303 Bacteria 403675
236 Ga0209051_1000036 3300025303 Bacteria 339863
237 Ga0209051_1000160 3300025303 Bacteria 126473
238 Ga0209051_1000213 3300025303 Bacteria 98755
239 Ga0209051_1000243 3300025303 Bacteria 91605
240 Ga0209051_1001689 3300025303 Bacteria 17720
241 Ga0209051_1010050 3300025303 Bacteria 4816
242 Ga0209257_1000011 3300025304 Bacteria 1112630
243 Ga0209257_1000116 3300025304 Bacteria 228733
244 Ga0209257_1000168 3300025304 Bacteria 171312
245 Ga0209257_1002543 3300025304 Bacteria 17847
246 Ga0209257_1005026 3300025304 Bacteria 9629
247 Ga0209257_1011698 3300025304 Bacteria 4181
248 Ga0207696_1043505 3300025711 Bacteria 1305
249 Ga0207655_1027258 3300025728 Bacteria 2725
250 Ga0207688_10027637 3300025901 Bacteria 3121
251 Ga0207688_10067248 3300025901 Bacteria 2028
252 Ga0207645_10009923 3300025907 Bacteria 6559
253 Ga0207695_10226568 3300025913 Bacteria 1775
254 Ga0207671_10160000 3300025914 Bacteria 1743
255 Ga0207681_10012605 3300025923 Bacteria 5219
256 Ga0207681_10075350 3300025923 Bacteria 2366
257 Ga0207681_10236268 3300025923 Bacteria 1421
258 Ga0207694_10219030 3300025924 Bacteria 1552
259 Ga0207650_10019359 3300025925 Bacteria 4781
260 Ga0207650_10311798 3300025925 Bacteria 1287
261 Ga0207690_10206527 3300025932 Bacteria 1495
262 Ga0207706_10240518 3300025933 Bacteria 1582
263 Ga0207686_10020084 3300025934 Bacteria 3811
264 Ga0207686_10154566 3300025934 Bacteria 1601
265 Ga0207709_10000147 3300025935 Bacteria 97401
266 Ga0207709_10001737 3300025935 Bacteria 14677
267 Ga0207709_10009721 3300025935 Bacteria 5299
268 Ga0207709_10011042 3300025935 Bacteria 4980
269 Ga0207704_10041592 3300025938 Bacteria 2697
270 Ga0207691_10105128 3300025940 Bacteria 2515
271 Ga0207691_10360910 3300025940 Unclassified 1242
272 Ga0207679_10018064 3300025945 Bacteria 4716
273 Ga0207668_10002415 3300025972 Bacteria 10923
274 Ga0207658_10129522 3300025986 Bacteria 2025
275 Ga0207677_10157651 3300026023 Bacteria 1760
276 Ga0207639_10071285 3300026041 Unclassified 2717
277 Ga0207641_10173323 3300026088 Bacteria 1971
278 Ga0207648_10196618 3300026089 Bacteria 1788
279 Ga0207648_10317815 3300026089 Bacteria 1399
280 Ga0207674_10099952 3300026116 Bacteria 2883
281 Ga0207675_100149486 3300026118 Bacteria 2222
282 Ga0207683_10020918 3300026121 Bacteria 5599
283 Ga0207683_10024860 3300026121 Bacteria 5161
284 Ga0207683_10040295 3300026121 Bacteria 4075
285 Ga0207683_10115166 3300026121 Bacteria 2410
286 Ga0209281_1000002 3300027111 Bacteria 1924012
287 Ga0209281_1000125 3300027111 Bacteria 200371
288 Ga0209281_1022292 3300027111 Bacteria 1213
289 Ga0209282_1000221 3300027666 Bacteria 29591
290 Ga0209813_10003569 3300027866 Bacteria 3649
291 Ga0209974_10031352 3300027876 Bacteria 1760
292 Ga0268266_10185496 3300028379 Bacteria 1897
293 Ga0268265_10515486 3300028380 Bacteria 1129
294 Ga0307515_10000014 3300028794 Bacteria 562358
295 Ga0307515_10000137 3300028794 Bacteria 173516
296 Ga0307515_10000215 3300028794 Bacteria 142594
297 Ga0307515_10098521 3300028794 Bacteria 3559
298 Ga0316177_1005798 3300030731 Bacteria 3697
299 Ga0314311_1220690 3300030733 Bacteria 5561
300 Ga0316178_1124753 3300030735 Bacteria 1385
301 Ga0316182_1376612 3300030745 Bacteria 1246
302 Ga0316182_1422663 3300030745 Bacteria 1441
303 Ga0265327_10000108 3300031251 Bacteria 183209
304 Ga0265327_10005212 3300031251 Bacteria 10972
305 Ga0307513_10000006 3300031456 Bacteria 470848
306 Ga0307408_100005066 3300031548 Bacteria 8842
307 Ga0307408_100012595 3300031548 Bacteria 5605
308 Ga0307408_100061238 3300031548 Bacteria 2747
309 Ga0307408_100264739 3300031548 Bacteria 1424
310 Ga0307514_10008357 3300031649 Bacteria 8834
311 Ga0307514_10128952 3300031649 Bacteria 1745
312 Ga0307516_10003345 3300031730 Bacteria 20737
313 Ga0307405_10082415 3300031731 Bacteria 2105
314 Ga0307406_10003384 3300031901 Bacteria 8693
315 Ga0307412_10059103 3300031911 Bacteria 2568
316 Ga0307412_10080912 3300031911 Bacteria 2245
317 Ga0307416_100013165 3300032002 Bacteria 5613
318 Ga0307416_100288398 3300032002 Bacteria 1623
319 Ga0307416_100417801 3300032002 Bacteria 1384
320 Ga0307414_10223961 3300032004 Bacteria 1546
321 Ga0395905_0118094 3300037471 Bacteria 2493
322 Ga0395905_0129895 3300037471 Bacteria 2369
323 Ga0395905_0178069 3300037471 Bacteria 1996
324 Ga0439436_0002888 3300041404 Bacteria 5220
325 Ga0439436_0020790 3300041404 Bacteria 1954
326 Ga0439436_0046801 3300041404 Bacteria 1229
327 Ga0439447_027716 3300041407 Bacteria 1444
328 Ga0439447_037174 3300041407 Bacteria 1201
329 Ga0439466_0011174 3300041411 Bacteria 3323
330 Ga0439431_0000244 3300041997 Bacteria 11026
331 Ga0439431_0011897 3300041997 Bacteria 1994
332 Ga0439431_0017199 3300041997 Bacteria 1698
333 Ga0439433_0010174 3300041999 Bacteria 2053
334 Ga0439433_0018561 3300041999 Bacteria 1549
335 Ga0439442_002325 3300042002 Bacteria 3734
336 Ga0439445_0001130 3300042004 Bacteria 5710
337 Ga0439432_000895 3300042006 Bacteria 11191
338 Ga0439432_009575 3300042006 Bacteria 3376
339 Ga0439449_0000162 3300042007 Bacteria 22807
340 Ga0439449_0003095 3300042007 Bacteria 6480
341 Ga0439449_0008704 3300042007 Bacteria 3852
342 Ga0439449_0023099 3300042007 Bacteria 2328
343 Ga0439452_001519 3300042010 Bacteria 9348
344 Ga0439452_003280 3300042010 Bacteria 5700
345 Ga0439457_002467 3300042014 Bacteria 5275
346 Ga0439462_0028054 3300042015 Bacteria 1487
347 Ga0450919_000791 3300042121 Bacteria 4063
348 Ga0439446_0001692 3300042156 Bacteria 5112
349 Ga0439446_0041847 3300042156 Bacteria 1351
350 Ga0439434_0001507 3300042435 Bacteria 6703
351 Ga0439434_0010366 3300042435 Bacteria 2747
352 Ga0450918_000131 3300042531 Bacteria 16295
353 Ga0450918_007437 3300042531 Bacteria 1936
354 Ga0451577_0213361 3300042876 Bacteria 1744
355 Ga0453684_0295326 3300044712 Unclassified 1843
356 Ga0466960_0089034 3300044901 Bacteria 1570
357 Ga0495638_0008625 3300046460 Bacteria 7211
358 Ga0495650_0004904 3300046471 Bacteria 8940
359 Ga0495650_0023771 3300046471 Bacteria 2909
360 Ga0495639_0004274 3300046475 Bacteria 6127
361 Ga0495607_0160687 3300046501 Bacteria 1142
362 Ga0495616_0006349 3300046513 Bacteria 7167
363 Ga0495620_0005458 3300046515 Bacteria 7087
364 Ga0495631_0000314 3300046518 Bacteria 33596
365 Ga0495637_0002107 3300046520 Bacteria 11187
366 Ga0495643_0016383 3300046522 Bacteria 4353
367 Ga0495621_0007586 3300046539 Bacteria 3220
368 Ga0495656_0000051 3300046615 Bacteria 55112
369 Ga0495668_0045141 3300046616 Unclassified 2449
370 Ga0495625_0000057 3300046660 Bacteria 181623
371 Ga0495661_0118827 3300046665 Bacteria 1463
372 Ga0495588_0010542 3300046674 Bacteria 4302
373 Ga0495588_0053649 3300046674 Bacteria 2079
374 Ga0495588_0066832 3300046674 Bacteria 1866
375 Ga0495588_0175731 3300046674 Bacteria 1132
376 Ga0495658_0121683 3300046683 Bacteria 1579
377 Ga0495671_0003603 3300046692 Bacteria 9450
378 Ga0495671_0009248 3300046692 Bacteria 5508
379 Ga0495660_0076519 3300046810 Bacteria 1763
380 Ga0495676_0024069 3300047321 Bacteria 5276
381 Ga0495676_0134195 3300047321 Bacteria 1783
382 Ga0495686_0005034 3300047472 Bacteria 10611
383 Ga0495593_0003390 3300047673 Bacteria 9548
384 Ga0495614_0013538 3300048089 Bacteria 3576
385 Ga0495614_0058594 3300048089 Bacteria 1654
386 Ga0496100_0004454 3300048903 Bacteria 7431
387 Ga0496101_0023870 3300048904 Bacteria 4228
388 Ga0496102_0027988 3300048905 Bacteria 5036
389 Ga0496103_0051467 3300048906 Bacteria 2549
390 Ga0496104_0019488 3300048907 Bacteria 6209
391 Ga0496105_0005332 3300048908 Bacteria 9743
392 Ga0496106_0009138 3300048909 Bacteria 7322
393 Ga0496109_0141325 3300048912 Bacteria 2251
394 Ga0496111_0036072 3300048914 Bacteria 3536
395 Ga0496111_0124943 3300048914 Bacteria 1901
396 Ga0496114_0079702 3300048917 Bacteria 2765
397 Ga0496114_0197857 3300048917 Bacteria 1759
398 Ga0496116_0013989 3300048919 Bacteria 6429
399 Ga0496116_0123855 3300048919 Bacteria 1489
400 Ga0496117_0010676 3300048920 Bacteria 8319
401 Ga0496118_0027282 3300048921 Bacteria 4838
402 Ga0496119_0044835 3300048922 Bacteria 2779
403 Ga0496121_0014037 3300048924 Bacteria 8550
404 Ga0496121_0054314 3300048924 Bacteria 3348
405 Ga0496121_0088621 3300048924 Bacteria 2425
406 Ga0496121_0176785 3300048924 Bacteria 1545
407 Ga0496122_0000039 3300048925 Bacteria 295352
408 Ga0496122_0010051 3300048925 Bacteria 9833
409 Ga0496122_0031555 3300048925 Bacteria 4407
410 Ga0496122_0045989 3300048925 Bacteria 3385
411 Ga0496122_0069791 3300048925 Bacteria 2515
412 Ga0496122_0082864 3300048925 Bacteria 2226
413 Ga0496122_0144404 3300048925 Bacteria 1482
414 Ga0496123_0000026 3300048926 Bacteria 318040
415 Ga0496123_0000108 3300048926 Bacteria 166102
416 Ga0496123_0021779 3300048926 Bacteria 4968
417 Ga0496124_0035694 3300048927 Bacteria 4348
418 Ga0496124_0137326 3300048927 Bacteria 1934
419 Ga0496125_0012019 3300048928 Bacteria 8618
420 Ga0496125_0132359 3300048928 Bacteria 1753
421 Ga0496126_0188946 3300048929 Bacteria 1746
422 Ga0501321_002860 3300049537 Bacteria 1536
423 Ga0501034_0080760 3300049571 Bacteria 3255
424 Ga0501036_0107817 3300049572 Bacteria 2355
425 Ga0501041_0106142 3300049577 Bacteria 1741
426 Ga0501048_0162575 3300049582 Bacteria 1580
427 Ga0501073_0036971 3300049589 Bacteria 3468
428 Ga0501080_0001360 3300049742 Bacteria 20445
429 Ga0501081_0102342 3300049743 Bacteria 2026
430 Ga0501262_000144 3300049759 Bacteria 8833
431 Ga0501266_000871 3300049763 Bacteria 3931
432 nmdc:mga03683_1156_c2 3300050489 Bacteria 6568
433 nmdc:mga03683_4623_c2 3300050489 Bacteria 2985
434 nmdc:mga03n38_6974_c1 3300050490 Bacteria 3969
435 nmdc:mga00v17_165139_c1 3300050491 Bacteria 1426
436 nmdc:mga00v17_29210_c1 3300050491 Bacteria 3235
437 nmdc:mga00v17_4493_c1 3300050491 Bacteria 7262
438 nmdc:mga0yw44_18373_c1 3300050492 Bacteria 3827
439 nmdc:mga0yw44_90600_c1 3300050492 Bacteria 1932
440 nmdc:mga0k408_14031_c1 3300050493 Bacteria 4405
441 nmdc:mga0k408_19722_c1 3300050493 Bacteria 3771
442 nmdc:mga0k408_250827_c1 3300050493 Bacteria 1057
443 nmdc:mga0k408_94921_c1 3300050493 Bacteria 1754
444 nmdc:mga06z11_101327_c1 3300050494 Bacteria 1580
445 nmdc:mga04h51_4498_c1 3300050495 Bacteria 3476
446 nmdc:mga07m45_1861_c2 3300050496 Bacteria 4839
447 nmdc:mga07m45_29426_c1 3300050496 Bacteria 3037
448 nmdc:mga07m45_32979_c1 3300050496 Bacteria 2874
449 nmdc:mga07m45_6560_c1 3300050496 Bacteria 5891
450 nmdc:mga05p37_725168_c1 3300050507 Bacteria 1100
451 nmdc:mga0qj67_5_c1 3300050509 Bacteria 160703
452 nmdc:mga08x19_3775_c1 3300050514 Bacteria 9016
453 nmdc:mga0sz30_11499_c2 3300050516 Bacteria 2855
454 Ga0500610_0000173 3300053079 Bacteria 19389
455 Ga0500610_0000175 3300053079 Bacteria 19266
456 Ga0500610_0054529 3300053079 Bacteria 2084
457 Ga0500635_0003069 3300053080 Bacteria 4174
458 Ga0500578_0016250 3300053086 Bacteria 4779
459 Ga0500643_002772 3300053087 Bacteria 8773
460 Ga0500643_019032 3300053087 Bacteria 2267
461 Ga0500646_0020310 3300053090 Bacteria 1764
462 Ga0500651_0000090 3300053093 Bacteria 58811
463 Ga0500651_0058311 3300053093 Bacteria 2414
464 Ga0500566_0037643 3300053094 Bacteria 2802
465 Ga0500641_0068533 3300053096 Bacteria 1489
466 Ga0500641_0110044 3300053096 Bacteria 1186
467 Ga0500555_053897 3300053103 Bacteria 1095
468 Ga0500562_000781 3300053108 Bacteria 7761
469 Ga0500562_012500 3300053108 Bacteria 2160
470 Ga0500569_002258 3300053109 Bacteria 3770
471 Ga0500571_000041 3300053110 Bacteria 40237
472 Ga0500571_000329 3300053110 Bacteria 18736
473 Ga0500593_000045 3300053117 Bacteria 43688
474 Ga0500593_000629 3300053117 Bacteria 13546
475 Ga0500595_040068 3300053119 Bacteria 1513
476 Ga0500607_000328 3300053121 Bacteria 44883
477 Ga0500607_000934 3300053121 Bacteria 27960
478 Ga0500607_010671 3300053121 Bacteria 5453
479 Ga0500618_010160 3300053125 Bacteria 2534
480 Ga0500626_063827 3300053128 Bacteria 1645
481 Ga0500655_000214 3300053133 Bacteria 13768
482 Ga0500655_000865 3300053133 Bacteria 5886
483 Ga0500658_0000018 3300053134 Bacteria 141217
484 Ga0500658_0000068 3300053134 Bacteria 48536
485 Ga0500658_0000614 3300053134 Bacteria 14765
486 Ga0500559_0054559 3300053136 Bacteria 1770
487 Ga0500561_0012300 3300053137 Bacteria 1823
488 Ga0500564_048514 3300053138 Bacteria 1945
489 Ga0500564_061714 3300053138 Bacteria 1699
490 Ga0500568_0004019 3300053139 Bacteria 7974
491 Ga0500573_0007244 3300053140 Bacteria 6045
492 Ga0500574_006956 3300053141 Bacteria 2315
493 Ga0500574_026398 3300053141 Bacteria 1523
494 Ga0500577_0037611 3300053142 Bacteria 1742
495 Ga0500590_046824 3300053148 Bacteria 2209
496 Ga0500624_006562 3300053157 Bacteria 1578
497 Ga0500627_0001973 3300053158 Bacteria 5913
498 Ga0500634_0003816 3300053161 Bacteria 6819
499 Ga0500634_0023017 3300053161 Bacteria 3386
500 Ga0500634_0053394 3300053161 Bacteria 2167
501 Ga0500638_014236 3300053162 Bacteria 3624
502 Ga0501082_0135119 3300060353 Bacteria 2140
503 2513226407 2513020051 Bacteria 6053213
504 2599626516 2599185214 Bacteria 8209958
505 2599675580 2599185226 Bacteria 8233575
506 2599684053 2599185227 Bacteria 8246414
507 2599696067 2599185229 Bacteria 8216126
508 2643865273 2643221570 Bacteria 5103772
509 2643991501 2643221596 Bacteria 5006805
510 2644062341 2643221609 Bacteria 6756331
511 2644163312 2643221628 Bacteria 5745828
512 2644244662 2643221644 Bacteria 6865017
513 2644292548 2643221652 Bacteria 5140275
514 2644301149 2643221654 Bacteria 5273570
515 2644303122 2643221654 Bacteria 5273570
516 2644327827 2643221658 Bacteria 6064537
517 2644400524 2643221672 Bacteria 6322190
518 2644468377 2643221683 Bacteria 5749203
519 2644742643 2643221736 Bacteria 6608466
520 2722885737 2721755523 Bacteria 6430384
521 2738717936 2738541277 Bacteria 7458140
522 2738881095 2738541307 Bacteria 8606193
523 2739243082 2738543012 Bacteria 7115078
524 2739278622 2738543019 Bacteria 7459457
525 2776266774 2775506901 Bacteria 9631051
526 2816473226 2816332133 Bacteria 7249298
527 2819721139 2818991467 Bacteria 5893227
528 2831266646 2831265667 Bacteria 7184833
529 2838057275 2838054893 Bacteria 7451788
530 2839138608 2839138175 Bacteria 6549354
531 2841764056 2841760612 Bacteria 6454112
532 2842336759 2842333319 Bacteria 8899485
533 2842679583 2842677519 Bacteria 5615038
534 2842721703 2842718218 Bacteria 4560148
535 2842736693 2842733646 Bacteria 5716726
536 2842750320 2842747753 Bacteria 5578255
537 2842751519 2842747753 Bacteria 5578255
538 2844108489 2844104063 Bacteria 6440972
539 2851185295 2851182111 Bacteria 6047226
540 2851250491 2851246043 Bacteria 6439203
541 2885192557 2885192300 Bacteria 5882526
542 2885193460 2885192300 Bacteria 5882526
543 2885201330 2885198086 Bacteria 7212419
544 2885214988 2885211737 Bacteria 7212420
545 2904453076 2904449895 Bacteria 6927402
546 2904453500 2904449895 Bacteria 6927402
547 2904455682 2904449895 Bacteria 6927402
548 2904462808 2904456579 Bacteria 6819253
549 2904463076 2904456579 Bacteria 6819253
550 2904482189 2904479285 Bacteria 5073931
551 2904544895 2904541872 Bacteria 8915136
552 2917704962 2917699015 Bacteria 7043791
553 2919467321 2919462493 Bacteria 5817112
554 2928071396 2928070936 Bacteria 8062541
555 2928084662 2928084124 Bacteria 7159212
556 2929163435 2929160207 Bacteria 9075316
557 2929200837 2929199973 Bacteria 7260745
558 2929522670 2929520902 Bacteria 6765052
559 2929525088 2929520902 Bacteria 6765052
560 2945911093 2945909444 Bacteria 7065066
561 2945912129 2945909444 Bacteria 7065066
562 2945947805 2945945610 Bacteria 5951079
563 2945972226 2945972063 Bacteria 6086495
564 2945977350 2945972063 Bacteria 6086495
565 2945985586 2945984333 Bacteria 7358892
566 2945986607 2945984333 Bacteria 7358892
567 2954772125 2954767861 Bacteria 5535784
568 2974322087 2974320154 Bacteria 4571377
569 2990714054 2990710928 Bacteria 5002431
570 8055911765 8055909800 Bacteria 7278581
571 8057534025 8057529695 Bacteria 6306553
572 nmdc:mga03n38_10461_c1
573 JGI25155J39150_1000062
574 JGI25156J39149_1000012
575 JGI25154J39366_1000029
576 JGI25157J39369_1000014
577 JGI25152J39213_1000673
578 JGI25150J39212_1000503
579 JGI25159J45721_1000505
580 JGI25159J45721_1001997
581 JGI25159J45721_1005379
582 JGI25151J46595_10001271
583 JGI25151J46595_10001929
584 JGI25151J46595_10004683
585 JGI25153J46596_10000930
586 rootH1_10174792
587 JGI25160J50197_1000732
588 JGI25160J50197_1018065
589 JGI25161J50226_1000898
590 JGI25161J50226_1003193
591 Ga0006562J51391_1125836
592 Ga0006562J51391_1125839
593 Ga0006562J51391_1183337
594 Ga0055526_1000184
595 Ga0055526_1001027
596 Ga0055526_1002078
597 Ga0055537_1000006
598 Ga0055537_1000036
599 Ga0055537_1000683
600 Ga0055537_1014642
601 Ga0055524_1000032
602 Ga0055524_1000326
603 Ga0055524_1000828
604 Ga0055524_1001149
605 Ga0055536_1000875
606 Ga0055536_1001160
607 Ga0055536_1002042
608 Ga0055536_1002368
609 Ga0055536_1023771
610 Ga0055534_1000018
611 Ga0055534_1000048
612 Ga0055534_1000535
613 Ga0055534_1001805
614 Ga0055534_1001837
615 Ga0055534_1007558
616 Ga0055528_1000903
617 Ga0055528_1001096
618 Ga0055528_1024195
619 Ga0055528_1030796
620 Ga0055530_10000086
621 Ga0055530_10007519
622 Ga0055540_1000073
623 Ga0055540_1000894
624 Ga0055540_1001765
625 Ga0055540_1003761
626 Ga0055540_1004096
627 Ga0055540_1004991
628 Ga0055531_10001217
629 Ga0055531_10002312
630 Ga0055531_10004635
631 Ga0055531_10038210
632 Ga0055543_1000964
633 Ga0055543_1002819
634 Ga0065165_1000150
635 Ga0065165_1001252
636 Ga0065165_1006153
637 Ga0065165_1007800
638 Ga0065165_1010337
639 Ga0065165_1031593
640 Ga0065714_10007015
641 Ga0065704_10088799
642 Ga0070658_10090874
643 Ga0070676_10021421
644 Ga0070668_100156757
645 Ga0070668_100205342
646 Ga0070669_100244868
647 Ga0070675_100019069
648 Ga0070674_100254776
649 Ga0070667_100028805
650 Ga0070678_100043273
651 Ga0070678_100105947
652 Ga0068867_100033126
653 Ga0068853_100085237
654 Ga0070672_100071128
655 Ga0070665_100315422
656 Ga0070664_100047093
657 Ga0068857_100104216
658 Ga0068857_100127667
659 Ga0068854_100062233
660 Ga0070702_100247048
661 Ga0068852_100130372
662 Ga0068863_100170570
663 Ga0068863_100284909
664 Ga0068860_100196425
665 Ga0068862_100032571
666 Ga0075365_10015817
667 Ga0075365_10027431
668 Ga0075365_10072562
669 Ga0075368_10009942
670 Ga0075368_10081726
671 Ga0075363_100049383
672 Ga0075363_100188494
673 Ga0075364_10021924
674 Ga0075364_10029776
675 Ga0075432_10010889
676 Ga0075362_10001734
677 Ga0075362_10004440
678 Ga0075362_10110720
679 Ga0075366_10009077
680 Ga0075366_10012090
681 Ga0075366_10021112
682 Ga0075366_10040208
683 Ga0075366_10172716
684 Ga0097621_100377961
685 Ga0075370_10005227
686 Ga0075370_10007084
687 Ga0075370_10035937
688 Ga0075370_10041025
689 Ga0075370_10113002
690 Ga0075430_100000003
691 Ga0075430_100031429
692 Ga0075431_100023776
693 Ga0068865_100215065
694 Ga0068865_100298878
695 Ga0075436_100025269
696 Ga0079104_1000056
697 Ga0079104_1001506
698 Ga0099826_10000369
699 Ga0105250_10082417
700 Ga0105240_10153597
701 Ga0114129_10324252
702 Ga0114129_10693568
703 Ga0105243_10000481
704 Ga0105243_10009917
705 Ga0105243_10020508
706 Ga0105243_10181790
707 Ga0105243_10330639
708 Ga0105242_10001456
709 Ga0105237_10236605
710 Ga0105239_10705162
711 Ga0157347_1001465
712 Ga0157373_10018829
713 Ga0157370_10008744
714 Ga0157370_10244187
715 Ga0157370_10244360
716 Ga0157369_10108768
717 Ga0163162_10400960
718 Ga0163163_10255097
719 Ga0157380_10056306
720 Ga0157380_10073871
721 Ga0182008_10003480
722 Ga0182008_10009972
723 Ga0182008_10081805
724 Ga0182008_10125522
725 Ga0182006_1016573
726 Ga0182006_1051512
727 Ga0182006_1054407
728 Ga0182007_10000727
729 Ga0182007_10000842
730 Ga0182007_10025419
731 Ga0182005_1017935
732 Ga0183362_10010
733 Ga0163161_10000162
734 Ga0163161_10000578
735 Ga0163161_10016574
736 Ga0163161_10058890
737 Ga0163161_10066035
738 Ga0163161_10135423
739 Ga0209435_100002
740 Ga0209436_102275
741 Ga0207425_1000087
742 Ga0207425_1004522
743 Ga0207425_1007769
744 Ga0209646_1000001
745 Ga0209026_1000040
746 Ga0209759_1000001
747 Ga0209129_1000007
748 Ga0209129_1004712
749 Ga0209129_1009567
750 Ga0209565_1000016
751 Ga0209565_1000038
752 Ga0209565_1000075
753 Ga0209565_1004633
754 Ga0209673_1000066
755 Ga0209673_1000073
756 Ga0209673_1000080
757 Ga0209673_1001092
758 Ga0209673_1002586
759 Ga0209130_1000131
760 Ga0209130_1000137
761 Ga0209130_1000187
762 Ga0209130_1001901
763 Ga0209130_1004592
764 Ga0209130_1015649
765 Ga0209675_1000074
766 Ga0209675_1000080
767 Ga0209675_1000102
768 Ga0209675_1001656
769 Ga0209675_1013064
770 Ga0209675_1017546
771 Ga0209676_1000005
772 Ga0209676_1000139
773 Ga0209676_1000142
774 Ga0209676_1000186
775 Ga0209676_1001725
776 Ga0209676_1004754
777 Ga0209676_1004996
778 Ga0209025_1000056
779 Ga0209025_1000088
780 Ga0209025_1000104
781 Ga0209025_1001126
782 Ga0209025_1001133
783 Ga0209025_1021862
784 Ga0209025_1027639
785 Ga0209564_1000073
786 Ga0209564_1000090
787 Ga0209564_1000165
788 Ga0209564_1013125
789 Ga0209564_1026118
790 Ga0209758_1000044
791 Ga0209758_1007714
792 Ga0209050_1000007
793 Ga0209050_1000250
794 Ga0209050_1000942
795 Ga0209050_1005650
796 Ga0209050_1007601
797 Ga0209050_1011058
798 Ga0209256_1000020
799 Ga0209256_1000022
800 Ga0209256_1000049
801 Ga0209256_1000110
802 Ga0207426_1000001
803 Ga0207426_1000031
804 Ga0207426_1006487
805 Ga0207426_1008494
806 Ga0209051_1000029
807 Ga0209051_1000036
808 Ga0209051_1000160
809 Ga0209051_1000213
810 Ga0209051_1000243
811 Ga0209051_1001689
812 Ga0209051_1010050
813 Ga0209257_1000011
814 Ga0209257_1000116
815 Ga0209257_1000168
816 Ga0209257_1002543
817 Ga0209257_1005026
818 Ga0209257_1011698
819 Ga0207696_1043505
820 Ga0207655_1027258
821 Ga0207688_10027637
822 Ga0207688_10067248
823 Ga0207645_10009923
824 Ga0207695_10226568
825 Ga0207671_10160000
826 Ga0207681_10012605
827 Ga0207681_10075350
828 Ga0207681_10236268
829 Ga0207694_10219030
830 Ga0207650_10019359
831 Ga0207650_10311798
832 Ga0207690_10206527
833 Ga0207706_10240518
834 Ga0207686_10020084
835 Ga0207686_10154566
836 Ga0207709_10000147
837 Ga0207709_10001737
838 Ga0207709_10009721
839 Ga0207709_10011042
840 Ga0207704_10041592
841 Ga0207691_10105128
842 Ga0207691_10360910
843 Ga0207679_10018064
844 Ga0207668_10002415
845 Ga0207658_10129522
846 Ga0207677_10157651
847 Ga0207639_10071285
848 Ga0207641_10173323
849 Ga0207648_10196618
850 Ga0207648_10317815
851 Ga0207674_10099952
852 Ga0207675_100149486
853 Ga0207683_10020918
854 Ga0207683_10024860
855 Ga0207683_10040295
856 Ga0207683_10115166
857 Ga0209281_1000002
858 Ga0209281_1000125
859 Ga0209281_1022292
860 Ga0209282_1000221
861 Ga0209813_10003569
862 Ga0209974_10031352
863 Ga0268266_10185496
864 Ga0268265_10515486
865 Ga0307515_10000014
866 Ga0307515_10000137
867 Ga0307515_10000215
868 Ga0307515_10098521
869 Ga0316177_1005798
870 Ga0314311_1220690
871 Ga0316178_1124753
872 Ga0316182_1376612
873 Ga0316182_1422663
874 Ga0265327_10000108
875 Ga0265327_10005212
876 Ga0307513_10000006
877 Ga0307408_100005066
878 Ga0307408_100012595
879 Ga0307408_100061238
880 Ga0307408_100264739
881 Ga0307514_10008357
882 Ga0307514_10128952
883 Ga0307516_10003345
884 Ga0307405_10082415
885 Ga0307406_10003384
886 Ga0307412_10059103
887 Ga0307412_10080912
888 Ga0307416_100013165
889 Ga0307416_100288398
890 Ga0307416_100417801
891 Ga0307414_10223961
892 Ga0395905_0118094
893 Ga0395905_0129895
894 Ga0395905_0178069
895 Ga0439436_0002888
896 Ga0439436_0020790
897 Ga0439436_0046801
898 Ga0439447_027716
899 Ga0439447_037174
900 Ga0439466_0011174
901 Ga0439431_0000244
902 Ga0439431_0011897
903 Ga0439431_0017199
904 Ga0439433_0010174
905 Ga0439433_0018561
906 Ga0439442_002325
907 Ga0439445_0001130
908 Ga0439432_000895
909 Ga0439432_009575
910 Ga0439449_0000162
911 Ga0439449_0003095
912 Ga0439449_0008704
913 Ga0439449_0023099
914 Ga0439452_001519
915 Ga0439452_003280
916 Ga0439457_002467
917 Ga0439462_0028054
918 Ga0450919_000791
919 Ga0439446_0001692
920 Ga0439446_0041847
921 Ga0439434_0001507
922 Ga0439434_0010366
923 Ga0450918_000131
924 Ga0450918_007437
925 Ga0451577_0213361
926 Ga0453684_0295326
927 Ga0466960_0089034
928 Ga0495638_0008625
929 Ga0495650_0004904
930 Ga0495650_0023771
931 Ga0495639_0004274
932 Ga0495607_0160687
933 Ga0495616_0006349
934 Ga0495620_0005458
935 Ga0495631_0000314
936 Ga0495637_0002107
937 Ga0495643_0016383
938 Ga0495621_0007586
939 Ga0495656_0000051
940 Ga0495668_0045141
941 Ga0495625_0000057
942 Ga0495661_0118827
943 Ga0495588_0010542
944 Ga0495588_0053649
945 Ga0495588_0066832
946 Ga0495588_0175731
947 Ga0495658_0121683
948 Ga0495671_0003603
949 Ga0495671_0009248
950 Ga0495660_0076519
951 Ga0495676_0024069
952 Ga0495676_0134195
953 Ga0495686_0005034
954 Ga0495593_0003390
955 Ga0495614_0013538
956 Ga0495614_0058594
957 Ga0496100_0004454
958 Ga0496101_0023870
959 Ga0496102_0027988
960 Ga0496103_0051467
961 Ga0496104_0019488
962 Ga0496105_0005332
963 Ga0496106_0009138
964 Ga0496109_0141325
965 Ga0496111_0036072
966 Ga0496111_0124943
967 Ga0496114_0079702
968 Ga0496114_0197857
969 Ga0496116_0013989
970 Ga0496116_0123855
971 Ga0496117_0010676
972 Ga0496118_0027282
973 Ga0496119_0044835
974 Ga0496121_0014037
975 Ga0496121_0054314
976 Ga0496121_0088621
977 Ga0496121_0176785
978 Ga0496122_0000039
979 Ga0496122_0010051
980 Ga0496122_0031555
981 Ga0496122_0045989
982 Ga0496122_0069791
983 Ga0496122_0082864
984 Ga0496122_0144404
985 Ga0496123_0000026
986 Ga0496123_0000108
987 Ga0496123_0021779
988 Ga0496124_0035694
989 Ga0496124_0137326
990 Ga0496125_0012019
991 Ga0496125_0132359
992 Ga0496126_0188946
993 Ga0501321_002860
994 Ga0501034_0080760
995 Ga0501036_0107817
996 Ga0501041_0106142
997 Ga0501048_0162575
998 Ga0501073_0036971
999 Ga0501080_0001360
1000 Ga0501081_0102342
1001 Ga0501262_000144
1002 Ga0501266_000871
1003 nmdc:mga03683_1156_c2
1004 nmdc:mga03683_4623_c2
1005 nmdc:mga03n38_6974_c1
1006 nmdc:mga00v17_165139_c1
1007 nmdc:mga00v17_29210_c1
1008 nmdc:mga00v17_4493_c1
1009 nmdc:mga0yw44_18373_c1
1010 nmdc:mga0yw44_90600_c1
1011 nmdc:mga0k408_14031_c1
1012 nmdc:mga0k408_19722_c1
1013 nmdc:mga0k408_250827_c1
1014 nmdc:mga0k408_94921_c1
1015 nmdc:mga06z11_101327_c1
1016 nmdc:mga04h51_4498_c1
1017 nmdc:mga07m45_1861_c2
1018 nmdc:mga07m45_29426_c1
1019 nmdc:mga07m45_32979_c1
1020 nmdc:mga07m45_6560_c1
1021 nmdc:mga05p37_725168_c1
1022 nmdc:mga0qj67_5_c1
1023 nmdc:mga08x19_3775_c1
1024 nmdc:mga0sz30_11499_c2
1025 Ga0500610_0000173
1026 Ga0500610_0000175
1027 Ga0500610_0054529
1028 Ga0500635_0003069
1029 Ga0500578_0016250
1030 Ga0500643_002772
1031 Ga0500643_019032
1032 Ga0500646_0020310
1033 Ga0500651_0000090
1034 Ga0500651_0058311
1035 Ga0500566_0037643
1036 Ga0500641_0068533
1037 Ga0500641_0110044
1038 Ga0500555_053897
1039 Ga0500562_000781
1040 Ga0500562_012500
1041 Ga0500569_002258
1042 Ga0500571_000041
1043 Ga0500571_000329
1044 Ga0500593_000045
1045 Ga0500593_000629
1046 Ga0500595_040068
1047 Ga0500607_000328
1048 Ga0500607_000934
1049 Ga0500607_010671
1050 Ga0500618_010160
1051 Ga0500626_063827
1052 Ga0500655_000214
1053 Ga0500655_000865
1054 Ga0500658_0000018
1055 Ga0500658_0000068
1056 Ga0500658_0000614
1057 Ga0500559_0054559
1058 Ga0500561_0012300
1059 Ga0500564_048514
1060 Ga0500564_061714
1061 Ga0500568_0004019
1062 Ga0500573_0007244
1063 Ga0500574_006956
1064 Ga0500574_026398
1065 Ga0500577_0037611
1066 Ga0500590_046824
1067 Ga0500624_006562
1068 Ga0500627_0001973
1069 Ga0500634_0003816
1070 Ga0500634_0023017
1071 Ga0500634_0053394
1072 Ga0500638_014236
1073 Ga0501082_0135119
1074 2513226407
1075 2599626516
1076 2599675580
1077 2599684053
1078 2599696067
1079 2643865273
1080 2643991501
1081 2644062341
1082 2644163312
1083 2644244662
1084 2644292548
1085 2644301149
1086 2644303122
1087 2644327827
1088 2644400524
1089 2644468377
1090 2644742643
1091 2722885737
1092 2738717936
1093 2738881095
1094 2739243082
1095 2739278622
1096 2776266774
1097 2816473226
1098 2819721139
1099 2831266646
1100 2838057275
1101 2839138608
1102 2841764056
1103 2842336759
1104 2842679583
1105 2842721703
1106 2842736693
1107 2842750320
1108 2842751519
1109 2844108489
1110 2851185295
1111 2851250491
1112 2885192557
1113 2885193460
1114 2885201330
1115 2885214988
1116 2904453076
1117 2904453500
1118 2904455682
1119 2904462808
1120 2904463076
1121 2904482189
1122 2904544895
1123 2917704962
1124 2919467321
1125 2928071396
1126 2928084662
1127 2929163435
1128 2929200837
1129 2929522670
1130 2929525088
1131 2945911093
1132 2945912129
1133 2945947805
1134 2945972226
1135 2945977350
1136 2945985586
1137 2945986607
1138 2954772125
1139 2974322087
1140 2990714054
1141 8055911765
1142 8057534025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

95

368

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9489 32 324
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9461 29 322
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9451 28 324
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9331 28 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9324 29 322
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9638 126 248 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9487 126 248 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9375 126 241 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9305 29 324 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9252 29 324 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A6P2E0C5-F1-model_v4 Argininosuccinate lyase 0.9702 19 324 GO:0016829
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9636 54 321
AF-A0A4P7LJW2-F1-model_v4 TTT family tricarboxylate transporter receptor protein 0.9633 54 322
AF-V8QW12-F1-model_v4 ABC transporter substrate-binding protein 0.9621 37 324
AF-A0A1B2R9E2-F1-model_v4 LacI family transcriptional regulator 0.962 20 322

Map