F465012

General Info

Members Datasets Scaffolds Average Seq Length
571 369 1142 351

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237098|2513676117
Length 382
Sequence DPGIHAFLSPDQYVDGRVKPGHDAAGTAGVVMTYIAKPKFHHPGLKKNELGYTHRDYEGKISTLCAGCGHDSITASIIEACYELSIEPHRVAKISGIGCSSKTPDYFLGNSHGFNSVHGRMPSVLTGANLANRDLIYLGVSGDGDSASIGFGQFAHSIRRGVNMTYIVENNGVYGLTKGQFSATADRGSKSKKGVVNTDNAIDLVAIALQLGATFVARSFSGDKTQLVPLIAAAIQHKGASFIDVISPCIAFNNHAGSTKSFDYVREHNDAVNRLDVLVGREPIHVDYAPGTVQVVEQHDGSRIALRKLDADYDPHDRVGAMTFLQKHAAKGQIVTGLLYVDPEAEDLHAHLNTVDTPLNTLDAKALCPGSAALDKINASLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
334 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
335 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
336 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
337 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
341 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
344 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
345 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
346 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
347 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
348 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
349 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
350 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
351 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
352 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
353 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
354 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
355 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
356 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
357 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
358 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
359 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
360 2904699407
361 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
362 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
363 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
364 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
365 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
366 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
367 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
368 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
369 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 0
Isolates 4.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 1.93
Rhizoplane 2.98
Rhizosphere 81.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3047889 2162886007 Bacteria 1684
2 ARSoilYngRDRAFT_c00458 3300000042 Bacteria 4991
3 ARcpr5yngRDRAFT_c002082 3300000043 Bacteria 2112
4 ARSoilOldRDRAFT_c000053 3300000044 Bacteria 23841
5 ARCol0oldRDRAFT_c01210 3300000045 Bacteria 1847
6 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
7 JGI24747J21853_1000252 3300001978 Bacteria 2932
8 JGI24739J22299_10004000 3300001989 Bacteria 5641
9 JGI24739J22299_10008709 3300001989 Bacteria 3784
10 JGI24737J22298_10000053 3300001990 Bacteria 34054
11 JGI24737J22298_10004052 3300001990 Bacteria 5124
12 JGI24750J21931_1000906 3300002070 Bacteria 4027
13 JGI24745J21846_1000906 3300002073 Bacteria 2758
14 JGI24738J21930_10002204 3300002075 Bacteria 5182
15 JGI24035J26624_1000962 3300002126 Bacteria 2711
16 JGI24034J26672_10000960 3300002239 Bacteria 3760
17 JGI24742J22300_10000216 3300002244 Bacteria 8591
18 JGI24751J29686_10004605 3300002459 Bacteria 2802
19 JGI25157J39369_1011623 3300002741 Bacteria 1135
20 Ga0055535_1000063 3300003761 Bacteria 117039
21 Ga0055535_1000072 3300003761 Bacteria 113031
22 Ga0055535_1000219 3300003761 Bacteria 60251
23 Ga0055529_1000287 3300003763 Bacteria 59706
24 Ga0055530_10001762 3300003791 Bacteria 15127
25 Ga0055531_10006219 3300003794 Bacteria 6818
26 Ga0065165_1000472 3300005262 Bacteria 62746
27 Ga0065165_1018743 3300005262 Bacteria 2494
28 Ga0065717_1002456 3300005276 Bacteria 1949
29 Ga0065716_1002341 3300005277 Bacteria 1908
30 Ga0065704_10100585 3300005289 Bacteria 2248
31 Ga0065712_10071633 3300005290 Bacteria 5146
32 Ga0070658_10011015 3300005327 Bacteria 7249
33 Ga0070658_10019708 3300005327 Bacteria 5401
34 Ga0070658_10248509 3300005327 Bacteria 1509
35 Ga0070676_10004729 3300005328 Bacteria 7199
36 Ga0070683_100001083 3300005329 Bacteria 20468
37 Ga0070683_100145741 3300005329 Bacteria 2243
38 Ga0070690_100002762 3300005330 Bacteria 9483
39 Ga0070670_100005035 3300005331 Bacteria 11118
40 Ga0070677_10003137 3300005333 Bacteria 5311
41 Ga0068869_100000279 3300005334 Bacteria 27008
42 Ga0070680_100056337 3300005336 Bacteria 3213
43 Ga0070680_100124707 3300005336 Bacteria 2151
44 Ga0070680_100237101 3300005336 Bacteria 1541
45 Ga0070682_100000287 3300005337 Bacteria 35953
46 Ga0068868_100004075 3300005338 Bacteria 10198
47 Ga0070660_100000245 3300005339 Bacteria 35915
48 Ga0070660_100038256 3300005339 Bacteria 3642
49 Ga0070689_100000422 3300005340 Bacteria 24979
50 Ga0070691_10006681 3300005341 Bacteria 5279
51 Ga0070687_100000348 3300005343 Bacteria 15751
52 Ga0070661_100000017 3300005344 Bacteria 153232
53 Ga0070692_10000101 3300005345 Bacteria 19118
54 Ga0070668_100003604 3300005347 Bacteria 11429
55 Ga0070668_100006939 3300005347 Bacteria 8392
56 Ga0070668_100044014 3300005347 Bacteria 3423
57 Ga0070668_100079031 3300005347 Bacteria 2574
58 Ga0070668_100097123 3300005347 Bacteria 2330
59 Ga0070669_100000314 3300005353 Bacteria 37924
60 Ga0070669_100134363 3300005353 Bacteria 1901
61 Ga0070675_100000161 3300005354 Bacteria 40950
62 Ga0070675_100219713 3300005354 Bacteria 1654
63 Ga0070675_100307217 3300005354 Bacteria 1398
64 Ga0070671_100000313 3300005355 Bacteria 32932
65 Ga0070671_100009979 3300005355 Bacteria 7625
66 Ga0070671_100128052 3300005355 Bacteria 2137
67 Ga0070674_100001686 3300005356 Bacteria 11955
68 Ga0070673_100000272 3300005364 Bacteria 26555
69 Ga0070673_100081674 3300005364 Bacteria 2621
70 Ga0070688_100000306 3300005365 Bacteria 24982
71 Ga0070688_100000991 3300005365 Bacteria 14237
72 Ga0070659_100000467 3300005366 Bacteria 29858
73 Ga0070659_100007586 3300005366 Bacteria 7886
74 Ga0070667_100012364 3300005367 Bacteria 7061
75 Ga0070667_100024052 3300005367 Bacteria 5059
76 Ga0070709_10173754 3300005434 Bacteria 1508
77 Ga0070714_100009580 3300005435 Bacteria 7622
78 Ga0070714_100014952 3300005435 Bacteria 6239
79 Ga0070713_100000371 3300005436 Bacteria 28904
80 Ga0070701_10000204 3300005438 Bacteria 18457
81 Ga0070700_100000856 3300005441 Bacteria 15021
82 Ga0070694_100002279 3300005444 Bacteria 11339
83 Ga0070694_100070271 3300005444 Bacteria 2410
84 Ga0070663_100000945 3300005455 Bacteria 15785
85 Ga0070678_100314752 3300005456 Bacteria 1335
86 Ga0070662_100003593 3300005457 Bacteria 9675
87 Ga0070681_10009252 3300005458 Bacteria 9684
88 Ga0070681_10041263 3300005458 Bacteria 4624
89 Ga0070681_10049176 3300005458 Bacteria 4212
90 Ga0070681_10264052 3300005458 Bacteria 1633
91 Ga0068867_100151199 3300005459 Bacteria 1824
92 Ga0070685_10031229 3300005466 Bacteria 2974
93 Ga0070679_100002050 3300005530 Bacteria 18095
94 Ga0070679_100013603 3300005530 Bacteria 7796
95 Ga0070679_100100453 3300005530 Bacteria 2879
96 Ga0070679_100228746 3300005530 Bacteria 1819
97 Ga0070679_100238982 3300005530 Bacteria 1774
98 Ga0070684_100000365 3300005535 Bacteria 31110
99 Ga0070684_100035412 3300005535 Bacteria 4272
100 Ga0068853_100000523 3300005539 Bacteria 25970
101 Ga0070672_100000709 3300005543 Bacteria 19721
102 Ga0070686_100000455 3300005544 Bacteria 24982
103 Ga0070695_100001044 3300005545 Bacteria 15130
104 Ga0070696_100021689 3300005546 Bacteria 4356
105 Ga0070696_100237412 3300005546 Bacteria 1373
106 Ga0070693_100000905 3300005547 Bacteria 13209
107 Ga0070693_100060132 3300005547 Bacteria 2205
108 Ga0070665_100000327 3300005548 Bacteria 73382
109 Ga0070665_100052141 3300005548 Bacteria 4105
110 Ga0070665_100109298 3300005548 Bacteria 2767
111 Ga0070665_100140598 3300005548 Bacteria 2418
112 Ga0070704_100000197 3300005549 Bacteria 24897
113 Ga0068855_100040932 3300005563 Bacteria 5495
114 Ga0068855_100079840 3300005563 Bacteria 3793
115 Ga0068855_100098430 3300005563 Bacteria 3369
116 Ga0068855_100099582 3300005563 Bacteria 3347
117 Ga0068855_100643262 3300005563 Bacteria 1139
118 Ga0070664_100002074 3300005564 Bacteria 16005
119 Ga0068857_100000921 3300005577 Bacteria 22261
120 Ga0068857_100024980 3300005577 Bacteria 5262
121 Ga0068854_100000749 3300005578 Bacteria 19195
122 Ga0068854_100019836 3300005578 Bacteria 4537
123 Ga0068856_100000902 3300005614 Bacteria 31812
124 Ga0068856_100253827 3300005614 Bacteria 1773
125 Ga0070702_100002928 3300005615 Bacteria 7519
126 Ga0070702_100164471 3300005615 Bacteria 1437
127 Ga0068852_100015241 3300005616 Bacteria 5953
128 Ga0068852_100110867 3300005616 Bacteria 2494
129 Ga0068859_100004450 3300005617 Bacteria 14299
130 Ga0068859_100008773 3300005617 Bacteria 10209
131 Ga0068859_100089758 3300005617 Bacteria 3124
132 Ga0068864_100049073 3300005618 Bacteria 3630
133 Ga0068866_10002012 3300005718 Bacteria 8459
134 Ga0068861_100000825 3300005719 Bacteria 18722
135 Ga0068870_10000112 3300005840 Bacteria 27710
136 Ga0068863_100000703 3300005841 Bacteria 33695
137 Ga0068863_100023806 3300005841 Bacteria 5845
138 Ga0068858_100008283 3300005842 Bacteria 9996
139 Ga0068858_100019588 3300005842 Bacteria 6326
140 Ga0068860_100000165 3300005843 Bacteria 108321
141 Ga0068860_100006736 3300005843 Bacteria 11522
142 Ga0068860_100049862 3300005843 Bacteria 3986
143 Ga0068860_100051115 3300005843 Bacteria 3933
144 Ga0068860_100120534 3300005843 Bacteria 2512
145 Ga0068862_100006290 3300005844 Bacteria 9882
146 Ga0068862_100100949 3300005844 Bacteria 2524
147 Ga0081455_10011886 3300005937 Bacteria 8717
148 Ga0081540_1010346 3300005983 Bacteria 6327
149 Ga0081540_1014849 3300005983 Bacteria 4959
150 Ga0081540_1033560 3300005983 Bacteria 2785
151 Ga0081540_1083756 3300005983 Bacteria 1425
152 Ga0075368_10024712 3300006042 Bacteria 2302
153 Ga0075363_100114362 3300006048 Bacteria 1502
154 Ga0075364_10057532 3300006051 Bacteria 2547
155 Ga0075364_10145686 3300006051 Bacteria 1594
156 Ga0070716_100117379 3300006173 Bacteria 1660
157 Ga0075362_10036225 3300006177 Bacteria 2157
158 Ga0075369_10015948 3300006186 Bacteria 3024
159 Ga0075366_10049965 3300006195 Bacteria 2482
160 Ga0097621_100000473 3300006237 Bacteria 28196
161 Ga0097621_100025204 3300006237 Bacteria 4651
162 Ga0075370_10068039 3300006353 Bacteria 2033
163 Ga0068871_100000118 3300006358 Bacteria 49211
164 Ga0068871_100016676 3300006358 Bacteria 5540
165 Ga0068871_100389850 3300006358 Bacteria 1239
166 Ga0075428_100208791 3300006844 Bacteria 2110
167 Ga0075430_100033350 3300006846 Bacteria 4370
168 Ga0075431_100212332 3300006847 Bacteria 1977
169 Ga0075431_100263706 3300006847 Bacteria 1748
170 Ga0075434_100013398 3300006871 Bacteria 7801
171 Ga0075434_100434097 3300006871 Bacteria 1335
172 Ga0097620_100004450 3300006931 Bacteria 14299
173 Ga0097620_100008773 3300006931 Bacteria 10209
174 Ga0097620_100089759 3300006931 Bacteria 3124
175 Ga0105240_10022758 3300009093 Bacteria 8302
176 Ga0105240_10064698 3300009093 Bacteria 4543
177 Ga0111539_10001167 3300009094 Bacteria 34770
178 Ga0111539_10004804 3300009094 Bacteria 17625
179 Ga0105245_10001982 3300009098 Bacteria 18594
180 Ga0105245_10021615 3300009098 Bacteria 5646
181 Ga0114129_10015418 3300009147 Bacteria 10872
182 Ga0114129_10180395 3300009147 Bacteria 2873
183 Ga0105243_10002278 3300009148 Bacteria 16096
184 Ga0105243_10054499 3300009148 Bacteria 3175
185 Ga0105241_10003555 3300009174 Bacteria 11590
186 Ga0105242_10001156 3300009176 Bacteria 20789
187 Ga0105248_10002414 3300009177 Bacteria 20740
188 Ga0105248_10010454 3300009177 Bacteria 10220
189 Ga0105248_10414399 3300009177 Bacteria 1517
190 Ga0105238_10028630 3300009551 Bacteria 5675
191 Ga0105249_10001021 3300009553 Bacteria 24754
192 Ga0105249_10006960 3300009553 Bacteria 9861
193 Ga0099796_10018054 3300010159 Bacteria 2112
194 Ga0105239_10008950 3300010375 Bacteria 11329
195 Ga0105239_10038202 3300010375 Bacteria 5261
196 Ga0105246_10003701 3300011119 Bacteria 9254
197 Ga0157326_1000541 3300012513 Bacteria 4473
198 Ga0157373_10005579 3300013100 Bacteria 9433
199 Ga0157373_10006895 3300013100 Bacteria 8454
200 Ga0157373_10162181 3300013100 Bacteria 1573
201 Ga0157371_10016850 3300013102 Bacteria 5440
202 Ga0157371_10131676 3300013102 Bacteria 1779
203 Ga0157369_10521336 3300013105 Bacteria 1229
204 Ga0157374_10015941 3300013296 Bacteria 6602
205 Ga0157378_10002986 3300013297 Bacteria 15027
206 Ga0157378_10375921 3300013297 Bacteria 1394
207 Ga0163162_10009522 3300013306 Bacteria 9448
208 Ga0157372_10008348 3300013307 Bacteria 11015
209 Ga0157375_10000508 3300013308 Bacteria 35108
210 Ga0157375_10053915 3300013308 Bacteria 3959
211 Ga0163163_10082125 3300014325 Bacteria 3226
212 Ga0157380_10000212 3300014326 Bacteria 34358
213 Ga0157377_10000287 3300014745 Bacteria 24040
214 Ga0157379_10008690 3300014968 Bacteria 8847
215 Ga0157379_10046080 3300014968 Bacteria 3892
216 Ga0157376_10004642 3300014969 Bacteria 9575
217 Ga0157376_10016040 3300014969 Bacteria 5675
218 Ga0163161_10000415 3300017792 Bacteria 35797
219 Ga0209258_100123 3300025242 Bacteria 178931
220 Ga0209026_1005744 3300025250 Bacteria 3239
221 Ga0209759_1001598 3300025256 Bacteria 12262
222 Ga0209233_1009332 3300025261 Bacteria 2991
223 Ga0207666_1000073 3300025271 Bacteria 16742
224 Ga0209455_1000115 3300025272 Bacteria 178506
225 Ga0207673_1000295 3300025290 Bacteria 5011
226 Ga0209758_1003089 3300025297 Bacteria 15775
227 Ga0209050_1000431 3300025298 Bacteria 76895
228 Ga0209257_1000572 3300025304 Bacteria 61910
229 Ga0209257_1001182 3300025304 Bacteria 33003
230 Ga0207697_10000061 3300025315 Bacteria 45271
231 Ga0207697_10005956 3300025315 Bacteria 5594
232 Ga0207653_10005338 3300025885 Bacteria 4015
233 Ga0207682_10002961 3300025893 Bacteria 7454
234 Ga0207692_10150929 3300025898 Bacteria 1331
235 Ga0207642_10001238 3300025899 Bacteria 7906
236 Ga0207688_10000001 3300025901 Bacteria 107505
237 Ga0207688_10015574 3300025901 Bacteria 4122
238 Ga0207685_10037419 3300025905 Bacteria 1787
239 Ga0207645_10000222 3300025907 Bacteria 47139
240 Ga0207643_10000009 3300025908 Bacteria 160496
241 Ga0207705_10019295 3300025909 Bacteria 4875
242 Ga0207705_10054591 3300025909 Bacteria 2879
243 Ga0207705_10086233 3300025909 Bacteria 2294
244 Ga0207654_10001390 3300025911 Bacteria 12824
245 Ga0207707_10004174 3300025912 Bacteria 12795
246 Ga0207707_10007205 3300025912 Bacteria 9680
247 Ga0207707_10139243 3300025912 Bacteria 2122
248 Ga0207707_10317028 3300025912 Bacteria 1347
249 Ga0207695_10002836 3300025913 Bacteria 25176
250 Ga0207695_10003652 3300025913 Bacteria 21488
251 Ga0207695_10037195 3300025913 Bacteria 5254
252 Ga0207695_10041473 3300025913 Bacteria 4927
253 Ga0207671_10033935 3300025914 Bacteria 3794
254 Ga0207660_10000197 3300025917 Bacteria 38486
255 Ga0207660_10056050 3300025917 Bacteria 2819
256 Ga0207657_10000776 3300025919 Bacteria 33868
257 Ga0207657_10060873 3300025919 Bacteria 3239
258 Ga0207649_10000052 3300025920 Bacteria 106800
259 Ga0207649_10271357 3300025920 Bacteria 1230
260 Ga0207652_10001438 3300025921 Bacteria 21098
261 Ga0207652_10028531 3300025921 Bacteria 4657
262 Ga0207652_10041704 3300025921 Bacteria 3903
263 Ga0207652_10065597 3300025921 Bacteria 3144
264 Ga0207652_10096741 3300025921 Bacteria 2601
265 Ga0207652_10169340 3300025921 Bacteria 1959
266 Ga0207681_10000035 3300025923 Bacteria 161792
267 Ga0207681_10307423 3300025923 Bacteria 1256
268 Ga0207694_10057865 3300025924 Bacteria 3015
269 Ga0207650_10006131 3300025925 Bacteria 8190
270 Ga0207650_10035460 3300025925 Bacteria 3623
271 Ga0207659_10000132 3300025926 Bacteria 43798
272 Ga0207659_10093633 3300025926 Bacteria 2249
273 Ga0207687_10000174 3300025927 Bacteria 42351
274 Ga0207687_10017776 3300025927 Bacteria 4688
275 Ga0207700_10000274 3300025928 Bacteria 30765
276 Ga0207700_10118585 3300025928 Bacteria 2142
277 Ga0207664_10007717 3300025929 Bacteria 7469
278 Ga0207644_10000212 3300025931 Bacteria 40175
279 Ga0207644_10016349 3300025931 Bacteria 4992
280 Ga0207644_10098037 3300025931 Bacteria 2196
281 Ga0207690_10000148 3300025932 Bacteria 56244
282 Ga0207690_10000294 3300025932 Bacteria 35162
283 Ga0207706_10001360 3300025933 Bacteria 24441
284 Ga0207706_10025201 3300025933 Bacteria 5332
285 Ga0207706_10144799 3300025933 Bacteria 2090
286 Ga0207709_10000530 3300025935 Bacteria 33097
287 Ga0207670_10000523 3300025936 Bacteria 21171
288 Ga0207670_10317815 3300025936 Bacteria 1224
289 Ga0207669_10000857 3300025937 Bacteria 12949
290 Ga0207704_10000198 3300025938 Bacteria 31182
291 Ga0207691_10000517 3300025940 Bacteria 38398
292 Ga0207691_10076224 3300025940 Bacteria 3022
293 Ga0207691_10252651 3300025940 Bacteria 1521
294 Ga0207711_10008997 3300025941 Bacteria 8349
295 Ga0207711_10041446 3300025941 Bacteria 3921
296 Ga0207711_10311697 3300025941 Bacteria 1453
297 Ga0207689_10000031 3300025942 Bacteria 97131
298 Ga0207661_10001089 3300025944 Bacteria 18028
299 Ga0207661_10094772 3300025944 Bacteria 2494
300 Ga0207679_10000183 3300025945 Bacteria 51645
301 Ga0207667_10057690 3300025949 Bacteria 4074
302 Ga0207667_10458292 3300025949 Bacteria 1295
303 Ga0207651_10000051 3300025960 Bacteria 54163
304 Ga0207651_10155404 3300025960 Bacteria 1786
305 Ga0207712_10000738 3300025961 Bacteria 24767
306 Ga0207712_10056531 3300025961 Bacteria 2765
307 Ga0207668_10000664 3300025972 Bacteria 21087
308 Ga0207668_10009551 3300025972 Bacteria 5821
309 Ga0207668_10078238 3300025972 Bacteria 2387
310 Ga0207640_10002152 3300025981 Bacteria 10584
311 Ga0207658_10016338 3300025986 Bacteria 5104
312 Ga0207677_10075252 3300026023 Bacteria 2399
313 Ga0207703_10279307 3300026035 Bacteria 1516
314 Ga0207703_10321818 3300026035 Bacteria 1416
315 Ga0207639_10001257 3300026041 Bacteria 17164
316 Ga0207678_10000531 3300026067 Bacteria 34761
317 Ga0207708_10000573 3300026075 Bacteria 28465
318 Ga0207708_10006283 3300026075 Bacteria 8804
319 Ga0207702_10003284 3300026078 Bacteria 14915
320 Ga0207641_10001041 3300026088 Bacteria 28118
321 Ga0207648_10000581 3300026089 Bacteria 41019
322 Ga0207676_10000124 3300026095 Bacteria 67747
323 Ga0207676_10033074 3300026095 Bacteria 3904
324 Ga0207674_10000095 3300026116 Bacteria 99278
325 Ga0207674_10032833 3300026116 Bacteria 5441
326 Ga0207675_100000414 3300026118 Bacteria 41042
327 Ga0207675_100149414 3300026118 Bacteria 2223
328 Ga0207683_10000242 3300026121 Bacteria 48576
329 Ga0207698_10000951 3300026142 Bacteria 16837
330 Ga0207698_10473032 3300026142 Bacteria 1214
331 Ga0209981_1001280 3300027378 Bacteria 3191
332 Ga0210000_1001323 3300027462 Bacteria 3489
333 Ga0209999_1004075 3300027543 Bacteria 2625
334 Ga0209999_1008573 3300027543 Bacteria 1845
335 Ga0209982_1006315 3300027552 Bacteria 1722
336 Ga0210002_1001450 3300027617 Bacteria 3346
337 Ga0209983_1001668 3300027665 Bacteria 4921
338 Ga0209971_1004583 3300027682 Bacteria 3279
339 Ga0209966_1001052 3300027695 Bacteria 5088
340 Ga0209974_10001326 3300027876 Bacteria 8891
341 Ga0209974_10006235 3300027876 Bacteria 4171
342 Ga0207428_10000037 3300027907 Bacteria 218857
343 Ga0207428_10001773 3300027907 Bacteria 22109
344 Ga0268266_10000064 3300028379 Bacteria 249533
345 Ga0268266_10050497 3300028379 Bacteria 3569
346 Ga0268266_10071783 3300028379 Bacteria 3001
347 Ga0268266_10076065 3300028379 Bacteria 2917
348 Ga0268265_10000757 3300028380 Bacteria 31383
349 Ga0268265_10010381 3300028380 Bacteria 6292
350 Ga0268265_10012546 3300028380 Bacteria 5744
351 Ga0268265_10101042 3300028380 Bacteria 2329
352 Ga0268264_10000021 3300028381 Bacteria 481580
353 Ga0268264_10002331 3300028381 Bacteria 16789
354 Ga0268264_10012005 3300028381 Bacteria 7133
355 Ga0265336_10000048 3300028666 Bacteria 121572
356 Ga0307517_10004666 3300028786 Bacteria 21011
357 Ga0307515_10000020 3300028794 Bacteria 411735
358 Ga0265324_10003288 3300029957 Bacteria 7765
359 Ga0307511_10061552 3300030521 Bacteria 2859
360 Ga0265330_10068397 3300031235 Bacteria 1538
361 Ga0265325_10024100 3300031241 Bacteria 3312
362 Ga0265339_10002224 3300031249 Bacteria 14062
363 Ga0265327_10077631 3300031251 Bacteria 1647
364 Ga0307513_10001560 3300031456 Bacteria 32859
365 Ga0307513_10025455 3300031456 Bacteria 6855
366 Ga0307408_100098197 3300031548 Bacteria 2226
367 Ga0265313_10000098 3300031595 Bacteria 89130
368 Ga0265342_10099615 3300031712 Bacteria 1657
369 Ga0265342_10134189 3300031712 Bacteria 1385
370 Ga0307516_10003023 3300031730 Bacteria 21939
371 Ga0307507_10128569 3300033179 Bacteria 1993
372 Ga0307510_10026020 3300033180 Bacteria 6736
373 Ga0373930_0000371 3300034816 Bacteria 5868
374 Ga0373948_0000135 3300034817 Bacteria 7792
375 Ga0373950_0000327 3300034818 Bacteria 5972
376 Ga0373958_0000084 3300034819 Bacteria 9758
377 Ga0373938_0000013 3300034957 Bacteria 24269
378 Ga0373928_0001053 3300035084 Bacteria 5442
379 Ga0373929_0002957 3300035085 Bacteria 3093
380 Ga0373940_0002191 3300035088 Bacteria 3746
381 Ga0373949_0001274 3300035090 Bacteria 7344
382 Ga0373951_0006039 3300035091 Bacteria 2787
383 Ga0373952_0000880 3300035092 Bacteria 5466
384 Ga0373932_0000427 3300035112 Bacteria 12821
385 Ga0373932_0001840 3300035112 Bacteria 5677
386 Ga0373936_0005812 3300035113 Bacteria 4647
387 Ga0373939_0000704 3300035114 Bacteria 8284
388 Ga0373960_0000570 3300035121 Bacteria 7483
389 Ga0373942_0000725 3300035207 Bacteria 9083
390 Ga0373962_0000542 3300035242 Bacteria 8470
391 Ga0373962_0000610 3300035242 Bacteria 8072
392 Ga0373931_0002178 3300035691 Bacteria 8639
393 Ga0373931_0046588 3300035691 Bacteria 2292
394 Ga0373927_0073950 3300035695 Bacteria 2207
395 Ga0373927_0106094 3300035695 Bacteria 1829
396 Ga0373927_0163754 3300035695 Bacteria 1457
397 Ga0373925_0263357 3300037068 Bacteria 1385
398 Ga0395899_0005491 3300037312 Bacteria 9828
399 Ga0395899_0037648 3300037312 Bacteria 3626
400 Ga0395900_0004219 3300037418 Bacteria 15252
401 Ga0395900_0017348 3300037418 Bacteria 7350
402 Ga0395900_0160111 3300037418 Bacteria 2296
403 Ga0395900_0202164 3300037418 Bacteria 2009
404 Ga0395900_0316748 3300037418 Bacteria 1541
405 Ga0395898_0014233 3300037466 Bacteria 8177
406 Ga0395898_0015013 3300037466 Bacteria 7950
407 Ga0395898_0022197 3300037466 Bacteria 6432
408 Ga0395898_0352416 3300037466 Bacteria 1403
409 Ga0395905_0000983 3300037471 Bacteria 36562
410 Ga0395901_0022367 3300038443 Bacteria 6478
411 Ga0395901_0088277 3300038443 Bacteria 3243
412 Ga0395901_0130825 3300038443 Bacteria 2637
413 Ga0395901_0242258 3300038443 Bacteria 1880
414 Ga0395901_0603684 3300038443 Bacteria 1106
415 Ga0436365_0677869 3300039437 Bacteria 1359
416 Ga0436365_1378731 3300039437 Bacteria 1495
417 Ga0436360_0898381 3300039438 Bacteria 1634
418 Ga0436360_1266199 3300039438 Bacteria 1137
419 Ga0436361_0180569 3300039447 Bacteria 3182
420 Ga0451577_0004901 3300042876 Bacteria 13951
421 Ga0451577_0057580 3300042876 Bacteria 3464
422 Ga0451577_0068162 3300042876 Bacteria 3173
423 Ga0451577_0146502 3300042876 Bacteria 2123
424 Ga0453683_0013725 3300044673 Bacteria 5275
425 Ga0453683_0048258 3300044673 Bacteria 2671
426 Ga0466966_0051914 3300044684 Bacteria 2606
427 Ga0466963_0043929 3300044694 Bacteria 2940
428 Ga0453684_0014814 3300044712 Bacteria 12416
429 Ga0466957_0188578 3300044842 Bacteria 1350
430 Ga0451576_0006125 3300045051 Bacteria 14822
431 Ga0451576_0024532 3300045051 Bacteria 6514
432 Ga0451576_0177053 3300045051 Bacteria 2227
433 Ga0466967_0003577 3300045976 Bacteria 10195
434 Ga0495603_0097030 3300046455 Bacteria 1722
435 Ga0495638_0159912 3300046460 Bacteria 1300
436 Ga0495638_0164278 3300046460 Bacteria 1278
437 Ga0495639_0003100 3300046475 Bacteria 7230
438 Ga0495583_0000062 3300046506 Bacteria 195151
439 Ga0495606_0001633 3300046507 Bacteria 29221
440 Ga0495637_0021073 3300046520 Bacteria 2991
441 Ga0495637_0060757 3300046520 Bacteria 1551
442 Ga0495640_0007537 3300046533 Bacteria 8551
443 Ga0495621_0030896 3300046539 Bacteria 1834
444 Ga0495597_0037382 3300046542 Bacteria 2180
445 Ga0495668_0065197 3300046616 Bacteria 2005
446 Ga0495634_0054248 3300046642 Bacteria 2684
447 Ga0495625_0007787 3300046660 Bacteria 9246
448 Ga0495625_0035033 3300046660 Bacteria 3702
449 Ga0495659_0005240 3300046664 Bacteria 4078
450 Ga0495669_0000009 3300046684 Bacteria 165516
451 Ga0495649_0000247 3300046694 Bacteria 47906
452 Ga0495589_0003753 3300046794 Bacteria 8176
453 Ga0495674_0073619 3300047319 Bacteria 2944
454 Ga0495677_0069031 3300047445 Bacteria 1316
455 Ga0495686_0000049 3300047472 Bacteria 275004
456 Ga0495686_0014246 3300047472 Bacteria 5479
457 Ga0496101_0000866 3300048904 Bacteria 17903
458 Ga0496102_0001833 3300048905 Bacteria 18355
459 Ga0496102_0246568 3300048905 Bacteria 1684
460 Ga0496103_0001022 3300048906 Bacteria 19583
461 Ga0496107_0000118 3300048910 Bacteria 38697
462 Ga0496108_0006961 3300048911 Bacteria 9152
463 Ga0496108_0077610 3300048911 Bacteria 2810
464 Ga0496109_0002269 3300048912 Bacteria 15980
465 Ga0496109_0042716 3300048912 Bacteria 4108
466 Ga0496110_0156665 3300048913 Bacteria 2063
467 Ga0496112_0064319 3300048915 Bacteria 3620
468 Ga0496112_0102359 3300048915 Bacteria 2834
469 Ga0496113_0067850 3300048916 Bacteria 2706
470 Ga0496114_0372423 3300048917 Bacteria 1264
471 Ga0496115_0000967 3300048918 Bacteria 20862
472 Ga0496115_0106814 3300048918 Bacteria 2298
473 Ga0496126_0018874 3300048929 Bacteria 6814
474 Ga0501031_0222190 3300049568 Bacteria 1230
475 Ga0501032_0054310 3300049569 Bacteria 2697
476 Ga0501033_0033776 3300049570 Bacteria 3840
477 Ga0501034_0086892 3300049571 Bacteria 3127
478 Ga0501038_0149809 3300049574 Bacteria 1902
479 Ga0501038_0187603 3300049574 Bacteria 1665
480 Ga0501039_0149854 3300049575 Bacteria 1833
481 Ga0501043_0015687 3300049579 Bacteria 5939
482 Ga0501047_0000729 3300049581 Bacteria 34190
483 Ga0501047_0012289 3300049581 Bacteria 8103
484 Ga0501047_0027647 3300049581 Bacteria 5465
485 Ga0501047_0106554 3300049581 Bacteria 2684
486 Ga0501047_0109557 3300049581 Bacteria 2644
487 Ga0501047_0350892 3300049581 Bacteria 1312
488 Ga0501067_0065525 3300049583 Bacteria 2011
489 Ga0501067_0088263 3300049583 Bacteria 1721
490 Ga0501068_0021679 3300049584 Bacteria 3754
491 Ga0501070_0039278 3300049586 Bacteria 3948
492 Ga0501070_0110901 3300049586 Bacteria 2267
493 Ga0501072_0097662 3300049588 Bacteria 2335
494 Ga0501073_0027102 3300049589 Bacteria 4101
495 Ga0501073_0091631 3300049589 Bacteria 2113
496 Ga0501073_0155006 3300049589 Bacteria 1588
497 Ga0501074_0190975 3300049590 Bacteria 1460
498 Ga0501075_0114076 3300049591 Bacteria 2055
499 Ga0501080_0129759 3300049742 Bacteria 2333
500 Ga0501080_0156434 3300049742 Bacteria 2105
501 Ga0501083_0014143 3300049744 Bacteria 5581
502 Ga0501083_0088579 3300049744 Bacteria 2046
503 Ga0501035_0001116 3300049822 Bacteria 28096
504 Ga0501035_0027156 3300049822 Bacteria 5234
505 Ga0501035_0087906 3300049822 Bacteria 2739
506 Ga0501044_0000222 3300049823 Bacteria 71930
507 Ga0501044_0006838 3300049823 Bacteria 12568
508 Ga0501044_0066214 3300049823 Bacteria 3684
509 nmdc:mga0k408_34689_c2 3300050493 Bacteria 2284
510 nmdc:mga07m45_59399_c1 3300050496 Bacteria 2164
511 nmdc:mga0qj67_151017_c1 3300050509 Bacteria 1885
512 nmdc:mga06r32_115174_c1 3300050510 Bacteria 2647
513 nmdc:mga08y16_13712_c1 3300050511 Bacteria 8533
514 nmdc:mga08y16_333_c1 3300050511 Bacteria 42807
515 nmdc:mga0n895_62_c1 3300050512 Bacteria 62891
516 nmdc:mga0n895_97850_c1 3300050512 Bacteria 2940
517 Ga0495601_0011855 3300053077 Bacteria 5226
518 Ga0495595_0009473 3300053084 Bacteria 4030
519 Ga0495619_0025558 3300053085 Bacteria 3793
520 Ga0500643_004921 3300053087 Bacteria 5880
521 Ga0500644_0000282 3300053088 Bacteria 28207
522 Ga0500651_0001656 3300053093 Bacteria 11353
523 Ga0500641_0001396 3300053096 Bacteria 8609
524 Ga0500641_0008896 3300053096 Bacteria 3599
525 Ga0500641_0041561 3300053096 Bacteria 1861
526 Ga0500562_011969 3300053108 Bacteria 2202
527 Ga0500593_032897 3300053117 Bacteria 2321
528 Ga0500594_0013276 3300053118 Bacteria 1956
529 Ga0500595_000016 3300053119 Bacteria 211397
530 Ga0500642_0010511 3300053130 Bacteria 3267
531 Ga0500652_000024 3300053131 Bacteria 116239
532 Ga0500652_061781 3300053131 Bacteria 1543
533 Ga0500655_000102 3300053133 Bacteria 21853
534 Ga0500590_000159 3300053148 Bacteria 19562
535 Ga0500604_0012877 3300053151 Bacteria 2263
536 Ga0500616_0000006 3300053153 Bacteria 944738
537 Ga0500616_0012855 3300053153 Bacteria 4881
538 Ga0500616_0028109 3300053153 Bacteria 3101
539 Ga0500616_0092438 3300053153 Bacteria 1495
540 Ga0500622_0006073 3300053156 Bacteria 7092
541 Ga0500627_0016976 3300053158 Bacteria 2851
542 Ga0500570_000434 3300053724 Bacteria 16045
543 Ga0500645_000033 3300053730 Bacteria 119279
544 Ga0500645_000666 3300053730 Bacteria 21562
545 2513676117 2513237098 Bacteria 9902361
546 2524466577 2524023210 Bacteria 9029266
547 2524534660 2524023228 Bacteria 10118060
548 2585261929 2582581305 Bacteria 4895574
549 2643731008 2643221541 Bacteria 5498788
550 2643999041 2643221598 Bacteria 4578346
551 2644039064 2643221605 Bacteria 4772303
552 2644044339 2643221606 Bacteria 5588032
553 2644085038 2643221614 Bacteria 4260023
554 2644342590 2643221661 Bacteria 4267604
555 2644365890 2643221666 Bacteria 4265935
556 2644391737 2643221671 Bacteria 5496681
557 2671119309 2667528175 Bacteria 7532676
558 2793071984 2791355197 Bacteria 8420563
559 2885378315 2885374607 Bacteria 8927485
560 2885392142 2885383462 Bacteria 9473874
561 2903769750 2903768456 Bacteria 9749579
562 2904706143
563 2935632330 2935630451 Bacteria 8169952
564 2939631439 2939631187 Bacteria 6118131
565 2941508277 2941507105 Bacteria 8166816
566 2941515217 2941515067 Bacteria 8166720
567 2941524208 2941523033 Bacteria 8169134
568 8006933797 8006933436 Bacteria 10410654
569 8006983469 8006973647 Bacteria 10679141
570 8056689684 8056681323 Bacteria 8472857
571 8056693181 8056689827 Bacteria 6712655
572 SwRhRL2b_contig_3047889
573 ARSoilYngRDRAFT_c00458
574 ARcpr5yngRDRAFT_c002082
575 ARSoilOldRDRAFT_c000053
576 ARCol0oldRDRAFT_c01210
577 ARCol0yngRDRAFT_1000025
578 JGI24747J21853_1000252
579 JGI24739J22299_10004000
580 JGI24739J22299_10008709
581 JGI24737J22298_10000053
582 JGI24737J22298_10004052
583 JGI24750J21931_1000906
584 JGI24745J21846_1000906
585 JGI24738J21930_10002204
586 JGI24035J26624_1000962
587 JGI24034J26672_10000960
588 JGI24742J22300_10000216
589 JGI24751J29686_10004605
590 JGI25157J39369_1011623
591 Ga0055535_1000063
592 Ga0055535_1000072
593 Ga0055535_1000219
594 Ga0055529_1000287
595 Ga0055530_10001762
596 Ga0055531_10006219
597 Ga0065165_1000472
598 Ga0065165_1018743
599 Ga0065717_1002456
600 Ga0065716_1002341
601 Ga0065704_10100585
602 Ga0065712_10071633
603 Ga0070658_10011015
604 Ga0070658_10019708
605 Ga0070658_10248509
606 Ga0070676_10004729
607 Ga0070683_100001083
608 Ga0070683_100145741
609 Ga0070690_100002762
610 Ga0070670_100005035
611 Ga0070677_10003137
612 Ga0068869_100000279
613 Ga0070680_100056337
614 Ga0070680_100124707
615 Ga0070680_100237101
616 Ga0070682_100000287
617 Ga0068868_100004075
618 Ga0070660_100000245
619 Ga0070660_100038256
620 Ga0070689_100000422
621 Ga0070691_10006681
622 Ga0070687_100000348
623 Ga0070661_100000017
624 Ga0070692_10000101
625 Ga0070668_100003604
626 Ga0070668_100006939
627 Ga0070668_100044014
628 Ga0070668_100079031
629 Ga0070668_100097123
630 Ga0070669_100000314
631 Ga0070669_100134363
632 Ga0070675_100000161
633 Ga0070675_100219713
634 Ga0070675_100307217
635 Ga0070671_100000313
636 Ga0070671_100009979
637 Ga0070671_100128052
638 Ga0070674_100001686
639 Ga0070673_100000272
640 Ga0070673_100081674
641 Ga0070688_100000306
642 Ga0070688_100000991
643 Ga0070659_100000467
644 Ga0070659_100007586
645 Ga0070667_100012364
646 Ga0070667_100024052
647 Ga0070709_10173754
648 Ga0070714_100009580
649 Ga0070714_100014952
650 Ga0070713_100000371
651 Ga0070701_10000204
652 Ga0070700_100000856
653 Ga0070694_100002279
654 Ga0070694_100070271
655 Ga0070663_100000945
656 Ga0070678_100314752
657 Ga0070662_100003593
658 Ga0070681_10009252
659 Ga0070681_10041263
660 Ga0070681_10049176
661 Ga0070681_10264052
662 Ga0068867_100151199
663 Ga0070685_10031229
664 Ga0070679_100002050
665 Ga0070679_100013603
666 Ga0070679_100100453
667 Ga0070679_100228746
668 Ga0070679_100238982
669 Ga0070684_100000365
670 Ga0070684_100035412
671 Ga0068853_100000523
672 Ga0070672_100000709
673 Ga0070686_100000455
674 Ga0070695_100001044
675 Ga0070696_100021689
676 Ga0070696_100237412
677 Ga0070693_100000905
678 Ga0070693_100060132
679 Ga0070665_100000327
680 Ga0070665_100052141
681 Ga0070665_100109298
682 Ga0070665_100140598
683 Ga0070704_100000197
684 Ga0068855_100040932
685 Ga0068855_100079840
686 Ga0068855_100098430
687 Ga0068855_100099582
688 Ga0068855_100643262
689 Ga0070664_100002074
690 Ga0068857_100000921
691 Ga0068857_100024980
692 Ga0068854_100000749
693 Ga0068854_100019836
694 Ga0068856_100000902
695 Ga0068856_100253827
696 Ga0070702_100002928
697 Ga0070702_100164471
698 Ga0068852_100015241
699 Ga0068852_100110867
700 Ga0068859_100004450
701 Ga0068859_100008773
702 Ga0068859_100089758
703 Ga0068864_100049073
704 Ga0068866_10002012
705 Ga0068861_100000825
706 Ga0068870_10000112
707 Ga0068863_100000703
708 Ga0068863_100023806
709 Ga0068858_100008283
710 Ga0068858_100019588
711 Ga0068860_100000165
712 Ga0068860_100006736
713 Ga0068860_100049862
714 Ga0068860_100051115
715 Ga0068860_100120534
716 Ga0068862_100006290
717 Ga0068862_100100949
718 Ga0081455_10011886
719 Ga0081540_1010346
720 Ga0081540_1014849
721 Ga0081540_1033560
722 Ga0081540_1083756
723 Ga0075368_10024712
724 Ga0075363_100114362
725 Ga0075364_10057532
726 Ga0075364_10145686
727 Ga0070716_100117379
728 Ga0075362_10036225
729 Ga0075369_10015948
730 Ga0075366_10049965
731 Ga0097621_100000473
732 Ga0097621_100025204
733 Ga0075370_10068039
734 Ga0068871_100000118
735 Ga0068871_100016676
736 Ga0068871_100389850
737 Ga0075428_100208791
738 Ga0075430_100033350
739 Ga0075431_100212332
740 Ga0075431_100263706
741 Ga0075434_100013398
742 Ga0075434_100434097
743 Ga0097620_100004450
744 Ga0097620_100008773
745 Ga0097620_100089759
746 Ga0105240_10022758
747 Ga0105240_10064698
748 Ga0111539_10001167
749 Ga0111539_10004804
750 Ga0105245_10001982
751 Ga0105245_10021615
752 Ga0114129_10015418
753 Ga0114129_10180395
754 Ga0105243_10002278
755 Ga0105243_10054499
756 Ga0105241_10003555
757 Ga0105242_10001156
758 Ga0105248_10002414
759 Ga0105248_10010454
760 Ga0105248_10414399
761 Ga0105238_10028630
762 Ga0105249_10001021
763 Ga0105249_10006960
764 Ga0099796_10018054
765 Ga0105239_10008950
766 Ga0105239_10038202
767 Ga0105246_10003701
768 Ga0157326_1000541
769 Ga0157373_10005579
770 Ga0157373_10006895
771 Ga0157373_10162181
772 Ga0157371_10016850
773 Ga0157371_10131676
774 Ga0157369_10521336
775 Ga0157374_10015941
776 Ga0157378_10002986
777 Ga0157378_10375921
778 Ga0163162_10009522
779 Ga0157372_10008348
780 Ga0157375_10000508
781 Ga0157375_10053915
782 Ga0163163_10082125
783 Ga0157380_10000212
784 Ga0157377_10000287
785 Ga0157379_10008690
786 Ga0157379_10046080
787 Ga0157376_10004642
788 Ga0157376_10016040
789 Ga0163161_10000415
790 Ga0209258_100123
791 Ga0209026_1005744
792 Ga0209759_1001598
793 Ga0209233_1009332
794 Ga0207666_1000073
795 Ga0209455_1000115
796 Ga0207673_1000295
797 Ga0209758_1003089
798 Ga0209050_1000431
799 Ga0209257_1000572
800 Ga0209257_1001182
801 Ga0207697_10000061
802 Ga0207697_10005956
803 Ga0207653_10005338
804 Ga0207682_10002961
805 Ga0207692_10150929
806 Ga0207642_10001238
807 Ga0207688_10000001
808 Ga0207688_10015574
809 Ga0207685_10037419
810 Ga0207645_10000222
811 Ga0207643_10000009
812 Ga0207705_10019295
813 Ga0207705_10054591
814 Ga0207705_10086233
815 Ga0207654_10001390
816 Ga0207707_10004174
817 Ga0207707_10007205
818 Ga0207707_10139243
819 Ga0207707_10317028
820 Ga0207695_10002836
821 Ga0207695_10003652
822 Ga0207695_10037195
823 Ga0207695_10041473
824 Ga0207671_10033935
825 Ga0207660_10000197
826 Ga0207660_10056050
827 Ga0207657_10000776
828 Ga0207657_10060873
829 Ga0207649_10000052
830 Ga0207649_10271357
831 Ga0207652_10001438
832 Ga0207652_10028531
833 Ga0207652_10041704
834 Ga0207652_10065597
835 Ga0207652_10096741
836 Ga0207652_10169340
837 Ga0207681_10000035
838 Ga0207681_10307423
839 Ga0207694_10057865
840 Ga0207650_10006131
841 Ga0207650_10035460
842 Ga0207659_10000132
843 Ga0207659_10093633
844 Ga0207687_10000174
845 Ga0207687_10017776
846 Ga0207700_10000274
847 Ga0207700_10118585
848 Ga0207664_10007717
849 Ga0207644_10000212
850 Ga0207644_10016349
851 Ga0207644_10098037
852 Ga0207690_10000148
853 Ga0207690_10000294
854 Ga0207706_10001360
855 Ga0207706_10025201
856 Ga0207706_10144799
857 Ga0207709_10000530
858 Ga0207670_10000523
859 Ga0207670_10317815
860 Ga0207669_10000857
861 Ga0207704_10000198
862 Ga0207691_10000517
863 Ga0207691_10076224
864 Ga0207691_10252651
865 Ga0207711_10008997
866 Ga0207711_10041446
867 Ga0207711_10311697
868 Ga0207689_10000031
869 Ga0207661_10001089
870 Ga0207661_10094772
871 Ga0207679_10000183
872 Ga0207667_10057690
873 Ga0207667_10458292
874 Ga0207651_10000051
875 Ga0207651_10155404
876 Ga0207712_10000738
877 Ga0207712_10056531
878 Ga0207668_10000664
879 Ga0207668_10009551
880 Ga0207668_10078238
881 Ga0207640_10002152
882 Ga0207658_10016338
883 Ga0207677_10075252
884 Ga0207703_10279307
885 Ga0207703_10321818
886 Ga0207639_10001257
887 Ga0207678_10000531
888 Ga0207708_10000573
889 Ga0207708_10006283
890 Ga0207702_10003284
891 Ga0207641_10001041
892 Ga0207648_10000581
893 Ga0207676_10000124
894 Ga0207676_10033074
895 Ga0207674_10000095
896 Ga0207674_10032833
897 Ga0207675_100000414
898 Ga0207675_100149414
899 Ga0207683_10000242
900 Ga0207698_10000951
901 Ga0207698_10473032
902 Ga0209981_1001280
903 Ga0210000_1001323
904 Ga0209999_1004075
905 Ga0209999_1008573
906 Ga0209982_1006315
907 Ga0210002_1001450
908 Ga0209983_1001668
909 Ga0209971_1004583
910 Ga0209966_1001052
911 Ga0209974_10001326
912 Ga0209974_10006235
913 Ga0207428_10000037
914 Ga0207428_10001773
915 Ga0268266_10000064
916 Ga0268266_10050497
917 Ga0268266_10071783
918 Ga0268266_10076065
919 Ga0268265_10000757
920 Ga0268265_10010381
921 Ga0268265_10012546
922 Ga0268265_10101042
923 Ga0268264_10000021
924 Ga0268264_10002331
925 Ga0268264_10012005
926 Ga0265336_10000048
927 Ga0307517_10004666
928 Ga0307515_10000020
929 Ga0265324_10003288
930 Ga0307511_10061552
931 Ga0265330_10068397
932 Ga0265325_10024100
933 Ga0265339_10002224
934 Ga0265327_10077631
935 Ga0307513_10001560
936 Ga0307513_10025455
937 Ga0307408_100098197
938 Ga0265313_10000098
939 Ga0265342_10099615
940 Ga0265342_10134189
941 Ga0307516_10003023
942 Ga0307507_10128569
943 Ga0307510_10026020
944 Ga0373930_0000371
945 Ga0373948_0000135
946 Ga0373950_0000327
947 Ga0373958_0000084
948 Ga0373938_0000013
949 Ga0373928_0001053
950 Ga0373929_0002957
951 Ga0373940_0002191
952 Ga0373949_0001274
953 Ga0373951_0006039
954 Ga0373952_0000880
955 Ga0373932_0000427
956 Ga0373932_0001840
957 Ga0373936_0005812
958 Ga0373939_0000704
959 Ga0373960_0000570
960 Ga0373942_0000725
961 Ga0373962_0000542
962 Ga0373962_0000610
963 Ga0373931_0002178
964 Ga0373931_0046588
965 Ga0373927_0073950
966 Ga0373927_0106094
967 Ga0373927_0163754
968 Ga0373925_0263357
969 Ga0395899_0005491
970 Ga0395899_0037648
971 Ga0395900_0004219
972 Ga0395900_0017348
973 Ga0395900_0160111
974 Ga0395900_0202164
975 Ga0395900_0316748
976 Ga0395898_0014233
977 Ga0395898_0015013
978 Ga0395898_0022197
979 Ga0395898_0352416
980 Ga0395905_0000983
981 Ga0395901_0022367
982 Ga0395901_0088277
983 Ga0395901_0130825
984 Ga0395901_0242258
985 Ga0395901_0603684
986 Ga0436365_0677869
987 Ga0436365_1378731
988 Ga0436360_0898381
989 Ga0436360_1266199
990 Ga0436361_0180569
991 Ga0451577_0004901
992 Ga0451577_0057580
993 Ga0451577_0068162
994 Ga0451577_0146502
995 Ga0453683_0013725
996 Ga0453683_0048258
997 Ga0466966_0051914
998 Ga0466963_0043929
999 Ga0453684_0014814
1000 Ga0466957_0188578
1001 Ga0451576_0006125
1002 Ga0451576_0024532
1003 Ga0451576_0177053
1004 Ga0466967_0003577
1005 Ga0495603_0097030
1006 Ga0495638_0159912
1007 Ga0495638_0164278
1008 Ga0495639_0003100
1009 Ga0495583_0000062
1010 Ga0495606_0001633
1011 Ga0495637_0021073
1012 Ga0495637_0060757
1013 Ga0495640_0007537
1014 Ga0495621_0030896
1015 Ga0495597_0037382
1016 Ga0495668_0065197
1017 Ga0495634_0054248
1018 Ga0495625_0007787
1019 Ga0495625_0035033
1020 Ga0495659_0005240
1021 Ga0495669_0000009
1022 Ga0495649_0000247
1023 Ga0495589_0003753
1024 Ga0495674_0073619
1025 Ga0495677_0069031
1026 Ga0495686_0000049
1027 Ga0495686_0014246
1028 Ga0496101_0000866
1029 Ga0496102_0001833
1030 Ga0496102_0246568
1031 Ga0496103_0001022
1032 Ga0496107_0000118
1033 Ga0496108_0006961
1034 Ga0496108_0077610
1035 Ga0496109_0002269
1036 Ga0496109_0042716
1037 Ga0496110_0156665
1038 Ga0496112_0064319
1039 Ga0496112_0102359
1040 Ga0496113_0067850
1041 Ga0496114_0372423
1042 Ga0496115_0000967
1043 Ga0496115_0106814
1044 Ga0496126_0018874
1045 Ga0501031_0222190
1046 Ga0501032_0054310
1047 Ga0501033_0033776
1048 Ga0501034_0086892
1049 Ga0501038_0149809
1050 Ga0501038_0187603
1051 Ga0501039_0149854
1052 Ga0501043_0015687
1053 Ga0501047_0000729
1054 Ga0501047_0012289
1055 Ga0501047_0027647
1056 Ga0501047_0106554
1057 Ga0501047_0109557
1058 Ga0501047_0350892
1059 Ga0501067_0065525
1060 Ga0501067_0088263
1061 Ga0501068_0021679
1062 Ga0501070_0039278
1063 Ga0501070_0110901
1064 Ga0501072_0097662
1065 Ga0501073_0027102
1066 Ga0501073_0091631
1067 Ga0501073_0155006
1068 Ga0501074_0190975
1069 Ga0501075_0114076
1070 Ga0501080_0129759
1071 Ga0501080_0156434
1072 Ga0501083_0014143
1073 Ga0501083_0088579
1074 Ga0501035_0001116
1075 Ga0501035_0027156
1076 Ga0501035_0087906
1077 Ga0501044_0000222
1078 Ga0501044_0006838
1079 Ga0501044_0066214
1080 nmdc:mga0k408_34689_c2
1081 nmdc:mga07m45_59399_c1
1082 nmdc:mga0qj67_151017_c1
1083 nmdc:mga06r32_115174_c1
1084 nmdc:mga08y16_13712_c1
1085 nmdc:mga08y16_333_c1
1086 nmdc:mga0n895_62_c1
1087 nmdc:mga0n895_97850_c1
1088 Ga0495601_0011855
1089 Ga0495595_0009473
1090 Ga0495619_0025558
1091 Ga0500643_004921
1092 Ga0500644_0000282
1093 Ga0500651_0001656
1094 Ga0500641_0001396
1095 Ga0500641_0008896
1096 Ga0500641_0041561
1097 Ga0500562_011969
1098 Ga0500593_032897
1099 Ga0500594_0013276
1100 Ga0500595_000016
1101 Ga0500642_0010511
1102 Ga0500652_000024
1103 Ga0500652_061781
1104 Ga0500655_000102
1105 Ga0500590_000159
1106 Ga0500604_0012877
1107 Ga0500616_0000006
1108 Ga0500616_0012855
1109 Ga0500616_0028109
1110 Ga0500616_0092438
1111 Ga0500622_0006073
1112 Ga0500627_0016976
1113 Ga0500570_000434
1114 Ga0500645_000033
1115 Ga0500645_000666
1116 2513676117
1117 2524466577
1118 2524534660
1119 2585261929
1120 2643731008
1121 2643999041
1122 2644039064
1123 2644044339
1124 2644085038
1125 2644342590
1126 2644365890
1127 2644391737
1128 2671119309
1129 2793071984
1130 2885378315
1131 2885392142
1132 2903769750
1133 2904706143
1134 2935632330
1135 2939631439
1136 2941508277
1137 2941515217
1138 2941524208
1139 8006933797
1140 8006983469
1141 8056689684
1142 8056693181

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

96

245

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b48-assembly1.cif.gz_D 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.8404 41 214
5b47-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex 0.8043 34 221
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.7396 14 336
5b48-assembly1.cif.gz_B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.7176 31 335
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.7132 14 336
ID Description Score Start End Superfamily
af_Q58077_321_493_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6823 35 225 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6698 90 237 3.40.50.970
3lq1A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6673 39 214 3.40.50.970
af_P08142_365_562_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6632 39 216 3.40.50.970
af_Q58077_321_493_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6618 35 225 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A537U0L2-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8303 1 351 GO:0016625
GO:0030976
GO:0044281
AF-A0A537U0L2-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8278 1 351 GO:0016625
GO:0030976
GO:0044281
AF-A0A7Y5M726-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8036 1 108
AF-A0A3A5UYY8-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8031 14 224 GO:0006082
GO:0016625
GO:0030976
GO:0044272
AF-A0A7C3GBX4-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.7999 1 214 GO:0016625
GO:0030976
GO:0044281

Map