F465012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 571 | 369 | 1142 | 351 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237098|2513676117 |
| Length | 382 |
| Sequence | DPGIHAFLSPDQYVDGRVKPGHDAAGTAGVVMTYIAKPKFHHPGLKKNELGYTHRDYEGKISTLCAGCGHDSITASIIEACYELSIEPHRVAKISGIGCSSKTPDYFLGNSHGFNSVHGRMPSVLTGANLANRDLIYLGVSGDGDSASIGFGQFAHSIRRGVNMTYIVENNGVYGLTKGQFSATADRGSKSKKGVVNTDNAIDLVAIALQLGATFVARSFSGDKTQLVPLIAAAIQHKGASFIDVISPCIAFNNHAGSTKSFDYVREHNDAVNRLDVLVGREPIHVDYAPGTVQVVEQHDGSRIALRKLDADYDPHDRVGAMTFLQKHAAKGQIVTGLLYVDPEAEDLHAHLNTVDTPLNTLDAKALCPGSAALDKINASLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 24 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 219 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 326 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 328 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 330 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 334 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 335 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 336 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 344 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 345 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 346 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 347 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 348 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 349 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 350 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 351 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 352 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 353 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 354 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 355 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 356 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 357 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 358 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 359 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 360 | 2904699407 | |||
| 361 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 362 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 363 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 364 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 365 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 366 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 367 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 368 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 369 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.44 |
| Metatranscriptomes | 0 |
| Isolates | 4.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.76 |
| Nodule | 1.93 |
| Rhizoplane | 2.98 |
| Rhizosphere | 81.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3047889 | 2162886007 | Bacteria | 1684 |
| 2 | ARSoilYngRDRAFT_c00458 | 3300000042 | Bacteria | 4991 |
| 3 | ARcpr5yngRDRAFT_c002082 | 3300000043 | Bacteria | 2112 |
| 4 | ARSoilOldRDRAFT_c000053 | 3300000044 | Bacteria | 23841 |
| 5 | ARCol0oldRDRAFT_c01210 | 3300000045 | Bacteria | 1847 |
| 6 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 7 | JGI24747J21853_1000252 | 3300001978 | Bacteria | 2932 |
| 8 | JGI24739J22299_10004000 | 3300001989 | Bacteria | 5641 |
| 9 | JGI24739J22299_10008709 | 3300001989 | Bacteria | 3784 |
| 10 | JGI24737J22298_10000053 | 3300001990 | Bacteria | 34054 |
| 11 | JGI24737J22298_10004052 | 3300001990 | Bacteria | 5124 |
| 12 | JGI24750J21931_1000906 | 3300002070 | Bacteria | 4027 |
| 13 | JGI24745J21846_1000906 | 3300002073 | Bacteria | 2758 |
| 14 | JGI24738J21930_10002204 | 3300002075 | Bacteria | 5182 |
| 15 | JGI24035J26624_1000962 | 3300002126 | Bacteria | 2711 |
| 16 | JGI24034J26672_10000960 | 3300002239 | Bacteria | 3760 |
| 17 | JGI24742J22300_10000216 | 3300002244 | Bacteria | 8591 |
| 18 | JGI24751J29686_10004605 | 3300002459 | Bacteria | 2802 |
| 19 | JGI25157J39369_1011623 | 3300002741 | Bacteria | 1135 |
| 20 | Ga0055535_1000063 | 3300003761 | Bacteria | 117039 |
| 21 | Ga0055535_1000072 | 3300003761 | Bacteria | 113031 |
| 22 | Ga0055535_1000219 | 3300003761 | Bacteria | 60251 |
| 23 | Ga0055529_1000287 | 3300003763 | Bacteria | 59706 |
| 24 | Ga0055530_10001762 | 3300003791 | Bacteria | 15127 |
| 25 | Ga0055531_10006219 | 3300003794 | Bacteria | 6818 |
| 26 | Ga0065165_1000472 | 3300005262 | Bacteria | 62746 |
| 27 | Ga0065165_1018743 | 3300005262 | Bacteria | 2494 |
| 28 | Ga0065717_1002456 | 3300005276 | Bacteria | 1949 |
| 29 | Ga0065716_1002341 | 3300005277 | Bacteria | 1908 |
| 30 | Ga0065704_10100585 | 3300005289 | Bacteria | 2248 |
| 31 | Ga0065712_10071633 | 3300005290 | Bacteria | 5146 |
| 32 | Ga0070658_10011015 | 3300005327 | Bacteria | 7249 |
| 33 | Ga0070658_10019708 | 3300005327 | Bacteria | 5401 |
| 34 | Ga0070658_10248509 | 3300005327 | Bacteria | 1509 |
| 35 | Ga0070676_10004729 | 3300005328 | Bacteria | 7199 |
| 36 | Ga0070683_100001083 | 3300005329 | Bacteria | 20468 |
| 37 | Ga0070683_100145741 | 3300005329 | Bacteria | 2243 |
| 38 | Ga0070690_100002762 | 3300005330 | Bacteria | 9483 |
| 39 | Ga0070670_100005035 | 3300005331 | Bacteria | 11118 |
| 40 | Ga0070677_10003137 | 3300005333 | Bacteria | 5311 |
| 41 | Ga0068869_100000279 | 3300005334 | Bacteria | 27008 |
| 42 | Ga0070680_100056337 | 3300005336 | Bacteria | 3213 |
| 43 | Ga0070680_100124707 | 3300005336 | Bacteria | 2151 |
| 44 | Ga0070680_100237101 | 3300005336 | Bacteria | 1541 |
| 45 | Ga0070682_100000287 | 3300005337 | Bacteria | 35953 |
| 46 | Ga0068868_100004075 | 3300005338 | Bacteria | 10198 |
| 47 | Ga0070660_100000245 | 3300005339 | Bacteria | 35915 |
| 48 | Ga0070660_100038256 | 3300005339 | Bacteria | 3642 |
| 49 | Ga0070689_100000422 | 3300005340 | Bacteria | 24979 |
| 50 | Ga0070691_10006681 | 3300005341 | Bacteria | 5279 |
| 51 | Ga0070687_100000348 | 3300005343 | Bacteria | 15751 |
| 52 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 53 | Ga0070692_10000101 | 3300005345 | Bacteria | 19118 |
| 54 | Ga0070668_100003604 | 3300005347 | Bacteria | 11429 |
| 55 | Ga0070668_100006939 | 3300005347 | Bacteria | 8392 |
| 56 | Ga0070668_100044014 | 3300005347 | Bacteria | 3423 |
| 57 | Ga0070668_100079031 | 3300005347 | Bacteria | 2574 |
| 58 | Ga0070668_100097123 | 3300005347 | Bacteria | 2330 |
| 59 | Ga0070669_100000314 | 3300005353 | Bacteria | 37924 |
| 60 | Ga0070669_100134363 | 3300005353 | Bacteria | 1901 |
| 61 | Ga0070675_100000161 | 3300005354 | Bacteria | 40950 |
| 62 | Ga0070675_100219713 | 3300005354 | Bacteria | 1654 |
| 63 | Ga0070675_100307217 | 3300005354 | Bacteria | 1398 |
| 64 | Ga0070671_100000313 | 3300005355 | Bacteria | 32932 |
| 65 | Ga0070671_100009979 | 3300005355 | Bacteria | 7625 |
| 66 | Ga0070671_100128052 | 3300005355 | Bacteria | 2137 |
| 67 | Ga0070674_100001686 | 3300005356 | Bacteria | 11955 |
| 68 | Ga0070673_100000272 | 3300005364 | Bacteria | 26555 |
| 69 | Ga0070673_100081674 | 3300005364 | Bacteria | 2621 |
| 70 | Ga0070688_100000306 | 3300005365 | Bacteria | 24982 |
| 71 | Ga0070688_100000991 | 3300005365 | Bacteria | 14237 |
| 72 | Ga0070659_100000467 | 3300005366 | Bacteria | 29858 |
| 73 | Ga0070659_100007586 | 3300005366 | Bacteria | 7886 |
| 74 | Ga0070667_100012364 | 3300005367 | Bacteria | 7061 |
| 75 | Ga0070667_100024052 | 3300005367 | Bacteria | 5059 |
| 76 | Ga0070709_10173754 | 3300005434 | Bacteria | 1508 |
| 77 | Ga0070714_100009580 | 3300005435 | Bacteria | 7622 |
| 78 | Ga0070714_100014952 | 3300005435 | Bacteria | 6239 |
| 79 | Ga0070713_100000371 | 3300005436 | Bacteria | 28904 |
| 80 | Ga0070701_10000204 | 3300005438 | Bacteria | 18457 |
| 81 | Ga0070700_100000856 | 3300005441 | Bacteria | 15021 |
| 82 | Ga0070694_100002279 | 3300005444 | Bacteria | 11339 |
| 83 | Ga0070694_100070271 | 3300005444 | Bacteria | 2410 |
| 84 | Ga0070663_100000945 | 3300005455 | Bacteria | 15785 |
| 85 | Ga0070678_100314752 | 3300005456 | Bacteria | 1335 |
| 86 | Ga0070662_100003593 | 3300005457 | Bacteria | 9675 |
| 87 | Ga0070681_10009252 | 3300005458 | Bacteria | 9684 |
| 88 | Ga0070681_10041263 | 3300005458 | Bacteria | 4624 |
| 89 | Ga0070681_10049176 | 3300005458 | Bacteria | 4212 |
| 90 | Ga0070681_10264052 | 3300005458 | Bacteria | 1633 |
| 91 | Ga0068867_100151199 | 3300005459 | Bacteria | 1824 |
| 92 | Ga0070685_10031229 | 3300005466 | Bacteria | 2974 |
| 93 | Ga0070679_100002050 | 3300005530 | Bacteria | 18095 |
| 94 | Ga0070679_100013603 | 3300005530 | Bacteria | 7796 |
| 95 | Ga0070679_100100453 | 3300005530 | Bacteria | 2879 |
| 96 | Ga0070679_100228746 | 3300005530 | Bacteria | 1819 |
| 97 | Ga0070679_100238982 | 3300005530 | Bacteria | 1774 |
| 98 | Ga0070684_100000365 | 3300005535 | Bacteria | 31110 |
| 99 | Ga0070684_100035412 | 3300005535 | Bacteria | 4272 |
| 100 | Ga0068853_100000523 | 3300005539 | Bacteria | 25970 |
| 101 | Ga0070672_100000709 | 3300005543 | Bacteria | 19721 |
| 102 | Ga0070686_100000455 | 3300005544 | Bacteria | 24982 |
| 103 | Ga0070695_100001044 | 3300005545 | Bacteria | 15130 |
| 104 | Ga0070696_100021689 | 3300005546 | Bacteria | 4356 |
| 105 | Ga0070696_100237412 | 3300005546 | Bacteria | 1373 |
| 106 | Ga0070693_100000905 | 3300005547 | Bacteria | 13209 |
| 107 | Ga0070693_100060132 | 3300005547 | Bacteria | 2205 |
| 108 | Ga0070665_100000327 | 3300005548 | Bacteria | 73382 |
| 109 | Ga0070665_100052141 | 3300005548 | Bacteria | 4105 |
| 110 | Ga0070665_100109298 | 3300005548 | Bacteria | 2767 |
| 111 | Ga0070665_100140598 | 3300005548 | Bacteria | 2418 |
| 112 | Ga0070704_100000197 | 3300005549 | Bacteria | 24897 |
| 113 | Ga0068855_100040932 | 3300005563 | Bacteria | 5495 |
| 114 | Ga0068855_100079840 | 3300005563 | Bacteria | 3793 |
| 115 | Ga0068855_100098430 | 3300005563 | Bacteria | 3369 |
| 116 | Ga0068855_100099582 | 3300005563 | Bacteria | 3347 |
| 117 | Ga0068855_100643262 | 3300005563 | Bacteria | 1139 |
| 118 | Ga0070664_100002074 | 3300005564 | Bacteria | 16005 |
| 119 | Ga0068857_100000921 | 3300005577 | Bacteria | 22261 |
| 120 | Ga0068857_100024980 | 3300005577 | Bacteria | 5262 |
| 121 | Ga0068854_100000749 | 3300005578 | Bacteria | 19195 |
| 122 | Ga0068854_100019836 | 3300005578 | Bacteria | 4537 |
| 123 | Ga0068856_100000902 | 3300005614 | Bacteria | 31812 |
| 124 | Ga0068856_100253827 | 3300005614 | Bacteria | 1773 |
| 125 | Ga0070702_100002928 | 3300005615 | Bacteria | 7519 |
| 126 | Ga0070702_100164471 | 3300005615 | Bacteria | 1437 |
| 127 | Ga0068852_100015241 | 3300005616 | Bacteria | 5953 |
| 128 | Ga0068852_100110867 | 3300005616 | Bacteria | 2494 |
| 129 | Ga0068859_100004450 | 3300005617 | Bacteria | 14299 |
| 130 | Ga0068859_100008773 | 3300005617 | Bacteria | 10209 |
| 131 | Ga0068859_100089758 | 3300005617 | Bacteria | 3124 |
| 132 | Ga0068864_100049073 | 3300005618 | Bacteria | 3630 |
| 133 | Ga0068866_10002012 | 3300005718 | Bacteria | 8459 |
| 134 | Ga0068861_100000825 | 3300005719 | Bacteria | 18722 |
| 135 | Ga0068870_10000112 | 3300005840 | Bacteria | 27710 |
| 136 | Ga0068863_100000703 | 3300005841 | Bacteria | 33695 |
| 137 | Ga0068863_100023806 | 3300005841 | Bacteria | 5845 |
| 138 | Ga0068858_100008283 | 3300005842 | Bacteria | 9996 |
| 139 | Ga0068858_100019588 | 3300005842 | Bacteria | 6326 |
| 140 | Ga0068860_100000165 | 3300005843 | Bacteria | 108321 |
| 141 | Ga0068860_100006736 | 3300005843 | Bacteria | 11522 |
| 142 | Ga0068860_100049862 | 3300005843 | Bacteria | 3986 |
| 143 | Ga0068860_100051115 | 3300005843 | Bacteria | 3933 |
| 144 | Ga0068860_100120534 | 3300005843 | Bacteria | 2512 |
| 145 | Ga0068862_100006290 | 3300005844 | Bacteria | 9882 |
| 146 | Ga0068862_100100949 | 3300005844 | Bacteria | 2524 |
| 147 | Ga0081455_10011886 | 3300005937 | Bacteria | 8717 |
| 148 | Ga0081540_1010346 | 3300005983 | Bacteria | 6327 |
| 149 | Ga0081540_1014849 | 3300005983 | Bacteria | 4959 |
| 150 | Ga0081540_1033560 | 3300005983 | Bacteria | 2785 |
| 151 | Ga0081540_1083756 | 3300005983 | Bacteria | 1425 |
| 152 | Ga0075368_10024712 | 3300006042 | Bacteria | 2302 |
| 153 | Ga0075363_100114362 | 3300006048 | Bacteria | 1502 |
| 154 | Ga0075364_10057532 | 3300006051 | Bacteria | 2547 |
| 155 | Ga0075364_10145686 | 3300006051 | Bacteria | 1594 |
| 156 | Ga0070716_100117379 | 3300006173 | Bacteria | 1660 |
| 157 | Ga0075362_10036225 | 3300006177 | Bacteria | 2157 |
| 158 | Ga0075369_10015948 | 3300006186 | Bacteria | 3024 |
| 159 | Ga0075366_10049965 | 3300006195 | Bacteria | 2482 |
| 160 | Ga0097621_100000473 | 3300006237 | Bacteria | 28196 |
| 161 | Ga0097621_100025204 | 3300006237 | Bacteria | 4651 |
| 162 | Ga0075370_10068039 | 3300006353 | Bacteria | 2033 |
| 163 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 164 | Ga0068871_100016676 | 3300006358 | Bacteria | 5540 |
| 165 | Ga0068871_100389850 | 3300006358 | Bacteria | 1239 |
| 166 | Ga0075428_100208791 | 3300006844 | Bacteria | 2110 |
| 167 | Ga0075430_100033350 | 3300006846 | Bacteria | 4370 |
| 168 | Ga0075431_100212332 | 3300006847 | Bacteria | 1977 |
| 169 | Ga0075431_100263706 | 3300006847 | Bacteria | 1748 |
| 170 | Ga0075434_100013398 | 3300006871 | Bacteria | 7801 |
| 171 | Ga0075434_100434097 | 3300006871 | Bacteria | 1335 |
| 172 | Ga0097620_100004450 | 3300006931 | Bacteria | 14299 |
| 173 | Ga0097620_100008773 | 3300006931 | Bacteria | 10209 |
| 174 | Ga0097620_100089759 | 3300006931 | Bacteria | 3124 |
| 175 | Ga0105240_10022758 | 3300009093 | Bacteria | 8302 |
| 176 | Ga0105240_10064698 | 3300009093 | Bacteria | 4543 |
| 177 | Ga0111539_10001167 | 3300009094 | Bacteria | 34770 |
| 178 | Ga0111539_10004804 | 3300009094 | Bacteria | 17625 |
| 179 | Ga0105245_10001982 | 3300009098 | Bacteria | 18594 |
| 180 | Ga0105245_10021615 | 3300009098 | Bacteria | 5646 |
| 181 | Ga0114129_10015418 | 3300009147 | Bacteria | 10872 |
| 182 | Ga0114129_10180395 | 3300009147 | Bacteria | 2873 |
| 183 | Ga0105243_10002278 | 3300009148 | Bacteria | 16096 |
| 184 | Ga0105243_10054499 | 3300009148 | Bacteria | 3175 |
| 185 | Ga0105241_10003555 | 3300009174 | Bacteria | 11590 |
| 186 | Ga0105242_10001156 | 3300009176 | Bacteria | 20789 |
| 187 | Ga0105248_10002414 | 3300009177 | Bacteria | 20740 |
| 188 | Ga0105248_10010454 | 3300009177 | Bacteria | 10220 |
| 189 | Ga0105248_10414399 | 3300009177 | Bacteria | 1517 |
| 190 | Ga0105238_10028630 | 3300009551 | Bacteria | 5675 |
| 191 | Ga0105249_10001021 | 3300009553 | Bacteria | 24754 |
| 192 | Ga0105249_10006960 | 3300009553 | Bacteria | 9861 |
| 193 | Ga0099796_10018054 | 3300010159 | Bacteria | 2112 |
| 194 | Ga0105239_10008950 | 3300010375 | Bacteria | 11329 |
| 195 | Ga0105239_10038202 | 3300010375 | Bacteria | 5261 |
| 196 | Ga0105246_10003701 | 3300011119 | Bacteria | 9254 |
| 197 | Ga0157326_1000541 | 3300012513 | Bacteria | 4473 |
| 198 | Ga0157373_10005579 | 3300013100 | Bacteria | 9433 |
| 199 | Ga0157373_10006895 | 3300013100 | Bacteria | 8454 |
| 200 | Ga0157373_10162181 | 3300013100 | Bacteria | 1573 |
| 201 | Ga0157371_10016850 | 3300013102 | Bacteria | 5440 |
| 202 | Ga0157371_10131676 | 3300013102 | Bacteria | 1779 |
| 203 | Ga0157369_10521336 | 3300013105 | Bacteria | 1229 |
| 204 | Ga0157374_10015941 | 3300013296 | Bacteria | 6602 |
| 205 | Ga0157378_10002986 | 3300013297 | Bacteria | 15027 |
| 206 | Ga0157378_10375921 | 3300013297 | Bacteria | 1394 |
| 207 | Ga0163162_10009522 | 3300013306 | Bacteria | 9448 |
| 208 | Ga0157372_10008348 | 3300013307 | Bacteria | 11015 |
| 209 | Ga0157375_10000508 | 3300013308 | Bacteria | 35108 |
| 210 | Ga0157375_10053915 | 3300013308 | Bacteria | 3959 |
| 211 | Ga0163163_10082125 | 3300014325 | Bacteria | 3226 |
| 212 | Ga0157380_10000212 | 3300014326 | Bacteria | 34358 |
| 213 | Ga0157377_10000287 | 3300014745 | Bacteria | 24040 |
| 214 | Ga0157379_10008690 | 3300014968 | Bacteria | 8847 |
| 215 | Ga0157379_10046080 | 3300014968 | Bacteria | 3892 |
| 216 | Ga0157376_10004642 | 3300014969 | Bacteria | 9575 |
| 217 | Ga0157376_10016040 | 3300014969 | Bacteria | 5675 |
| 218 | Ga0163161_10000415 | 3300017792 | Bacteria | 35797 |
| 219 | Ga0209258_100123 | 3300025242 | Bacteria | 178931 |
| 220 | Ga0209026_1005744 | 3300025250 | Bacteria | 3239 |
| 221 | Ga0209759_1001598 | 3300025256 | Bacteria | 12262 |
| 222 | Ga0209233_1009332 | 3300025261 | Bacteria | 2991 |
| 223 | Ga0207666_1000073 | 3300025271 | Bacteria | 16742 |
| 224 | Ga0209455_1000115 | 3300025272 | Bacteria | 178506 |
| 225 | Ga0207673_1000295 | 3300025290 | Bacteria | 5011 |
| 226 | Ga0209758_1003089 | 3300025297 | Bacteria | 15775 |
| 227 | Ga0209050_1000431 | 3300025298 | Bacteria | 76895 |
| 228 | Ga0209257_1000572 | 3300025304 | Bacteria | 61910 |
| 229 | Ga0209257_1001182 | 3300025304 | Bacteria | 33003 |
| 230 | Ga0207697_10000061 | 3300025315 | Bacteria | 45271 |
| 231 | Ga0207697_10005956 | 3300025315 | Bacteria | 5594 |
| 232 | Ga0207653_10005338 | 3300025885 | Bacteria | 4015 |
| 233 | Ga0207682_10002961 | 3300025893 | Bacteria | 7454 |
| 234 | Ga0207692_10150929 | 3300025898 | Bacteria | 1331 |
| 235 | Ga0207642_10001238 | 3300025899 | Bacteria | 7906 |
| 236 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 237 | Ga0207688_10015574 | 3300025901 | Bacteria | 4122 |
| 238 | Ga0207685_10037419 | 3300025905 | Bacteria | 1787 |
| 239 | Ga0207645_10000222 | 3300025907 | Bacteria | 47139 |
| 240 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 241 | Ga0207705_10019295 | 3300025909 | Bacteria | 4875 |
| 242 | Ga0207705_10054591 | 3300025909 | Bacteria | 2879 |
| 243 | Ga0207705_10086233 | 3300025909 | Bacteria | 2294 |
| 244 | Ga0207654_10001390 | 3300025911 | Bacteria | 12824 |
| 245 | Ga0207707_10004174 | 3300025912 | Bacteria | 12795 |
| 246 | Ga0207707_10007205 | 3300025912 | Bacteria | 9680 |
| 247 | Ga0207707_10139243 | 3300025912 | Bacteria | 2122 |
| 248 | Ga0207707_10317028 | 3300025912 | Bacteria | 1347 |
| 249 | Ga0207695_10002836 | 3300025913 | Bacteria | 25176 |
| 250 | Ga0207695_10003652 | 3300025913 | Bacteria | 21488 |
| 251 | Ga0207695_10037195 | 3300025913 | Bacteria | 5254 |
| 252 | Ga0207695_10041473 | 3300025913 | Bacteria | 4927 |
| 253 | Ga0207671_10033935 | 3300025914 | Bacteria | 3794 |
| 254 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 255 | Ga0207660_10056050 | 3300025917 | Bacteria | 2819 |
| 256 | Ga0207657_10000776 | 3300025919 | Bacteria | 33868 |
| 257 | Ga0207657_10060873 | 3300025919 | Bacteria | 3239 |
| 258 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 259 | Ga0207649_10271357 | 3300025920 | Bacteria | 1230 |
| 260 | Ga0207652_10001438 | 3300025921 | Bacteria | 21098 |
| 261 | Ga0207652_10028531 | 3300025921 | Bacteria | 4657 |
| 262 | Ga0207652_10041704 | 3300025921 | Bacteria | 3903 |
| 263 | Ga0207652_10065597 | 3300025921 | Bacteria | 3144 |
| 264 | Ga0207652_10096741 | 3300025921 | Bacteria | 2601 |
| 265 | Ga0207652_10169340 | 3300025921 | Bacteria | 1959 |
| 266 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 267 | Ga0207681_10307423 | 3300025923 | Bacteria | 1256 |
| 268 | Ga0207694_10057865 | 3300025924 | Bacteria | 3015 |
| 269 | Ga0207650_10006131 | 3300025925 | Bacteria | 8190 |
| 270 | Ga0207650_10035460 | 3300025925 | Bacteria | 3623 |
| 271 | Ga0207659_10000132 | 3300025926 | Bacteria | 43798 |
| 272 | Ga0207659_10093633 | 3300025926 | Bacteria | 2249 |
| 273 | Ga0207687_10000174 | 3300025927 | Bacteria | 42351 |
| 274 | Ga0207687_10017776 | 3300025927 | Bacteria | 4688 |
| 275 | Ga0207700_10000274 | 3300025928 | Bacteria | 30765 |
| 276 | Ga0207700_10118585 | 3300025928 | Bacteria | 2142 |
| 277 | Ga0207664_10007717 | 3300025929 | Bacteria | 7469 |
| 278 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 279 | Ga0207644_10016349 | 3300025931 | Bacteria | 4992 |
| 280 | Ga0207644_10098037 | 3300025931 | Bacteria | 2196 |
| 281 | Ga0207690_10000148 | 3300025932 | Bacteria | 56244 |
| 282 | Ga0207690_10000294 | 3300025932 | Bacteria | 35162 |
| 283 | Ga0207706_10001360 | 3300025933 | Bacteria | 24441 |
| 284 | Ga0207706_10025201 | 3300025933 | Bacteria | 5332 |
| 285 | Ga0207706_10144799 | 3300025933 | Bacteria | 2090 |
| 286 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 287 | Ga0207670_10000523 | 3300025936 | Bacteria | 21171 |
| 288 | Ga0207670_10317815 | 3300025936 | Bacteria | 1224 |
| 289 | Ga0207669_10000857 | 3300025937 | Bacteria | 12949 |
| 290 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 291 | Ga0207691_10000517 | 3300025940 | Bacteria | 38398 |
| 292 | Ga0207691_10076224 | 3300025940 | Bacteria | 3022 |
| 293 | Ga0207691_10252651 | 3300025940 | Bacteria | 1521 |
| 294 | Ga0207711_10008997 | 3300025941 | Bacteria | 8349 |
| 295 | Ga0207711_10041446 | 3300025941 | Bacteria | 3921 |
| 296 | Ga0207711_10311697 | 3300025941 | Bacteria | 1453 |
| 297 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 298 | Ga0207661_10001089 | 3300025944 | Bacteria | 18028 |
| 299 | Ga0207661_10094772 | 3300025944 | Bacteria | 2494 |
| 300 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 301 | Ga0207667_10057690 | 3300025949 | Bacteria | 4074 |
| 302 | Ga0207667_10458292 | 3300025949 | Bacteria | 1295 |
| 303 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 304 | Ga0207651_10155404 | 3300025960 | Bacteria | 1786 |
| 305 | Ga0207712_10000738 | 3300025961 | Bacteria | 24767 |
| 306 | Ga0207712_10056531 | 3300025961 | Bacteria | 2765 |
| 307 | Ga0207668_10000664 | 3300025972 | Bacteria | 21087 |
| 308 | Ga0207668_10009551 | 3300025972 | Bacteria | 5821 |
| 309 | Ga0207668_10078238 | 3300025972 | Bacteria | 2387 |
| 310 | Ga0207640_10002152 | 3300025981 | Bacteria | 10584 |
| 311 | Ga0207658_10016338 | 3300025986 | Bacteria | 5104 |
| 312 | Ga0207677_10075252 | 3300026023 | Bacteria | 2399 |
| 313 | Ga0207703_10279307 | 3300026035 | Bacteria | 1516 |
| 314 | Ga0207703_10321818 | 3300026035 | Bacteria | 1416 |
| 315 | Ga0207639_10001257 | 3300026041 | Bacteria | 17164 |
| 316 | Ga0207678_10000531 | 3300026067 | Bacteria | 34761 |
| 317 | Ga0207708_10000573 | 3300026075 | Bacteria | 28465 |
| 318 | Ga0207708_10006283 | 3300026075 | Bacteria | 8804 |
| 319 | Ga0207702_10003284 | 3300026078 | Bacteria | 14915 |
| 320 | Ga0207641_10001041 | 3300026088 | Bacteria | 28118 |
| 321 | Ga0207648_10000581 | 3300026089 | Bacteria | 41019 |
| 322 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 323 | Ga0207676_10033074 | 3300026095 | Bacteria | 3904 |
| 324 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 325 | Ga0207674_10032833 | 3300026116 | Bacteria | 5441 |
| 326 | Ga0207675_100000414 | 3300026118 | Bacteria | 41042 |
| 327 | Ga0207675_100149414 | 3300026118 | Bacteria | 2223 |
| 328 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 329 | Ga0207698_10000951 | 3300026142 | Bacteria | 16837 |
| 330 | Ga0207698_10473032 | 3300026142 | Bacteria | 1214 |
| 331 | Ga0209981_1001280 | 3300027378 | Bacteria | 3191 |
| 332 | Ga0210000_1001323 | 3300027462 | Bacteria | 3489 |
| 333 | Ga0209999_1004075 | 3300027543 | Bacteria | 2625 |
| 334 | Ga0209999_1008573 | 3300027543 | Bacteria | 1845 |
| 335 | Ga0209982_1006315 | 3300027552 | Bacteria | 1722 |
| 336 | Ga0210002_1001450 | 3300027617 | Bacteria | 3346 |
| 337 | Ga0209983_1001668 | 3300027665 | Bacteria | 4921 |
| 338 | Ga0209971_1004583 | 3300027682 | Bacteria | 3279 |
| 339 | Ga0209966_1001052 | 3300027695 | Bacteria | 5088 |
| 340 | Ga0209974_10001326 | 3300027876 | Bacteria | 8891 |
| 341 | Ga0209974_10006235 | 3300027876 | Bacteria | 4171 |
| 342 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 343 | Ga0207428_10001773 | 3300027907 | Bacteria | 22109 |
| 344 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 345 | Ga0268266_10050497 | 3300028379 | Bacteria | 3569 |
| 346 | Ga0268266_10071783 | 3300028379 | Bacteria | 3001 |
| 347 | Ga0268266_10076065 | 3300028379 | Bacteria | 2917 |
| 348 | Ga0268265_10000757 | 3300028380 | Bacteria | 31383 |
| 349 | Ga0268265_10010381 | 3300028380 | Bacteria | 6292 |
| 350 | Ga0268265_10012546 | 3300028380 | Bacteria | 5744 |
| 351 | Ga0268265_10101042 | 3300028380 | Bacteria | 2329 |
| 352 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 353 | Ga0268264_10002331 | 3300028381 | Bacteria | 16789 |
| 354 | Ga0268264_10012005 | 3300028381 | Bacteria | 7133 |
| 355 | Ga0265336_10000048 | 3300028666 | Bacteria | 121572 |
| 356 | Ga0307517_10004666 | 3300028786 | Bacteria | 21011 |
| 357 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 358 | Ga0265324_10003288 | 3300029957 | Bacteria | 7765 |
| 359 | Ga0307511_10061552 | 3300030521 | Bacteria | 2859 |
| 360 | Ga0265330_10068397 | 3300031235 | Bacteria | 1538 |
| 361 | Ga0265325_10024100 | 3300031241 | Bacteria | 3312 |
| 362 | Ga0265339_10002224 | 3300031249 | Bacteria | 14062 |
| 363 | Ga0265327_10077631 | 3300031251 | Bacteria | 1647 |
| 364 | Ga0307513_10001560 | 3300031456 | Bacteria | 32859 |
| 365 | Ga0307513_10025455 | 3300031456 | Bacteria | 6855 |
| 366 | Ga0307408_100098197 | 3300031548 | Bacteria | 2226 |
| 367 | Ga0265313_10000098 | 3300031595 | Bacteria | 89130 |
| 368 | Ga0265342_10099615 | 3300031712 | Bacteria | 1657 |
| 369 | Ga0265342_10134189 | 3300031712 | Bacteria | 1385 |
| 370 | Ga0307516_10003023 | 3300031730 | Bacteria | 21939 |
| 371 | Ga0307507_10128569 | 3300033179 | Bacteria | 1993 |
| 372 | Ga0307510_10026020 | 3300033180 | Bacteria | 6736 |
| 373 | Ga0373930_0000371 | 3300034816 | Bacteria | 5868 |
| 374 | Ga0373948_0000135 | 3300034817 | Bacteria | 7792 |
| 375 | Ga0373950_0000327 | 3300034818 | Bacteria | 5972 |
| 376 | Ga0373958_0000084 | 3300034819 | Bacteria | 9758 |
| 377 | Ga0373938_0000013 | 3300034957 | Bacteria | 24269 |
| 378 | Ga0373928_0001053 | 3300035084 | Bacteria | 5442 |
| 379 | Ga0373929_0002957 | 3300035085 | Bacteria | 3093 |
| 380 | Ga0373940_0002191 | 3300035088 | Bacteria | 3746 |
| 381 | Ga0373949_0001274 | 3300035090 | Bacteria | 7344 |
| 382 | Ga0373951_0006039 | 3300035091 | Bacteria | 2787 |
| 383 | Ga0373952_0000880 | 3300035092 | Bacteria | 5466 |
| 384 | Ga0373932_0000427 | 3300035112 | Bacteria | 12821 |
| 385 | Ga0373932_0001840 | 3300035112 | Bacteria | 5677 |
| 386 | Ga0373936_0005812 | 3300035113 | Bacteria | 4647 |
| 387 | Ga0373939_0000704 | 3300035114 | Bacteria | 8284 |
| 388 | Ga0373960_0000570 | 3300035121 | Bacteria | 7483 |
| 389 | Ga0373942_0000725 | 3300035207 | Bacteria | 9083 |
| 390 | Ga0373962_0000542 | 3300035242 | Bacteria | 8470 |
| 391 | Ga0373962_0000610 | 3300035242 | Bacteria | 8072 |
| 392 | Ga0373931_0002178 | 3300035691 | Bacteria | 8639 |
| 393 | Ga0373931_0046588 | 3300035691 | Bacteria | 2292 |
| 394 | Ga0373927_0073950 | 3300035695 | Bacteria | 2207 |
| 395 | Ga0373927_0106094 | 3300035695 | Bacteria | 1829 |
| 396 | Ga0373927_0163754 | 3300035695 | Bacteria | 1457 |
| 397 | Ga0373925_0263357 | 3300037068 | Bacteria | 1385 |
| 398 | Ga0395899_0005491 | 3300037312 | Bacteria | 9828 |
| 399 | Ga0395899_0037648 | 3300037312 | Bacteria | 3626 |
| 400 | Ga0395900_0004219 | 3300037418 | Bacteria | 15252 |
| 401 | Ga0395900_0017348 | 3300037418 | Bacteria | 7350 |
| 402 | Ga0395900_0160111 | 3300037418 | Bacteria | 2296 |
| 403 | Ga0395900_0202164 | 3300037418 | Bacteria | 2009 |
| 404 | Ga0395900_0316748 | 3300037418 | Bacteria | 1541 |
| 405 | Ga0395898_0014233 | 3300037466 | Bacteria | 8177 |
| 406 | Ga0395898_0015013 | 3300037466 | Bacteria | 7950 |
| 407 | Ga0395898_0022197 | 3300037466 | Bacteria | 6432 |
| 408 | Ga0395898_0352416 | 3300037466 | Bacteria | 1403 |
| 409 | Ga0395905_0000983 | 3300037471 | Bacteria | 36562 |
| 410 | Ga0395901_0022367 | 3300038443 | Bacteria | 6478 |
| 411 | Ga0395901_0088277 | 3300038443 | Bacteria | 3243 |
| 412 | Ga0395901_0130825 | 3300038443 | Bacteria | 2637 |
| 413 | Ga0395901_0242258 | 3300038443 | Bacteria | 1880 |
| 414 | Ga0395901_0603684 | 3300038443 | Bacteria | 1106 |
| 415 | Ga0436365_0677869 | 3300039437 | Bacteria | 1359 |
| 416 | Ga0436365_1378731 | 3300039437 | Bacteria | 1495 |
| 417 | Ga0436360_0898381 | 3300039438 | Bacteria | 1634 |
| 418 | Ga0436360_1266199 | 3300039438 | Bacteria | 1137 |
| 419 | Ga0436361_0180569 | 3300039447 | Bacteria | 3182 |
| 420 | Ga0451577_0004901 | 3300042876 | Bacteria | 13951 |
| 421 | Ga0451577_0057580 | 3300042876 | Bacteria | 3464 |
| 422 | Ga0451577_0068162 | 3300042876 | Bacteria | 3173 |
| 423 | Ga0451577_0146502 | 3300042876 | Bacteria | 2123 |
| 424 | Ga0453683_0013725 | 3300044673 | Bacteria | 5275 |
| 425 | Ga0453683_0048258 | 3300044673 | Bacteria | 2671 |
| 426 | Ga0466966_0051914 | 3300044684 | Bacteria | 2606 |
| 427 | Ga0466963_0043929 | 3300044694 | Bacteria | 2940 |
| 428 | Ga0453684_0014814 | 3300044712 | Bacteria | 12416 |
| 429 | Ga0466957_0188578 | 3300044842 | Bacteria | 1350 |
| 430 | Ga0451576_0006125 | 3300045051 | Bacteria | 14822 |
| 431 | Ga0451576_0024532 | 3300045051 | Bacteria | 6514 |
| 432 | Ga0451576_0177053 | 3300045051 | Bacteria | 2227 |
| 433 | Ga0466967_0003577 | 3300045976 | Bacteria | 10195 |
| 434 | Ga0495603_0097030 | 3300046455 | Bacteria | 1722 |
| 435 | Ga0495638_0159912 | 3300046460 | Bacteria | 1300 |
| 436 | Ga0495638_0164278 | 3300046460 | Bacteria | 1278 |
| 437 | Ga0495639_0003100 | 3300046475 | Bacteria | 7230 |
| 438 | Ga0495583_0000062 | 3300046506 | Bacteria | 195151 |
| 439 | Ga0495606_0001633 | 3300046507 | Bacteria | 29221 |
| 440 | Ga0495637_0021073 | 3300046520 | Bacteria | 2991 |
| 441 | Ga0495637_0060757 | 3300046520 | Bacteria | 1551 |
| 442 | Ga0495640_0007537 | 3300046533 | Bacteria | 8551 |
| 443 | Ga0495621_0030896 | 3300046539 | Bacteria | 1834 |
| 444 | Ga0495597_0037382 | 3300046542 | Bacteria | 2180 |
| 445 | Ga0495668_0065197 | 3300046616 | Bacteria | 2005 |
| 446 | Ga0495634_0054248 | 3300046642 | Bacteria | 2684 |
| 447 | Ga0495625_0007787 | 3300046660 | Bacteria | 9246 |
| 448 | Ga0495625_0035033 | 3300046660 | Bacteria | 3702 |
| 449 | Ga0495659_0005240 | 3300046664 | Bacteria | 4078 |
| 450 | Ga0495669_0000009 | 3300046684 | Bacteria | 165516 |
| 451 | Ga0495649_0000247 | 3300046694 | Bacteria | 47906 |
| 452 | Ga0495589_0003753 | 3300046794 | Bacteria | 8176 |
| 453 | Ga0495674_0073619 | 3300047319 | Bacteria | 2944 |
| 454 | Ga0495677_0069031 | 3300047445 | Bacteria | 1316 |
| 455 | Ga0495686_0000049 | 3300047472 | Bacteria | 275004 |
| 456 | Ga0495686_0014246 | 3300047472 | Bacteria | 5479 |
| 457 | Ga0496101_0000866 | 3300048904 | Bacteria | 17903 |
| 458 | Ga0496102_0001833 | 3300048905 | Bacteria | 18355 |
| 459 | Ga0496102_0246568 | 3300048905 | Bacteria | 1684 |
| 460 | Ga0496103_0001022 | 3300048906 | Bacteria | 19583 |
| 461 | Ga0496107_0000118 | 3300048910 | Bacteria | 38697 |
| 462 | Ga0496108_0006961 | 3300048911 | Bacteria | 9152 |
| 463 | Ga0496108_0077610 | 3300048911 | Bacteria | 2810 |
| 464 | Ga0496109_0002269 | 3300048912 | Bacteria | 15980 |
| 465 | Ga0496109_0042716 | 3300048912 | Bacteria | 4108 |
| 466 | Ga0496110_0156665 | 3300048913 | Bacteria | 2063 |
| 467 | Ga0496112_0064319 | 3300048915 | Bacteria | 3620 |
| 468 | Ga0496112_0102359 | 3300048915 | Bacteria | 2834 |
| 469 | Ga0496113_0067850 | 3300048916 | Bacteria | 2706 |
| 470 | Ga0496114_0372423 | 3300048917 | Bacteria | 1264 |
| 471 | Ga0496115_0000967 | 3300048918 | Bacteria | 20862 |
| 472 | Ga0496115_0106814 | 3300048918 | Bacteria | 2298 |
| 473 | Ga0496126_0018874 | 3300048929 | Bacteria | 6814 |
| 474 | Ga0501031_0222190 | 3300049568 | Bacteria | 1230 |
| 475 | Ga0501032_0054310 | 3300049569 | Bacteria | 2697 |
| 476 | Ga0501033_0033776 | 3300049570 | Bacteria | 3840 |
| 477 | Ga0501034_0086892 | 3300049571 | Bacteria | 3127 |
| 478 | Ga0501038_0149809 | 3300049574 | Bacteria | 1902 |
| 479 | Ga0501038_0187603 | 3300049574 | Bacteria | 1665 |
| 480 | Ga0501039_0149854 | 3300049575 | Bacteria | 1833 |
| 481 | Ga0501043_0015687 | 3300049579 | Bacteria | 5939 |
| 482 | Ga0501047_0000729 | 3300049581 | Bacteria | 34190 |
| 483 | Ga0501047_0012289 | 3300049581 | Bacteria | 8103 |
| 484 | Ga0501047_0027647 | 3300049581 | Bacteria | 5465 |
| 485 | Ga0501047_0106554 | 3300049581 | Bacteria | 2684 |
| 486 | Ga0501047_0109557 | 3300049581 | Bacteria | 2644 |
| 487 | Ga0501047_0350892 | 3300049581 | Bacteria | 1312 |
| 488 | Ga0501067_0065525 | 3300049583 | Bacteria | 2011 |
| 489 | Ga0501067_0088263 | 3300049583 | Bacteria | 1721 |
| 490 | Ga0501068_0021679 | 3300049584 | Bacteria | 3754 |
| 491 | Ga0501070_0039278 | 3300049586 | Bacteria | 3948 |
| 492 | Ga0501070_0110901 | 3300049586 | Bacteria | 2267 |
| 493 | Ga0501072_0097662 | 3300049588 | Bacteria | 2335 |
| 494 | Ga0501073_0027102 | 3300049589 | Bacteria | 4101 |
| 495 | Ga0501073_0091631 | 3300049589 | Bacteria | 2113 |
| 496 | Ga0501073_0155006 | 3300049589 | Bacteria | 1588 |
| 497 | Ga0501074_0190975 | 3300049590 | Bacteria | 1460 |
| 498 | Ga0501075_0114076 | 3300049591 | Bacteria | 2055 |
| 499 | Ga0501080_0129759 | 3300049742 | Bacteria | 2333 |
| 500 | Ga0501080_0156434 | 3300049742 | Bacteria | 2105 |
| 501 | Ga0501083_0014143 | 3300049744 | Bacteria | 5581 |
| 502 | Ga0501083_0088579 | 3300049744 | Bacteria | 2046 |
| 503 | Ga0501035_0001116 | 3300049822 | Bacteria | 28096 |
| 504 | Ga0501035_0027156 | 3300049822 | Bacteria | 5234 |
| 505 | Ga0501035_0087906 | 3300049822 | Bacteria | 2739 |
| 506 | Ga0501044_0000222 | 3300049823 | Bacteria | 71930 |
| 507 | Ga0501044_0006838 | 3300049823 | Bacteria | 12568 |
| 508 | Ga0501044_0066214 | 3300049823 | Bacteria | 3684 |
| 509 | nmdc:mga0k408_34689_c2 | 3300050493 | Bacteria | 2284 |
| 510 | nmdc:mga07m45_59399_c1 | 3300050496 | Bacteria | 2164 |
| 511 | nmdc:mga0qj67_151017_c1 | 3300050509 | Bacteria | 1885 |
| 512 | nmdc:mga06r32_115174_c1 | 3300050510 | Bacteria | 2647 |
| 513 | nmdc:mga08y16_13712_c1 | 3300050511 | Bacteria | 8533 |
| 514 | nmdc:mga08y16_333_c1 | 3300050511 | Bacteria | 42807 |
| 515 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 516 | nmdc:mga0n895_97850_c1 | 3300050512 | Bacteria | 2940 |
| 517 | Ga0495601_0011855 | 3300053077 | Bacteria | 5226 |
| 518 | Ga0495595_0009473 | 3300053084 | Bacteria | 4030 |
| 519 | Ga0495619_0025558 | 3300053085 | Bacteria | 3793 |
| 520 | Ga0500643_004921 | 3300053087 | Bacteria | 5880 |
| 521 | Ga0500644_0000282 | 3300053088 | Bacteria | 28207 |
| 522 | Ga0500651_0001656 | 3300053093 | Bacteria | 11353 |
| 523 | Ga0500641_0001396 | 3300053096 | Bacteria | 8609 |
| 524 | Ga0500641_0008896 | 3300053096 | Bacteria | 3599 |
| 525 | Ga0500641_0041561 | 3300053096 | Bacteria | 1861 |
| 526 | Ga0500562_011969 | 3300053108 | Bacteria | 2202 |
| 527 | Ga0500593_032897 | 3300053117 | Bacteria | 2321 |
| 528 | Ga0500594_0013276 | 3300053118 | Bacteria | 1956 |
| 529 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 530 | Ga0500642_0010511 | 3300053130 | Bacteria | 3267 |
| 531 | Ga0500652_000024 | 3300053131 | Bacteria | 116239 |
| 532 | Ga0500652_061781 | 3300053131 | Bacteria | 1543 |
| 533 | Ga0500655_000102 | 3300053133 | Bacteria | 21853 |
| 534 | Ga0500590_000159 | 3300053148 | Bacteria | 19562 |
| 535 | Ga0500604_0012877 | 3300053151 | Bacteria | 2263 |
| 536 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 537 | Ga0500616_0012855 | 3300053153 | Bacteria | 4881 |
| 538 | Ga0500616_0028109 | 3300053153 | Bacteria | 3101 |
| 539 | Ga0500616_0092438 | 3300053153 | Bacteria | 1495 |
| 540 | Ga0500622_0006073 | 3300053156 | Bacteria | 7092 |
| 541 | Ga0500627_0016976 | 3300053158 | Bacteria | 2851 |
| 542 | Ga0500570_000434 | 3300053724 | Bacteria | 16045 |
| 543 | Ga0500645_000033 | 3300053730 | Bacteria | 119279 |
| 544 | Ga0500645_000666 | 3300053730 | Bacteria | 21562 |
| 545 | 2513676117 | 2513237098 | Bacteria | 9902361 |
| 546 | 2524466577 | 2524023210 | Bacteria | 9029266 |
| 547 | 2524534660 | 2524023228 | Bacteria | 10118060 |
| 548 | 2585261929 | 2582581305 | Bacteria | 4895574 |
| 549 | 2643731008 | 2643221541 | Bacteria | 5498788 |
| 550 | 2643999041 | 2643221598 | Bacteria | 4578346 |
| 551 | 2644039064 | 2643221605 | Bacteria | 4772303 |
| 552 | 2644044339 | 2643221606 | Bacteria | 5588032 |
| 553 | 2644085038 | 2643221614 | Bacteria | 4260023 |
| 554 | 2644342590 | 2643221661 | Bacteria | 4267604 |
| 555 | 2644365890 | 2643221666 | Bacteria | 4265935 |
| 556 | 2644391737 | 2643221671 | Bacteria | 5496681 |
| 557 | 2671119309 | 2667528175 | Bacteria | 7532676 |
| 558 | 2793071984 | 2791355197 | Bacteria | 8420563 |
| 559 | 2885378315 | 2885374607 | Bacteria | 8927485 |
| 560 | 2885392142 | 2885383462 | Bacteria | 9473874 |
| 561 | 2903769750 | 2903768456 | Bacteria | 9749579 |
| 562 | 2904706143 | |||
| 563 | 2935632330 | 2935630451 | Bacteria | 8169952 |
| 564 | 2939631439 | 2939631187 | Bacteria | 6118131 |
| 565 | 2941508277 | 2941507105 | Bacteria | 8166816 |
| 566 | 2941515217 | 2941515067 | Bacteria | 8166720 |
| 567 | 2941524208 | 2941523033 | Bacteria | 8169134 |
| 568 | 8006933797 | 8006933436 | Bacteria | 10410654 |
| 569 | 8006983469 | 8006973647 | Bacteria | 10679141 |
| 570 | 8056689684 | 8056681323 | Bacteria | 8472857 |
| 571 | 8056693181 | 8056689827 | Bacteria | 6712655 |
| 572 | SwRhRL2b_contig_3047889 | |||
| 573 | ARSoilYngRDRAFT_c00458 | |||
| 574 | ARcpr5yngRDRAFT_c002082 | |||
| 575 | ARSoilOldRDRAFT_c000053 | |||
| 576 | ARCol0oldRDRAFT_c01210 | |||
| 577 | ARCol0yngRDRAFT_1000025 | |||
| 578 | JGI24747J21853_1000252 | |||
| 579 | JGI24739J22299_10004000 | |||
| 580 | JGI24739J22299_10008709 | |||
| 581 | JGI24737J22298_10000053 | |||
| 582 | JGI24737J22298_10004052 | |||
| 583 | JGI24750J21931_1000906 | |||
| 584 | JGI24745J21846_1000906 | |||
| 585 | JGI24738J21930_10002204 | |||
| 586 | JGI24035J26624_1000962 | |||
| 587 | JGI24034J26672_10000960 | |||
| 588 | JGI24742J22300_10000216 | |||
| 589 | JGI24751J29686_10004605 | |||
| 590 | JGI25157J39369_1011623 | |||
| 591 | Ga0055535_1000063 | |||
| 592 | Ga0055535_1000072 | |||
| 593 | Ga0055535_1000219 | |||
| 594 | Ga0055529_1000287 | |||
| 595 | Ga0055530_10001762 | |||
| 596 | Ga0055531_10006219 | |||
| 597 | Ga0065165_1000472 | |||
| 598 | Ga0065165_1018743 | |||
| 599 | Ga0065717_1002456 | |||
| 600 | Ga0065716_1002341 | |||
| 601 | Ga0065704_10100585 | |||
| 602 | Ga0065712_10071633 | |||
| 603 | Ga0070658_10011015 | |||
| 604 | Ga0070658_10019708 | |||
| 605 | Ga0070658_10248509 | |||
| 606 | Ga0070676_10004729 | |||
| 607 | Ga0070683_100001083 | |||
| 608 | Ga0070683_100145741 | |||
| 609 | Ga0070690_100002762 | |||
| 610 | Ga0070670_100005035 | |||
| 611 | Ga0070677_10003137 | |||
| 612 | Ga0068869_100000279 | |||
| 613 | Ga0070680_100056337 | |||
| 614 | Ga0070680_100124707 | |||
| 615 | Ga0070680_100237101 | |||
| 616 | Ga0070682_100000287 | |||
| 617 | Ga0068868_100004075 | |||
| 618 | Ga0070660_100000245 | |||
| 619 | Ga0070660_100038256 | |||
| 620 | Ga0070689_100000422 | |||
| 621 | Ga0070691_10006681 | |||
| 622 | Ga0070687_100000348 | |||
| 623 | Ga0070661_100000017 | |||
| 624 | Ga0070692_10000101 | |||
| 625 | Ga0070668_100003604 | |||
| 626 | Ga0070668_100006939 | |||
| 627 | Ga0070668_100044014 | |||
| 628 | Ga0070668_100079031 | |||
| 629 | Ga0070668_100097123 | |||
| 630 | Ga0070669_100000314 | |||
| 631 | Ga0070669_100134363 | |||
| 632 | Ga0070675_100000161 | |||
| 633 | Ga0070675_100219713 | |||
| 634 | Ga0070675_100307217 | |||
| 635 | Ga0070671_100000313 | |||
| 636 | Ga0070671_100009979 | |||
| 637 | Ga0070671_100128052 | |||
| 638 | Ga0070674_100001686 | |||
| 639 | Ga0070673_100000272 | |||
| 640 | Ga0070673_100081674 | |||
| 641 | Ga0070688_100000306 | |||
| 642 | Ga0070688_100000991 | |||
| 643 | Ga0070659_100000467 | |||
| 644 | Ga0070659_100007586 | |||
| 645 | Ga0070667_100012364 | |||
| 646 | Ga0070667_100024052 | |||
| 647 | Ga0070709_10173754 | |||
| 648 | Ga0070714_100009580 | |||
| 649 | Ga0070714_100014952 | |||
| 650 | Ga0070713_100000371 | |||
| 651 | Ga0070701_10000204 | |||
| 652 | Ga0070700_100000856 | |||
| 653 | Ga0070694_100002279 | |||
| 654 | Ga0070694_100070271 | |||
| 655 | Ga0070663_100000945 | |||
| 656 | Ga0070678_100314752 | |||
| 657 | Ga0070662_100003593 | |||
| 658 | Ga0070681_10009252 | |||
| 659 | Ga0070681_10041263 | |||
| 660 | Ga0070681_10049176 | |||
| 661 | Ga0070681_10264052 | |||
| 662 | Ga0068867_100151199 | |||
| 663 | Ga0070685_10031229 | |||
| 664 | Ga0070679_100002050 | |||
| 665 | Ga0070679_100013603 | |||
| 666 | Ga0070679_100100453 | |||
| 667 | Ga0070679_100228746 | |||
| 668 | Ga0070679_100238982 | |||
| 669 | Ga0070684_100000365 | |||
| 670 | Ga0070684_100035412 | |||
| 671 | Ga0068853_100000523 | |||
| 672 | Ga0070672_100000709 | |||
| 673 | Ga0070686_100000455 | |||
| 674 | Ga0070695_100001044 | |||
| 675 | Ga0070696_100021689 | |||
| 676 | Ga0070696_100237412 | |||
| 677 | Ga0070693_100000905 | |||
| 678 | Ga0070693_100060132 | |||
| 679 | Ga0070665_100000327 | |||
| 680 | Ga0070665_100052141 | |||
| 681 | Ga0070665_100109298 | |||
| 682 | Ga0070665_100140598 | |||
| 683 | Ga0070704_100000197 | |||
| 684 | Ga0068855_100040932 | |||
| 685 | Ga0068855_100079840 | |||
| 686 | Ga0068855_100098430 | |||
| 687 | Ga0068855_100099582 | |||
| 688 | Ga0068855_100643262 | |||
| 689 | Ga0070664_100002074 | |||
| 690 | Ga0068857_100000921 | |||
| 691 | Ga0068857_100024980 | |||
| 692 | Ga0068854_100000749 | |||
| 693 | Ga0068854_100019836 | |||
| 694 | Ga0068856_100000902 | |||
| 695 | Ga0068856_100253827 | |||
| 696 | Ga0070702_100002928 | |||
| 697 | Ga0070702_100164471 | |||
| 698 | Ga0068852_100015241 | |||
| 699 | Ga0068852_100110867 | |||
| 700 | Ga0068859_100004450 | |||
| 701 | Ga0068859_100008773 | |||
| 702 | Ga0068859_100089758 | |||
| 703 | Ga0068864_100049073 | |||
| 704 | Ga0068866_10002012 | |||
| 705 | Ga0068861_100000825 | |||
| 706 | Ga0068870_10000112 | |||
| 707 | Ga0068863_100000703 | |||
| 708 | Ga0068863_100023806 | |||
| 709 | Ga0068858_100008283 | |||
| 710 | Ga0068858_100019588 | |||
| 711 | Ga0068860_100000165 | |||
| 712 | Ga0068860_100006736 | |||
| 713 | Ga0068860_100049862 | |||
| 714 | Ga0068860_100051115 | |||
| 715 | Ga0068860_100120534 | |||
| 716 | Ga0068862_100006290 | |||
| 717 | Ga0068862_100100949 | |||
| 718 | Ga0081455_10011886 | |||
| 719 | Ga0081540_1010346 | |||
| 720 | Ga0081540_1014849 | |||
| 721 | Ga0081540_1033560 | |||
| 722 | Ga0081540_1083756 | |||
| 723 | Ga0075368_10024712 | |||
| 724 | Ga0075363_100114362 | |||
| 725 | Ga0075364_10057532 | |||
| 726 | Ga0075364_10145686 | |||
| 727 | Ga0070716_100117379 | |||
| 728 | Ga0075362_10036225 | |||
| 729 | Ga0075369_10015948 | |||
| 730 | Ga0075366_10049965 | |||
| 731 | Ga0097621_100000473 | |||
| 732 | Ga0097621_100025204 | |||
| 733 | Ga0075370_10068039 | |||
| 734 | Ga0068871_100000118 | |||
| 735 | Ga0068871_100016676 | |||
| 736 | Ga0068871_100389850 | |||
| 737 | Ga0075428_100208791 | |||
| 738 | Ga0075430_100033350 | |||
| 739 | Ga0075431_100212332 | |||
| 740 | Ga0075431_100263706 | |||
| 741 | Ga0075434_100013398 | |||
| 742 | Ga0075434_100434097 | |||
| 743 | Ga0097620_100004450 | |||
| 744 | Ga0097620_100008773 | |||
| 745 | Ga0097620_100089759 | |||
| 746 | Ga0105240_10022758 | |||
| 747 | Ga0105240_10064698 | |||
| 748 | Ga0111539_10001167 | |||
| 749 | Ga0111539_10004804 | |||
| 750 | Ga0105245_10001982 | |||
| 751 | Ga0105245_10021615 | |||
| 752 | Ga0114129_10015418 | |||
| 753 | Ga0114129_10180395 | |||
| 754 | Ga0105243_10002278 | |||
| 755 | Ga0105243_10054499 | |||
| 756 | Ga0105241_10003555 | |||
| 757 | Ga0105242_10001156 | |||
| 758 | Ga0105248_10002414 | |||
| 759 | Ga0105248_10010454 | |||
| 760 | Ga0105248_10414399 | |||
| 761 | Ga0105238_10028630 | |||
| 762 | Ga0105249_10001021 | |||
| 763 | Ga0105249_10006960 | |||
| 764 | Ga0099796_10018054 | |||
| 765 | Ga0105239_10008950 | |||
| 766 | Ga0105239_10038202 | |||
| 767 | Ga0105246_10003701 | |||
| 768 | Ga0157326_1000541 | |||
| 769 | Ga0157373_10005579 | |||
| 770 | Ga0157373_10006895 | |||
| 771 | Ga0157373_10162181 | |||
| 772 | Ga0157371_10016850 | |||
| 773 | Ga0157371_10131676 | |||
| 774 | Ga0157369_10521336 | |||
| 775 | Ga0157374_10015941 | |||
| 776 | Ga0157378_10002986 | |||
| 777 | Ga0157378_10375921 | |||
| 778 | Ga0163162_10009522 | |||
| 779 | Ga0157372_10008348 | |||
| 780 | Ga0157375_10000508 | |||
| 781 | Ga0157375_10053915 | |||
| 782 | Ga0163163_10082125 | |||
| 783 | Ga0157380_10000212 | |||
| 784 | Ga0157377_10000287 | |||
| 785 | Ga0157379_10008690 | |||
| 786 | Ga0157379_10046080 | |||
| 787 | Ga0157376_10004642 | |||
| 788 | Ga0157376_10016040 | |||
| 789 | Ga0163161_10000415 | |||
| 790 | Ga0209258_100123 | |||
| 791 | Ga0209026_1005744 | |||
| 792 | Ga0209759_1001598 | |||
| 793 | Ga0209233_1009332 | |||
| 794 | Ga0207666_1000073 | |||
| 795 | Ga0209455_1000115 | |||
| 796 | Ga0207673_1000295 | |||
| 797 | Ga0209758_1003089 | |||
| 798 | Ga0209050_1000431 | |||
| 799 | Ga0209257_1000572 | |||
| 800 | Ga0209257_1001182 | |||
| 801 | Ga0207697_10000061 | |||
| 802 | Ga0207697_10005956 | |||
| 803 | Ga0207653_10005338 | |||
| 804 | Ga0207682_10002961 | |||
| 805 | Ga0207692_10150929 | |||
| 806 | Ga0207642_10001238 | |||
| 807 | Ga0207688_10000001 | |||
| 808 | Ga0207688_10015574 | |||
| 809 | Ga0207685_10037419 | |||
| 810 | Ga0207645_10000222 | |||
| 811 | Ga0207643_10000009 | |||
| 812 | Ga0207705_10019295 | |||
| 813 | Ga0207705_10054591 | |||
| 814 | Ga0207705_10086233 | |||
| 815 | Ga0207654_10001390 | |||
| 816 | Ga0207707_10004174 | |||
| 817 | Ga0207707_10007205 | |||
| 818 | Ga0207707_10139243 | |||
| 819 | Ga0207707_10317028 | |||
| 820 | Ga0207695_10002836 | |||
| 821 | Ga0207695_10003652 | |||
| 822 | Ga0207695_10037195 | |||
| 823 | Ga0207695_10041473 | |||
| 824 | Ga0207671_10033935 | |||
| 825 | Ga0207660_10000197 | |||
| 826 | Ga0207660_10056050 | |||
| 827 | Ga0207657_10000776 | |||
| 828 | Ga0207657_10060873 | |||
| 829 | Ga0207649_10000052 | |||
| 830 | Ga0207649_10271357 | |||
| 831 | Ga0207652_10001438 | |||
| 832 | Ga0207652_10028531 | |||
| 833 | Ga0207652_10041704 | |||
| 834 | Ga0207652_10065597 | |||
| 835 | Ga0207652_10096741 | |||
| 836 | Ga0207652_10169340 | |||
| 837 | Ga0207681_10000035 | |||
| 838 | Ga0207681_10307423 | |||
| 839 | Ga0207694_10057865 | |||
| 840 | Ga0207650_10006131 | |||
| 841 | Ga0207650_10035460 | |||
| 842 | Ga0207659_10000132 | |||
| 843 | Ga0207659_10093633 | |||
| 844 | Ga0207687_10000174 | |||
| 845 | Ga0207687_10017776 | |||
| 846 | Ga0207700_10000274 | |||
| 847 | Ga0207700_10118585 | |||
| 848 | Ga0207664_10007717 | |||
| 849 | Ga0207644_10000212 | |||
| 850 | Ga0207644_10016349 | |||
| 851 | Ga0207644_10098037 | |||
| 852 | Ga0207690_10000148 | |||
| 853 | Ga0207690_10000294 | |||
| 854 | Ga0207706_10001360 | |||
| 855 | Ga0207706_10025201 | |||
| 856 | Ga0207706_10144799 | |||
| 857 | Ga0207709_10000530 | |||
| 858 | Ga0207670_10000523 | |||
| 859 | Ga0207670_10317815 | |||
| 860 | Ga0207669_10000857 | |||
| 861 | Ga0207704_10000198 | |||
| 862 | Ga0207691_10000517 | |||
| 863 | Ga0207691_10076224 | |||
| 864 | Ga0207691_10252651 | |||
| 865 | Ga0207711_10008997 | |||
| 866 | Ga0207711_10041446 | |||
| 867 | Ga0207711_10311697 | |||
| 868 | Ga0207689_10000031 | |||
| 869 | Ga0207661_10001089 | |||
| 870 | Ga0207661_10094772 | |||
| 871 | Ga0207679_10000183 | |||
| 872 | Ga0207667_10057690 | |||
| 873 | Ga0207667_10458292 | |||
| 874 | Ga0207651_10000051 | |||
| 875 | Ga0207651_10155404 | |||
| 876 | Ga0207712_10000738 | |||
| 877 | Ga0207712_10056531 | |||
| 878 | Ga0207668_10000664 | |||
| 879 | Ga0207668_10009551 | |||
| 880 | Ga0207668_10078238 | |||
| 881 | Ga0207640_10002152 | |||
| 882 | Ga0207658_10016338 | |||
| 883 | Ga0207677_10075252 | |||
| 884 | Ga0207703_10279307 | |||
| 885 | Ga0207703_10321818 | |||
| 886 | Ga0207639_10001257 | |||
| 887 | Ga0207678_10000531 | |||
| 888 | Ga0207708_10000573 | |||
| 889 | Ga0207708_10006283 | |||
| 890 | Ga0207702_10003284 | |||
| 891 | Ga0207641_10001041 | |||
| 892 | Ga0207648_10000581 | |||
| 893 | Ga0207676_10000124 | |||
| 894 | Ga0207676_10033074 | |||
| 895 | Ga0207674_10000095 | |||
| 896 | Ga0207674_10032833 | |||
| 897 | Ga0207675_100000414 | |||
| 898 | Ga0207675_100149414 | |||
| 899 | Ga0207683_10000242 | |||
| 900 | Ga0207698_10000951 | |||
| 901 | Ga0207698_10473032 | |||
| 902 | Ga0209981_1001280 | |||
| 903 | Ga0210000_1001323 | |||
| 904 | Ga0209999_1004075 | |||
| 905 | Ga0209999_1008573 | |||
| 906 | Ga0209982_1006315 | |||
| 907 | Ga0210002_1001450 | |||
| 908 | Ga0209983_1001668 | |||
| 909 | Ga0209971_1004583 | |||
| 910 | Ga0209966_1001052 | |||
| 911 | Ga0209974_10001326 | |||
| 912 | Ga0209974_10006235 | |||
| 913 | Ga0207428_10000037 | |||
| 914 | Ga0207428_10001773 | |||
| 915 | Ga0268266_10000064 | |||
| 916 | Ga0268266_10050497 | |||
| 917 | Ga0268266_10071783 | |||
| 918 | Ga0268266_10076065 | |||
| 919 | Ga0268265_10000757 | |||
| 920 | Ga0268265_10010381 | |||
| 921 | Ga0268265_10012546 | |||
| 922 | Ga0268265_10101042 | |||
| 923 | Ga0268264_10000021 | |||
| 924 | Ga0268264_10002331 | |||
| 925 | Ga0268264_10012005 | |||
| 926 | Ga0265336_10000048 | |||
| 927 | Ga0307517_10004666 | |||
| 928 | Ga0307515_10000020 | |||
| 929 | Ga0265324_10003288 | |||
| 930 | Ga0307511_10061552 | |||
| 931 | Ga0265330_10068397 | |||
| 932 | Ga0265325_10024100 | |||
| 933 | Ga0265339_10002224 | |||
| 934 | Ga0265327_10077631 | |||
| 935 | Ga0307513_10001560 | |||
| 936 | Ga0307513_10025455 | |||
| 937 | Ga0307408_100098197 | |||
| 938 | Ga0265313_10000098 | |||
| 939 | Ga0265342_10099615 | |||
| 940 | Ga0265342_10134189 | |||
| 941 | Ga0307516_10003023 | |||
| 942 | Ga0307507_10128569 | |||
| 943 | Ga0307510_10026020 | |||
| 944 | Ga0373930_0000371 | |||
| 945 | Ga0373948_0000135 | |||
| 946 | Ga0373950_0000327 | |||
| 947 | Ga0373958_0000084 | |||
| 948 | Ga0373938_0000013 | |||
| 949 | Ga0373928_0001053 | |||
| 950 | Ga0373929_0002957 | |||
| 951 | Ga0373940_0002191 | |||
| 952 | Ga0373949_0001274 | |||
| 953 | Ga0373951_0006039 | |||
| 954 | Ga0373952_0000880 | |||
| 955 | Ga0373932_0000427 | |||
| 956 | Ga0373932_0001840 | |||
| 957 | Ga0373936_0005812 | |||
| 958 | Ga0373939_0000704 | |||
| 959 | Ga0373960_0000570 | |||
| 960 | Ga0373942_0000725 | |||
| 961 | Ga0373962_0000542 | |||
| 962 | Ga0373962_0000610 | |||
| 963 | Ga0373931_0002178 | |||
| 964 | Ga0373931_0046588 | |||
| 965 | Ga0373927_0073950 | |||
| 966 | Ga0373927_0106094 | |||
| 967 | Ga0373927_0163754 | |||
| 968 | Ga0373925_0263357 | |||
| 969 | Ga0395899_0005491 | |||
| 970 | Ga0395899_0037648 | |||
| 971 | Ga0395900_0004219 | |||
| 972 | Ga0395900_0017348 | |||
| 973 | Ga0395900_0160111 | |||
| 974 | Ga0395900_0202164 | |||
| 975 | Ga0395900_0316748 | |||
| 976 | Ga0395898_0014233 | |||
| 977 | Ga0395898_0015013 | |||
| 978 | Ga0395898_0022197 | |||
| 979 | Ga0395898_0352416 | |||
| 980 | Ga0395905_0000983 | |||
| 981 | Ga0395901_0022367 | |||
| 982 | Ga0395901_0088277 | |||
| 983 | Ga0395901_0130825 | |||
| 984 | Ga0395901_0242258 | |||
| 985 | Ga0395901_0603684 | |||
| 986 | Ga0436365_0677869 | |||
| 987 | Ga0436365_1378731 | |||
| 988 | Ga0436360_0898381 | |||
| 989 | Ga0436360_1266199 | |||
| 990 | Ga0436361_0180569 | |||
| 991 | Ga0451577_0004901 | |||
| 992 | Ga0451577_0057580 | |||
| 993 | Ga0451577_0068162 | |||
| 994 | Ga0451577_0146502 | |||
| 995 | Ga0453683_0013725 | |||
| 996 | Ga0453683_0048258 | |||
| 997 | Ga0466966_0051914 | |||
| 998 | Ga0466963_0043929 | |||
| 999 | Ga0453684_0014814 | |||
| 1000 | Ga0466957_0188578 | |||
| 1001 | Ga0451576_0006125 | |||
| 1002 | Ga0451576_0024532 | |||
| 1003 | Ga0451576_0177053 | |||
| 1004 | Ga0466967_0003577 | |||
| 1005 | Ga0495603_0097030 | |||
| 1006 | Ga0495638_0159912 | |||
| 1007 | Ga0495638_0164278 | |||
| 1008 | Ga0495639_0003100 | |||
| 1009 | Ga0495583_0000062 | |||
| 1010 | Ga0495606_0001633 | |||
| 1011 | Ga0495637_0021073 | |||
| 1012 | Ga0495637_0060757 | |||
| 1013 | Ga0495640_0007537 | |||
| 1014 | Ga0495621_0030896 | |||
| 1015 | Ga0495597_0037382 | |||
| 1016 | Ga0495668_0065197 | |||
| 1017 | Ga0495634_0054248 | |||
| 1018 | Ga0495625_0007787 | |||
| 1019 | Ga0495625_0035033 | |||
| 1020 | Ga0495659_0005240 | |||
| 1021 | Ga0495669_0000009 | |||
| 1022 | Ga0495649_0000247 | |||
| 1023 | Ga0495589_0003753 | |||
| 1024 | Ga0495674_0073619 | |||
| 1025 | Ga0495677_0069031 | |||
| 1026 | Ga0495686_0000049 | |||
| 1027 | Ga0495686_0014246 | |||
| 1028 | Ga0496101_0000866 | |||
| 1029 | Ga0496102_0001833 | |||
| 1030 | Ga0496102_0246568 | |||
| 1031 | Ga0496103_0001022 | |||
| 1032 | Ga0496107_0000118 | |||
| 1033 | Ga0496108_0006961 | |||
| 1034 | Ga0496108_0077610 | |||
| 1035 | Ga0496109_0002269 | |||
| 1036 | Ga0496109_0042716 | |||
| 1037 | Ga0496110_0156665 | |||
| 1038 | Ga0496112_0064319 | |||
| 1039 | Ga0496112_0102359 | |||
| 1040 | Ga0496113_0067850 | |||
| 1041 | Ga0496114_0372423 | |||
| 1042 | Ga0496115_0000967 | |||
| 1043 | Ga0496115_0106814 | |||
| 1044 | Ga0496126_0018874 | |||
| 1045 | Ga0501031_0222190 | |||
| 1046 | Ga0501032_0054310 | |||
| 1047 | Ga0501033_0033776 | |||
| 1048 | Ga0501034_0086892 | |||
| 1049 | Ga0501038_0149809 | |||
| 1050 | Ga0501038_0187603 | |||
| 1051 | Ga0501039_0149854 | |||
| 1052 | Ga0501043_0015687 | |||
| 1053 | Ga0501047_0000729 | |||
| 1054 | Ga0501047_0012289 | |||
| 1055 | Ga0501047_0027647 | |||
| 1056 | Ga0501047_0106554 | |||
| 1057 | Ga0501047_0109557 | |||
| 1058 | Ga0501047_0350892 | |||
| 1059 | Ga0501067_0065525 | |||
| 1060 | Ga0501067_0088263 | |||
| 1061 | Ga0501068_0021679 | |||
| 1062 | Ga0501070_0039278 | |||
| 1063 | Ga0501070_0110901 | |||
| 1064 | Ga0501072_0097662 | |||
| 1065 | Ga0501073_0027102 | |||
| 1066 | Ga0501073_0091631 | |||
| 1067 | Ga0501073_0155006 | |||
| 1068 | Ga0501074_0190975 | |||
| 1069 | Ga0501075_0114076 | |||
| 1070 | Ga0501080_0129759 | |||
| 1071 | Ga0501080_0156434 | |||
| 1072 | Ga0501083_0014143 | |||
| 1073 | Ga0501083_0088579 | |||
| 1074 | Ga0501035_0001116 | |||
| 1075 | Ga0501035_0027156 | |||
| 1076 | Ga0501035_0087906 | |||
| 1077 | Ga0501044_0000222 | |||
| 1078 | Ga0501044_0006838 | |||
| 1079 | Ga0501044_0066214 | |||
| 1080 | nmdc:mga0k408_34689_c2 | |||
| 1081 | nmdc:mga07m45_59399_c1 | |||
| 1082 | nmdc:mga0qj67_151017_c1 | |||
| 1083 | nmdc:mga06r32_115174_c1 | |||
| 1084 | nmdc:mga08y16_13712_c1 | |||
| 1085 | nmdc:mga08y16_333_c1 | |||
| 1086 | nmdc:mga0n895_62_c1 | |||
| 1087 | nmdc:mga0n895_97850_c1 | |||
| 1088 | Ga0495601_0011855 | |||
| 1089 | Ga0495595_0009473 | |||
| 1090 | Ga0495619_0025558 | |||
| 1091 | Ga0500643_004921 | |||
| 1092 | Ga0500644_0000282 | |||
| 1093 | Ga0500651_0001656 | |||
| 1094 | Ga0500641_0001396 | |||
| 1095 | Ga0500641_0008896 | |||
| 1096 | Ga0500641_0041561 | |||
| 1097 | Ga0500562_011969 | |||
| 1098 | Ga0500593_032897 | |||
| 1099 | Ga0500594_0013276 | |||
| 1100 | Ga0500595_000016 | |||
| 1101 | Ga0500642_0010511 | |||
| 1102 | Ga0500652_000024 | |||
| 1103 | Ga0500652_061781 | |||
| 1104 | Ga0500655_000102 | |||
| 1105 | Ga0500590_000159 | |||
| 1106 | Ga0500604_0012877 | |||
| 1107 | Ga0500616_0000006 | |||
| 1108 | Ga0500616_0012855 | |||
| 1109 | Ga0500616_0028109 | |||
| 1110 | Ga0500616_0092438 | |||
| 1111 | Ga0500622_0006073 | |||
| 1112 | Ga0500627_0016976 | |||
| 1113 | Ga0500570_000434 | |||
| 1114 | Ga0500645_000033 | |||
| 1115 | Ga0500645_000666 | |||
| 1116 | 2513676117 | |||
| 1117 | 2524466577 | |||
| 1118 | 2524534660 | |||
| 1119 | 2585261929 | |||
| 1120 | 2643731008 | |||
| 1121 | 2643999041 | |||
| 1122 | 2644039064 | |||
| 1123 | 2644044339 | |||
| 1124 | 2644085038 | |||
| 1125 | 2644342590 | |||
| 1126 | 2644365890 | |||
| 1127 | 2644391737 | |||
| 1128 | 2671119309 | |||
| 1129 | 2793071984 | |||
| 1130 | 2885378315 | |||
| 1131 | 2885392142 | |||
| 1132 | 2903769750 | |||
| 1133 | 2904706143 | |||
| 1134 | 2935632330 | |||
| 1135 | 2939631439 | |||
| 1136 | 2941508277 | |||
| 1137 | 2941515217 | |||
| 1138 | 2941524208 | |||
| 1139 | 8006933797 | |||
| 1140 | 8006983469 | |||
| 1141 | 8056689684 | |||
| 1142 | 8056693181 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b48-assembly1.cif.gz_D | 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai | 0.8404 | 41 | 214 |
| 5b47-assembly1.cif.gz_B-2 | 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex | 0.8043 | 34 | 221 |
| 6n2o-assembly1.cif.gz_D | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.7396 | 14 | 336 |
| 5b48-assembly1.cif.gz_B | 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai | 0.7176 | 31 | 335 |
| 6n2o-assembly1.cif.gz_D | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.7132 | 14 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58077_321_493_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6823 | 35 | 225 | 3.40.50.970 |
| af_Q2FZ04_70_219_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6698 | 90 | 237 | 3.40.50.970 |
| 3lq1A03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6673 | 39 | 214 | 3.40.50.970 |
| af_P08142_365_562_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6632 | 39 | 216 | 3.40.50.970 |
| af_Q58077_321_493_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6618 | 35 | 225 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537U0L2-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8303 | 1 | 351 |
GO:0016625
GO:0030976 GO:0044281 |
| AF-A0A537U0L2-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8278 | 1 | 351 |
GO:0016625
GO:0030976 GO:0044281 |
| AF-A0A7Y5M726-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8036 | 1 | 108 |
|
| AF-A0A3A5UYY8-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8031 | 14 | 224 |
GO:0006082
GO:0016625 GO:0030976 GO:0044272 |
| AF-A0A7C3GBX4-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.7999 | 1 | 214 |
GO:0016625
GO:0030976 GO:0044281 |