F465035

General Info

Members Datasets Scaffolds Average Seq Length
572 243 1144 295

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100198483|Ga0070669_1001984832
Length 328
Sequence VSADDVGADSAALRPPAAEGAALPSGRPSGQRAGFVQAMPWLFVLIWSTGFVVARLAMPHAPPFSFLTIRFALSAACFVIWIAIARAAWPKGRWQWFHLAVVGLSMQAAYLGGVWAAVKSGLGAGTTALLVGLQPVLTALWLTRSSEARGAAGVTTRQWLGLVLGFAGIGLVVWRKLGGEVTPANLAMATVALLGITFGTLYQKRFLAPCDVRTASAVQMAAAFVVCLPLALLETEPMDWHLNLVLAMAWSVGVLTLGGSSLLYLLIQRGAATAVTSLLYLVPPCTALMAWALFGESLTLLMMAGVALTVIGVALVVRPVDEVKERPT

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
184 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
185 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
238 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
242 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
243 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.34
Nodule 0
Rhizoplane 4.2
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100198483 3300005353 Bacteria 1577
2 JGI24740J21852_10005871 3300001979 Bacteria 5145
3 rootL2_10004022 3300003322 Bacteria 8302
4 Ga0065715_10138494 3300005293 Bacteria 1891
5 Ga0070658_10107321 3300005327 Bacteria 2311
6 Ga0070658_10220808 3300005327 Bacteria 1603
7 Ga0070676_10003761 3300005328 Bacteria 7954
8 Ga0070676_10027633 3300005328 Bacteria 3219
9 Ga0070676_10048511 3300005328 Bacteria 2483
10 Ga0070676_10192078 3300005328 Bacteria 1334
11 Ga0070683_100009726 3300005329 Bacteria 8234
12 Ga0070683_100057152 3300005329 Bacteria 3624
13 Ga0070690_100010080 3300005330 Bacteria 5486
14 Ga0070670_100015059 3300005331 Bacteria 6636
15 Ga0070670_100015740 3300005331 Bacteria 6492
16 Ga0070670_100020291 3300005331 Bacteria 5711
17 Ga0070670_100036460 3300005331 Bacteria 4232
18 Ga0070670_100054740 3300005331 Bacteria 3425
19 Ga0070670_100112408 3300005331 Bacteria 2347
20 Ga0070670_100149350 3300005331 Bacteria 2022
21 Ga0070677_10036778 3300005333 Bacteria 1906
22 Ga0070677_10041996 3300005333 Bacteria 1808
23 Ga0068869_100004104 3300005334 Bacteria 9024
24 Ga0068869_100009289 3300005334 Bacteria 6377
25 Ga0068869_100034945 3300005334 Bacteria 3559
26 Ga0068869_100164997 3300005334 Bacteria 1727
27 Ga0070666_10005027 3300005335 Bacteria 8087
28 Ga0068868_100001107 3300005338 Bacteria 18443
29 Ga0068868_100011257 3300005338 Bacteria 6515
30 Ga0068868_100083640 3300005338 Bacteria 2562
31 Ga0068868_100091066 3300005338 Bacteria 2457
32 Ga0070660_100027449 3300005339 Bacteria 4248
33 Ga0070689_100025603 3300005340 Bacteria 4434
34 Ga0070661_100019001 3300005344 Bacteria 4892
35 Ga0070661_100110923 3300005344 Bacteria 2048
36 Ga0070668_100014374 3300005347 Bacteria 5915
37 Ga0070668_100207627 3300005347 Bacteria 1610
38 Ga0070669_100002267 3300005353 Bacteria 13955
39 Ga0070669_100070407 3300005353 Bacteria 2585
40 Ga0070675_100002227 3300005354 Bacteria 14391
41 Ga0070675_100003556 3300005354 Bacteria 11835
42 Ga0070675_100018420 3300005354 Bacteria 5557
43 Ga0070675_100049735 3300005354 Bacteria 3441
44 Ga0070675_100058734 3300005354 Bacteria 3172
45 Ga0070675_100154502 3300005354 Bacteria 1969
46 Ga0070675_100161327 3300005354 Bacteria 1928
47 Ga0070671_100014404 3300005355 Bacteria 6388
48 Ga0070671_100015350 3300005355 Bacteria 6186
49 Ga0070671_100020411 3300005355 Bacteria 5404
50 Ga0070671_100063154 3300005355 Bacteria 3084
51 Ga0070671_100182144 3300005355 Bacteria 1779
52 Ga0070674_100007082 3300005356 Bacteria 6594
53 Ga0070674_100036182 3300005356 Bacteria 3311
54 Ga0070674_100067910 3300005356 Bacteria 2509
55 Ga0070674_100087366 3300005356 Bacteria 2242
56 Ga0070674_100400765 3300005356 Bacteria 1121
57 Ga0070673_100002560 3300005364 Bacteria 11099
58 Ga0070673_100005364 3300005364 Bacteria 8192
59 Ga0070673_100006243 3300005364 Bacteria 7726
60 Ga0070673_100204865 3300005364 Bacteria 1700
61 Ga0070688_100041199 3300005365 Bacteria 2833
62 Ga0070688_100137864 3300005365 Bacteria 1654
63 Ga0070659_100020941 3300005366 Bacteria 4973
64 Ga0070667_100000558 3300005367 Bacteria 36933
65 Ga0070667_100002446 3300005367 Bacteria 16231
66 Ga0070667_100006752 3300005367 Bacteria 9531
67 Ga0070667_100059333 3300005367 Bacteria 3237
68 Ga0070667_100145158 3300005367 Bacteria 2080
69 Ga0070667_100172921 3300005367 Bacteria 1908
70 Ga0070708_100149153 3300005445 Bacteria 2174
71 Ga0070708_100172891 3300005445 Bacteria 2017
72 Ga0070663_100009660 3300005455 Bacteria 5983
73 Ga0070663_100319794 3300005455 Bacteria 1247
74 Ga0070678_100001192 3300005456 Bacteria 13834
75 Ga0070678_100003107 3300005456 Bacteria 9204
76 Ga0070678_100026621 3300005456 Bacteria 3913
77 Ga0070678_100033765 3300005456 Bacteria 3556
78 Ga0070678_100093756 3300005456 Bacteria 2309
79 Ga0070678_100107369 3300005456 Bacteria 2177
80 Ga0070678_100140719 3300005456 Bacteria 1930
81 Ga0070678_100152004 3300005456 Bacteria 1866
82 Ga0070662_100002238 3300005457 Bacteria 11875
83 Ga0070662_100034511 3300005457 Bacteria 3567
84 Ga0070662_100169676 3300005457 Bacteria 1713
85 Ga0070662_100244708 3300005457 Bacteria 1440
86 Ga0070681_10085061 3300005458 Bacteria 3116
87 Ga0068867_100000048 3300005459 Bacteria 73813
88 Ga0068867_100011068 3300005459 Bacteria 6364
89 Ga0068867_100013726 3300005459 Bacteria 5737
90 Ga0068867_100016023 3300005459 Bacteria 5322
91 Ga0068867_100019175 3300005459 Bacteria 4872
92 Ga0068867_100052682 3300005459 Bacteria 3003
93 Ga0068867_100094230 3300005459 Bacteria 2276
94 Ga0070685_10024014 3300005466 Bacteria 3345
95 Ga0070706_100000774 3300005467 Bacteria 35777
96 Ga0070707_100013453 3300005468 Bacteria 7657
97 Ga0070698_100040093 3300005471 Bacteria 4815
98 Ga0070699_100285678 3300005518 Bacteria 1478
99 Ga0070679_100011754 3300005530 Bacteria 8345
100 Ga0070679_100059287 3300005530 Bacteria 3815
101 Ga0068853_100003848 3300005539 Bacteria 11497
102 Ga0068853_100021465 3300005539 Bacteria 5385
103 Ga0068853_100113834 3300005539 Bacteria 2406
104 Ga0068853_100201864 3300005539 Bacteria 1810
105 Ga0070672_100014873 3300005543 Bacteria 5525
106 Ga0070672_100015318 3300005543 Bacteria 5457
107 Ga0070672_100023074 3300005543 Bacteria 4582
108 Ga0070672_100042207 3300005543 Bacteria 3511
109 Ga0070672_100076842 3300005543 Bacteria 2668
110 Ga0070672_100219101 3300005543 Bacteria 1596
111 Ga0070686_100438367 3300005544 Bacteria 1002
112 Ga0070695_100087923 3300005545 Bacteria 2068
113 Ga0070693_100007013 3300005547 Bacteria 5487
114 Ga0070665_100002809 3300005548 Bacteria 18859
115 Ga0070665_100020551 3300005548 Bacteria 6634
116 Ga0070665_100271196 3300005548 Bacteria 1699
117 Ga0068855_100028738 3300005563 Bacteria 6653
118 Ga0068855_100030912 3300005563 Bacteria 6399
119 Ga0070664_100015244 3300005564 Bacteria 6282
120 Ga0070664_100077190 3300005564 Bacteria 2864
121 Ga0070664_100091990 3300005564 Bacteria 2626
122 Ga0070664_100151234 3300005564 Bacteria 2049
123 Ga0070664_100151346 3300005564 Bacteria 2049
124 Ga0070664_100186076 3300005564 Bacteria 1848
125 Ga0068857_100020895 3300005577 Bacteria 5759
126 Ga0068857_100033057 3300005577 Bacteria 4573
127 Ga0068857_100034604 3300005577 Bacteria 4468
128 Ga0068854_100044202 3300005578 Bacteria 3160
129 Ga0068854_100050341 3300005578 Bacteria 2980
130 Ga0068854_100108458 3300005578 Bacteria 2091
131 Ga0068856_100076962 3300005614 Bacteria 3305
132 Ga0068856_100094327 3300005614 Bacteria 2979
133 Ga0068856_100097570 3300005614 Bacteria 2928
134 Ga0068852_100002564 3300005616 Bacteria 12517
135 Ga0068852_100005377 3300005616 Bacteria 9155
136 Ga0068852_100018459 3300005616 Bacteria 5496
137 Ga0068852_100039874 3300005616 Bacteria 3957
138 Ga0068852_100106095 3300005616 Bacteria 2546
139 Ga0068852_100272059 3300005616 Bacteria 1630
140 Ga0068859_100016554 3300005617 Bacteria 7402
141 Ga0068859_100028793 3300005617 Bacteria 5570
142 Ga0068859_100048826 3300005617 Bacteria 4252
143 Ga0068864_100002807 3300005618 Bacteria 14385
144 Ga0068864_100008660 3300005618 Bacteria 8395
145 Ga0068864_100018273 3300005618 Bacteria 5855
146 Ga0068864_100020328 3300005618 Bacteria 5554
147 Ga0068866_10006943 3300005718 Bacteria 4730
148 Ga0068861_100006804 3300005719 Bacteria 7809
149 Ga0068861_100009320 3300005719 Bacteria 6775
150 Ga0068851_10004417 3300005834 Bacteria 6342
151 Ga0068851_10007694 3300005834 Bacteria 4954
152 Ga0068851_10035103 3300005834 Bacteria 2506
153 Ga0068870_10081080 3300005840 Bacteria 1794
154 Ga0068870_10125350 3300005840 Bacteria 1484
155 Ga0068863_100017712 3300005841 Bacteria 6819
156 Ga0068863_100040341 3300005841 Bacteria 4439
157 Ga0068863_100097577 3300005841 Bacteria 2790
158 Ga0068858_100002948 3300005842 Bacteria 17114
159 Ga0068858_100007615 3300005842 Bacteria 10456
160 Ga0068858_100015770 3300005842 Bacteria 7106
161 Ga0068858_100029226 3300005842 Bacteria 5117
162 Ga0068860_100010009 3300005843 Bacteria 9400
163 Ga0068860_100014939 3300005843 Bacteria 7591
164 Ga0068860_100411681 3300005843 Bacteria 1339
165 Ga0068860_100584786 3300005843 Bacteria 1121
166 Ga0068862_100033542 3300005844 Bacteria 4340
167 Ga0068862_100089601 3300005844 Bacteria 2678
168 Ga0075368_10045553 3300006042 Bacteria 1733
169 Ga0075363_100000527 3300006048 Bacteria 12335
170 Ga0075363_100033503 3300006048 Bacteria 2675
171 Ga0075364_10044341 3300006051 Bacteria 2892
172 Ga0070716_100135331 3300006173 Bacteria 1564
173 Ga0075362_10005340 3300006177 Bacteria 4694
174 Ga0075362_10008523 3300006177 Bacteria 3924
175 Ga0075362_10027164 3300006177 Bacteria 2448
176 Ga0075362_10062517 3300006177 Bacteria 1687
177 Ga0075367_10008095 3300006178 Bacteria 5427
178 Ga0075367_10014712 3300006178 Bacteria 4237
179 Ga0075366_10000121 3300006195 Bacteria 32479
180 Ga0075366_10007517 3300006195 Bacteria 6023
181 Ga0075366_10019512 3300006195 Bacteria 3924
182 Ga0075366_10060919 3300006195 Bacteria 2242
183 Ga0075366_10088261 3300006195 Bacteria 1857
184 Ga0075366_10138108 3300006195 Bacteria 1472
185 Ga0097621_100023041 3300006237 Bacteria 4842
186 Ga0097621_100053922 3300006237 Bacteria 3278
187 Ga0097621_100091208 3300006237 Bacteria 2550
188 Ga0097621_100216993 3300006237 Bacteria 1665
189 Ga0075370_10006767 3300006353 Bacteria 5792
190 Ga0075370_10008461 3300006353 Bacteria 5295
191 Ga0075370_10009708 3300006353 Bacteria 5010
192 Ga0068871_100015012 3300006358 Bacteria 5792
193 Ga0068871_100045463 3300006358 Bacteria 3534
194 Ga0068871_100053399 3300006358 Bacteria 3275
195 Ga0068871_100181401 3300006358 Bacteria 1809
196 Ga0075430_100004038 3300006846 Bacteria 12383
197 Ga0075431_100059307 3300006847 Bacteria 3950
198 Ga0068865_100015592 3300006881 Bacteria 4848
199 Ga0068865_100076369 3300006881 Bacteria 2391
200 Ga0097620_100016554 3300006931 Bacteria 7402
201 Ga0097620_100028793 3300006931 Bacteria 5570
202 Ga0097620_100048825 3300006931 Bacteria 4252
203 Ga0105240_10002994 3300009093 Bacteria 26583
204 Ga0105240_10003519 3300009093 Bacteria 24297
205 Ga0105240_10066177 3300009093 Bacteria 4484
206 Ga0105245_10010772 3300009098 Bacteria 7957
207 Ga0105245_10171517 3300009098 Bacteria 2066
208 Ga0105245_10349307 3300009098 Bacteria 1465
209 Ga0105243_10004862 3300009148 Bacteria 10548
210 Ga0105243_10032690 3300009148 Bacteria 4021
211 Ga0105243_10186790 3300009148 Bacteria 1807
212 Ga0105241_10396372 3300009174 Bacteria 1209
213 Ga0105242_10026946 3300009176 Bacteria 4559
214 Ga0105242_10588803 3300009176 Bacteria 1072
215 Ga0105248_10015811 3300009177 Bacteria 8318
216 Ga0105248_10047810 3300009177 Bacteria 4798
217 Ga0105248_10073255 3300009177 Bacteria 3849
218 Ga0105248_10156688 3300009177 Bacteria 2570
219 Ga0105248_10216044 3300009177 Bacteria 2159
220 Ga0105237_10000373 3300009545 Bacteria 63672
221 Ga0105237_10025302 3300009545 Bacteria 6072
222 Ga0105237_10058850 3300009545 Bacteria 3846
223 Ga0105238_10034361 3300009551 Bacteria 5159
224 Ga0105238_10060327 3300009551 Bacteria 3798
225 Ga0105238_10100161 3300009551 Bacteria 2881
226 Ga0105249_10112011 3300009553 Bacteria 2580
227 Ga0105249_10184195 3300009553 Bacteria 2034
228 Ga0105239_10000153 3300010375 Bacteria 99169
229 Ga0105239_10027477 3300010375 Bacteria 6264
230 Ga0105246_10064384 3300011119 Bacteria 2561
231 Ga0157373_10105018 3300013100 Bacteria 1987
232 Ga0157369_10038803 3300013105 Bacteria 5207
233 Ga0157374_10014611 3300013296 Bacteria 6871
234 Ga0157374_10077081 3300013296 Bacteria 3154
235 Ga0157374_10119941 3300013296 Bacteria 2537
236 Ga0157374_10285743 3300013296 Bacteria 1629
237 Ga0157374_10474606 3300013296 Bacteria 1254
238 Ga0157378_10105341 3300013297 Bacteria 2579
239 Ga0157378_10406372 3300013297 Bacteria 1343
240 Ga0163162_10017839 3300013306 Bacteria 6944
241 Ga0163162_10083144 3300013306 Bacteria 3275
242 Ga0163162_10110354 3300013306 Bacteria 2848
243 Ga0157372_10004940 3300013307 Bacteria 14159
244 Ga0157372_10114535 3300013307 Bacteria 3091
245 Ga0157372_10123020 3300013307 Bacteria 2982
246 Ga0157375_10022181 3300013308 Bacteria 5842
247 Ga0157375_10066799 3300013308 Bacteria 3591
248 Ga0157375_10141654 3300013308 Bacteria 2532
249 Ga0157375_10284802 3300013308 Bacteria 1816
250 Ga0157375_10296146 3300013308 Bacteria 1781
251 Ga0163163_10005658 3300014325 Bacteria 10837
252 Ga0157380_10076279 3300014326 Bacteria 2728
253 Ga0157380_10211354 3300014326 Bacteria 1729
254 Ga0157380_10211411 3300014326 Bacteria 1729
255 Ga0157377_10000056 3300014745 Bacteria 87608
256 Ga0157377_10000805 3300014745 Bacteria 12966
257 Ga0157377_10144684 3300014745 Bacteria 1464
258 Ga0157379_10003987 3300014968 Bacteria 12584
259 Ga0157379_10008560 3300014968 Bacteria 8902
260 Ga0157379_10026383 3300014968 Bacteria 5172
261 Ga0157379_10028808 3300014968 Bacteria 4938
262 Ga0157379_10275173 3300014968 Bacteria 1531
263 Ga0157379_10531654 3300014968 Bacteria 1092
264 Ga0157376_10026454 3300014969 Bacteria 4586
265 Ga0157376_10314793 3300014969 Bacteria 1486
266 Ga0183362_10001 3300015683 Bacteria 2046624
267 Ga0163161_10025431 3300017792 Bacteria 4190
268 Ga0163161_10030741 3300017792 Bacteria 3824
269 Ga0163161_10271306 3300017792 Bacteria 1328
270 Ga0163161_10357665 3300017792 Bacteria 1162
271 Ga0209257_1024893 3300025304 Bacteria 2059
272 Ga0207697_10008136 3300025315 Bacteria 4617
273 Ga0207656_10117981 3300025321 Bacteria 1233
274 Ga0207682_10004030 3300025893 Bacteria 6246
275 Ga0207682_10032112 3300025893 Bacteria 2110
276 Ga0207682_10035708 3300025893 Bacteria 2008
277 Ga0207642_10003492 3300025899 Bacteria 4964
278 Ga0207688_10022252 3300025901 Bacteria 3467
279 Ga0207680_10007763 3300025903 Bacteria 5241
280 Ga0207680_10108326 3300025903 Bacteria 1797
281 Ga0207645_10005522 3300025907 Bacteria 9160
282 Ga0207645_10015922 3300025907 Bacteria 4983
283 Ga0207645_10017863 3300025907 Bacteria 4677
284 Ga0207645_10123767 3300025907 Bacteria 1680
285 Ga0207645_10136932 3300025907 Bacteria 1595
286 Ga0207643_10073232 3300025908 Bacteria 1974
287 Ga0207643_10118162 3300025908 Bacteria 1568
288 Ga0207705_10388844 3300025909 Bacteria 1078
289 Ga0207684_10006187 3300025910 Bacteria 10933
290 Ga0207707_10222688 3300025912 Bacteria 1642
291 Ga0207695_10012332 3300025913 Bacteria 10268
292 Ga0207695_10142107 3300025913 Bacteria 2348
293 Ga0207671_10003108 3300025914 Bacteria 16882
294 Ga0207660_10002058 3300025917 Bacteria 13362
295 Ga0207662_10325194 3300025918 Bacteria 1027
296 Ga0207657_10019640 3300025919 Bacteria 6408
297 Ga0207657_10038378 3300025919 Bacteria 4264
298 Ga0207657_10043973 3300025919 Bacteria 3931
299 Ga0207649_10131540 3300025920 Bacteria 1700
300 Ga0207649_10323431 3300025920 Bacteria 1134
301 Ga0207652_10026534 3300025921 Bacteria 4826
302 Ga0207646_10013956 3300025922 Bacteria 7656
303 Ga0207681_10004661 3300025923 Bacteria 8432
304 Ga0207681_10356447 3300025923 Bacteria 1172
305 Ga0207681_10360024 3300025923 Bacteria 1166
306 Ga0207694_10035849 3300025924 Bacteria 3806
307 Ga0207694_10084996 3300025924 Bacteria 2489
308 Ga0207650_10001129 3300025925 Bacteria 19633
309 Ga0207650_10014667 3300025925 Bacteria 5445
310 Ga0207650_10020864 3300025925 Bacteria 4627
311 Ga0207650_10316698 3300025925 Bacteria 1277
312 Ga0207659_10000725 3300025926 Bacteria 19531
313 Ga0207659_10021767 3300025926 Bacteria 4262
314 Ga0207659_10028803 3300025926 Bacteria 3777
315 Ga0207659_10045089 3300025926 Bacteria 3106
316 Ga0207659_10143430 3300025926 Bacteria 1856
317 Ga0207659_10292433 3300025926 Bacteria 1335
318 Ga0207687_10029453 3300025927 Bacteria 3693
319 Ga0207644_10002875 3300025931 Bacteria 11100
320 Ga0207644_10015017 3300025931 Bacteria 5194
321 Ga0207644_10023515 3300025931 Bacteria 4222
322 Ga0207644_10026266 3300025931 Bacteria 4010
323 Ga0207644_10093758 3300025931 Bacteria 2242
324 Ga0207644_10102126 3300025931 Bacteria 2156
325 Ga0207644_10450594 3300025931 Bacteria 1057
326 Ga0207690_10170343 3300025932 Bacteria 1631
327 Ga0207706_10011173 3300025933 Bacteria 8186
328 Ga0207706_10028023 3300025933 Bacteria 5033
329 Ga0207706_10050549 3300025933 Bacteria 3673
330 Ga0207706_10061572 3300025933 Bacteria 3305
331 Ga0207706_10122303 3300025933 Bacteria 2289
332 Ga0207706_10263520 3300025933 Bacteria 1504
333 Ga0207686_10021892 3300025934 Bacteria 3675
334 Ga0207686_10166506 3300025934 Bacteria 1550
335 Ga0207709_10003289 3300025935 Bacteria 9698
336 Ga0207709_10007670 3300025935 Bacteria 5986
337 Ga0207670_10087229 3300025936 Bacteria 2198
338 Ga0207669_10006230 3300025937 Bacteria 5433
339 Ga0207669_10014094 3300025937 Bacteria 3998
340 Ga0207669_10023729 3300025937 Bacteria 3282
341 Ga0207669_10063940 3300025937 Bacteria 2274
342 Ga0207669_10134732 3300025937 Bacteria 1704
343 Ga0207704_10172012 3300025938 Bacteria 1555
344 Ga0207691_10001003 3300025940 Bacteria 28006
345 Ga0207691_10032968 3300025940 Bacteria 4826
346 Ga0207691_10039555 3300025940 Bacteria 4362
347 Ga0207691_10066609 3300025940 Bacteria 3258
348 Ga0207691_10230006 3300025940 Bacteria 1606
349 Ga0207711_10064264 3300025941 Bacteria 3169
350 Ga0207711_10074216 3300025941 Bacteria 2958
351 Ga0207711_10138781 3300025941 Bacteria 2186
352 Ga0207711_10236311 3300025941 Bacteria 1675
353 Ga0207689_10001429 3300025942 Bacteria 22803
354 Ga0207689_10005991 3300025942 Bacteria 10752
355 Ga0207689_10016929 3300025942 Bacteria 6167
356 Ga0207689_10076742 3300025942 Bacteria 2747
357 Ga0207661_10139305 3300025944 Bacteria 2086
358 Ga0207661_10215610 3300025944 Bacteria 1694
359 Ga0207679_10121815 3300025945 Bacteria 2078
360 Ga0207679_10147203 3300025945 Bacteria 1912
361 Ga0207679_10178779 3300025945 Bacteria 1753
362 Ga0207679_10211251 3300025945 Bacteria 1627
363 Ga0207679_10300825 3300025945 Bacteria 1383
364 Ga0207679_10482690 3300025945 Bacteria 1103
365 Ga0207667_10053192 3300025949 Bacteria 4261
366 Ga0207667_10177348 3300025949 Bacteria 2189
367 Ga0207651_10004166 3300025960 Bacteria 7235
368 Ga0207651_10020668 3300025960 Bacteria 3980
369 Ga0207651_10025430 3300025960 Bacteria 3679
370 Ga0207712_10077662 3300025961 Bacteria 2407
371 Ga0207712_10266027 3300025961 Bacteria 1393
372 Ga0207668_10132426 3300025972 Bacteria 1905
373 Ga0207640_10040033 3300025981 Bacteria 2971
374 Ga0207640_10078618 3300025981 Bacteria 2246
375 Ga0207658_10000412 3300025986 Bacteria 40643
376 Ga0207658_10008870 3300025986 Bacteria 6824
377 Ga0207658_10018001 3300025986 Bacteria 4870
378 Ga0207658_10021384 3300025986 Bacteria 4490
379 Ga0207658_10201732 3300025986 Bacteria 1661
380 Ga0207658_10560159 3300025986 Bacteria 1023
381 Ga0207677_10003460 3300026023 Bacteria 8367
382 Ga0207677_10067429 3300026023 Bacteria 2507
383 Ga0207677_10384818 3300026023 Bacteria 1185
384 Ga0207703_10004923 3300026035 Bacteria 10836
385 Ga0207703_10011179 3300026035 Bacteria 6985
386 Ga0207703_10018286 3300026035 Bacteria 5473
387 Ga0207703_10065298 3300026035 Bacteria 2990
388 Ga0207639_10055553 3300026041 Bacteria 3031
389 Ga0207678_10005750 3300026067 Bacteria 11064
390 Ga0207678_10393421 3300026067 Bacteria 1199
391 Ga0207702_10004115 3300026078 Bacteria 13052
392 Ga0207702_10092676 3300026078 Bacteria 2648
393 Ga0207702_10175509 3300026078 Bacteria 1969
394 Ga0207702_10502724 3300026078 Bacteria 1182
395 Ga0207641_10002951 3300026088 Bacteria 15383
396 Ga0207641_10020843 3300026088 Bacteria 5387
397 Ga0207641_10067578 3300026088 Bacteria 3062
398 Ga0207641_10125257 3300026088 Bacteria 2299
399 Ga0207641_10169892 3300026088 Bacteria 1989
400 Ga0207648_10001142 3300026089 Bacteria 29820
401 Ga0207648_10004128 3300026089 Bacteria 15023
402 Ga0207648_10010746 3300026089 Bacteria 8649
403 Ga0207648_10015727 3300026089 Bacteria 6942
404 Ga0207648_10030829 3300026089 Bacteria 4745
405 Ga0207648_10063005 3300026089 Bacteria 3232
406 Ga0207648_10076766 3300026089 Bacteria 2912
407 Ga0207648_10201255 3300026089 Bacteria 1766
408 Ga0207676_10001271 3300026095 Bacteria 18758
409 Ga0207676_10014751 3300026095 Bacteria 5629
410 Ga0207676_10046806 3300026095 Bacteria 3349
411 Ga0207676_10194569 3300026095 Bacteria 1787
412 Ga0207674_10032904 3300026116 Bacteria 5434
413 Ga0207674_10035803 3300026116 Bacteria 5179
414 Ga0207674_10036445 3300026116 Bacteria 5125
415 Ga0207675_100000814 3300026118 Bacteria 31037
416 Ga0207675_100022248 3300026118 Bacteria 5903
417 Ga0207675_100058473 3300026118 Bacteria 3597
418 Ga0207675_100623694 3300026118 Bacteria 1083
419 Ga0207683_10017025 3300026121 Bacteria 6187
420 Ga0207683_10042627 3300026121 Bacteria 3964
421 Ga0207683_10053693 3300026121 Bacteria 3533
422 Ga0207683_10056428 3300026121 Bacteria 3445
423 Ga0207683_10197426 3300026121 Bacteria 1828
424 Ga0207683_10220879 3300026121 Bacteria 1726
425 Ga0207683_10437297 3300026121 Bacteria 1206
426 Ga0207698_10489214 3300026142 Bacteria 1195
427 Ga0207698_10519784 3300026142 Bacteria 1161
428 Ga0209968_1000332 3300027526 Bacteria 7886
429 Ga0209966_1000014 3300027695 Bacteria 81913
430 Ga0268266_10137528 3300028379 Bacteria 2189
431 Ga0268265_10030668 3300028380 Bacteria 3875
432 Ga0268265_10054442 3300028380 Bacteria 3036
433 Ga0268265_10161979 3300028380 Bacteria 1901
434 Ga0268264_10005463 3300028381 Bacteria 10772
435 Ga0268264_10009954 3300028381 Bacteria 7873
436 Ga0268264_10039248 3300028381 Bacteria 3912
437 Ga0268264_10255581 3300028381 Bacteria 1630
438 Ga0268264_10367418 3300028381 Bacteria 1374
439 Ga0307517_10003097 3300028786 Bacteria 26244
440 Ga0307515_10000006 3300028794 Bacteria 725810
441 Ga0307515_10000944 3300028794 Bacteria 66492
442 Ga0307515_10087270 3300028794 Bacteria 3963
443 Ga0307515_10147107 3300028794 Bacteria 2488
444 Ga0307515_10259925 3300028794 Bacteria 1474
445 Ga0307513_10015349 3300031456 Bacteria 9288
446 Ga0307513_10025237 3300031456 Bacteria 6892
447 Ga0307513_10058530 3300031456 Bacteria 4094
448 Ga0307509_10015361 3300031507 Bacteria 8934
449 Ga0307508_10022852 3300031616 Bacteria 5682
450 Ga0307514_10000395 3300031649 Bacteria 99171
451 Ga0307514_10000823 3300031649 Bacteria 50357
452 Ga0307516_10093094 3300031730 Bacteria 2840
453 Ga0307516_10261153 3300031730 Bacteria 1422
454 Ga0307405_10052336 3300031731 Bacteria 2538
455 Ga0307405_10150484 3300031731 Bacteria 1636
456 Ga0307406_10240894 3300031901 Bacteria 1357
457 Ga0307409_100004624 3300031995 Bacteria 7773
458 Ga0307416_100022102 3300032002 Bacteria 4583
459 Ga0307416_100035014 3300032002 Bacteria 3829
460 Ga0307416_100185364 3300032002 Bacteria 1955
461 Ga0307415_100002068 3300032126 Bacteria 9920
462 Ga0307507_10184860 3300033179 Bacteria 1480
463 Ga0373932_0006153 3300035112 Bacteria 2834
464 Ga0373961_0068138 3300035241 Bacteria 1095
465 Ga0373924_0020497 3300035410 Bacteria 2571
466 Ga0373933_0252465 3300035724 Bacteria 1136
467 Ga0373937_0027901 3300036401 Bacteria 5108
468 Ga0373925_0070651 3300037068 Bacteria 2640
469 Ga0395905_0166367 3300037471 Bacteria 2072
470 Ga0395905_0221071 3300037471 Bacteria 1772
471 Ga0436365_1736074 3300039437 Bacteria 3828
472 Ga0436363_0950423 3300039450 Bacteria 3156
473 Ga0439438_028376 3300041405 Bacteria 1506
474 Ga0451789_0587567 3300041443 Bacteria 864
475 Ga0439450_021283 3300042008 Bacteria 1391
476 Ga0450898_005486 3300042134 Bacteria 1918
477 Ga0450898_012387 3300042134 Bacteria 1408
478 Ga0439459_0067557 3300042438 Bacteria 820
479 Ga0439460_0012950 3300042461 Bacteria 2174
480 Ga0451577_0042165 3300042876 Bacteria 4093
481 Ga0451577_0253740 3300042876 Bacteria 1592
482 Ga0451577_0469405 3300042876 Bacteria 1143
483 Ga0451577_0478541 3300042876 Bacteria 1130
484 Ga0466965_0038973 3300044683 Bacteria 2335
485 Ga0466965_0041846 3300044683 Bacteria 2258
486 Ga0453684_0011391 3300044712 Bacteria 14933
487 Ga0453684_0058580 3300044712 Bacteria 4974
488 Ga0453684_0067005 3300044712 Bacteria 4568
489 Ga0453684_0098914 3300044712 Bacteria 3575
490 Ga0453684_0144168 3300044712 Bacteria 2840
491 Ga0466968_0003831 3300044735 Bacteria 5581
492 Ga0451576_0005731 3300045051 Bacteria 15465
493 Ga0451576_0007989 3300045051 Bacteria 12512
494 Ga0451576_0108627 3300045051 Bacteria 2887
495 Ga0495629_0018252 3300046459 Bacteria 5024
496 Ga0495580_0109208 3300046472 Bacteria 1921
497 Ga0495642_0108249 3300046528 Bacteria 1187
498 Ga0495598_0024276 3300046537 Bacteria 1642
499 Ga0495645_0119906 3300046543 Bacteria 1853
500 Ga0495622_0091134 3300046557 Bacteria 1400
501 Ga0495625_0042152 3300046660 Bacteria 3319
502 Ga0495625_0203988 3300046660 Bacteria 1303
503 Ga0495625_0271450 3300046660 Bacteria 1094
504 Ga0495658_0023401 3300046683 Bacteria 3279
505 Ga0495658_0223891 3300046683 Bacteria 1178
506 Ga0495613_0090441 3300046689 Bacteria 2217
507 Ga0495624_0009991 3300046690 Bacteria 6557
508 Ga0495671_0124148 3300046692 Bacteria 1259
509 Ga0495676_0013187 3300047321 Bacteria 7434
510 Ga0495684_0100504 3300047471 Bacteria 2187
511 Ga0495684_0344145 3300047471 Bacteria 1060
512 Ga0495686_0073479 3300047472 Bacteria 2100
513 Ga0495593_0053638 3300047673 Bacteria 2127
514 Ga0496100_0008980 3300048903 Bacteria 5595
515 Ga0496100_0138224 3300048903 Bacteria 1724
516 Ga0496102_0131239 3300048905 Bacteria 2345
517 Ga0496104_0018814 3300048907 Bacteria 6309
518 Ga0496104_0146185 3300048907 Bacteria 2270
519 Ga0496105_0108748 3300048908 Bacteria 2289
520 Ga0496106_0020744 3300048909 Bacteria 4876
521 Ga0496107_0027251 3300048910 Bacteria 4057
522 Ga0496108_0208719 3300048911 Bacteria 1695
523 Ga0496108_0286936 3300048911 Bacteria 1433
524 Ga0496109_0101277 3300048912 Bacteria 2673
525 Ga0496109_0179633 3300048912 Bacteria 1987
526 Ga0496109_0598317 3300048912 Bacteria 1039
527 Ga0496110_0062644 3300048913 Bacteria 3285
528 Ga0496110_0809967 3300048913 Bacteria 841
529 Ga0496111_0023735 3300048914 Bacteria 4308
530 Ga0496112_0563167 3300048915 Bacteria 1073
531 Ga0496113_0013470 3300048916 Bacteria 5543
532 Ga0496114_0030514 3300048917 Bacteria 4436
533 Ga0496114_0043366 3300048917 Bacteria 3730
534 Ga0496114_0101809 3300048917 Bacteria 2453
535 Ga0496114_0170198 3300048917 Bacteria 1898
536 Ga0496115_0019008 3300048918 Bacteria 5284
537 Ga0501292_000723 3300049515 Bacteria 4000
538 Ga0501043_0001706 3300049579 Bacteria 19026
539 Ga0501046_0000132 3300049580 Bacteria 79506
540 Ga0501047_0000026 3300049581 Bacteria 225296
541 Ga0501048_0010931 3300049582 Bacteria 6770
542 Ga0501257_004846 3300049686 Bacteria 2946
543 nmdc:mga03683_19169_c1 3300050489 Bacteria 2609
544 nmdc:mga03683_19557_c1 3300050489 Bacteria 2587
545 nmdc:mga03683_26310_c1 3300050489 Bacteria 2294
546 nmdc:mga03n38_124949_c1 3300050490 Bacteria 1269
547 nmdc:mga03n38_80571_c1 3300050490 Bacteria 1529
548 nmdc:mga00v17_104236_c1 3300050491 Bacteria 1793
549 nmdc:mga0k408_17025_c1 3300050493 Bacteria 4041
550 nmdc:mga0k408_24224_c1 3300050493 Bacteria 3430
551 nmdc:mga0k408_278_c1 3300050493 Bacteria 27806
552 nmdc:mga0k408_4736_c1 3300050493 Bacteria 7209
553 nmdc:mga0k408_93973_c1 3300050493 Bacteria 1763
554 nmdc:mga06z11_6097_c1 3300050494 Bacteria 4879
555 nmdc:mga06z11_92217_c1 3300050494 Bacteria 1647
556 nmdc:mga07m45_165183_c1 3300050496 Bacteria 1286
557 nmdc:mga07m45_202_c1 3300050496 Bacteria 23538
558 nmdc:mga07m45_25701_c1 3300050496 Bacteria 3231
559 nmdc:mga07m45_50595_c1 3300050496 Bacteria 2342
560 nmdc:mga07m45_79113_c1 3300050496 Bacteria 1876
561 nmdc:mga09592_6905_c1 3300050508 Bacteria 9232
562 nmdc:mga0qj67_146302_c1 3300050509 Bacteria 1916
563 nmdc:mga06r32_69942_c1 3300050510 Bacteria 3393
564 Ga0495601_0103207 3300053077 Bacteria 1843
565 Ga0500583_0148380 3300053092 Bacteria 1167
566 Ga0500555_021566 3300053103 Bacteria 1855
567 Ga0500645_000489 3300053730 Bacteria 26784
568 Ga0500645_000501 3300053730 Bacteria 26443
569 Ga0501082_0138674 3300060353 Bacteria 2111
570 2644304743 2643221654 Bacteria 5273570
571 2919705311 2919704043 Bacteria 5560311
572 8048747076 8048746797 Bacteria 3557226
573 Ga0070669_100198483
574 JGI24740J21852_10005871
575 rootL2_10004022
576 Ga0065715_10138494
577 Ga0070658_10107321
578 Ga0070658_10220808
579 Ga0070676_10003761
580 Ga0070676_10027633
581 Ga0070676_10048511
582 Ga0070676_10192078
583 Ga0070683_100009726
584 Ga0070683_100057152
585 Ga0070690_100010080
586 Ga0070670_100015059
587 Ga0070670_100015740
588 Ga0070670_100020291
589 Ga0070670_100036460
590 Ga0070670_100054740
591 Ga0070670_100112408
592 Ga0070670_100149350
593 Ga0070677_10036778
594 Ga0070677_10041996
595 Ga0068869_100004104
596 Ga0068869_100009289
597 Ga0068869_100034945
598 Ga0068869_100164997
599 Ga0070666_10005027
600 Ga0068868_100001107
601 Ga0068868_100011257
602 Ga0068868_100083640
603 Ga0068868_100091066
604 Ga0070660_100027449
605 Ga0070689_100025603
606 Ga0070661_100019001
607 Ga0070661_100110923
608 Ga0070668_100014374
609 Ga0070668_100207627
610 Ga0070669_100002267
611 Ga0070669_100070407
612 Ga0070675_100002227
613 Ga0070675_100003556
614 Ga0070675_100018420
615 Ga0070675_100049735
616 Ga0070675_100058734
617 Ga0070675_100154502
618 Ga0070675_100161327
619 Ga0070671_100014404
620 Ga0070671_100015350
621 Ga0070671_100020411
622 Ga0070671_100063154
623 Ga0070671_100182144
624 Ga0070674_100007082
625 Ga0070674_100036182
626 Ga0070674_100067910
627 Ga0070674_100087366
628 Ga0070674_100400765
629 Ga0070673_100002560
630 Ga0070673_100005364
631 Ga0070673_100006243
632 Ga0070673_100204865
633 Ga0070688_100041199
634 Ga0070688_100137864
635 Ga0070659_100020941
636 Ga0070667_100000558
637 Ga0070667_100002446
638 Ga0070667_100006752
639 Ga0070667_100059333
640 Ga0070667_100145158
641 Ga0070667_100172921
642 Ga0070708_100149153
643 Ga0070708_100172891
644 Ga0070663_100009660
645 Ga0070663_100319794
646 Ga0070678_100001192
647 Ga0070678_100003107
648 Ga0070678_100026621
649 Ga0070678_100033765
650 Ga0070678_100093756
651 Ga0070678_100107369
652 Ga0070678_100140719
653 Ga0070678_100152004
654 Ga0070662_100002238
655 Ga0070662_100034511
656 Ga0070662_100169676
657 Ga0070662_100244708
658 Ga0070681_10085061
659 Ga0068867_100000048
660 Ga0068867_100011068
661 Ga0068867_100013726
662 Ga0068867_100016023
663 Ga0068867_100019175
664 Ga0068867_100052682
665 Ga0068867_100094230
666 Ga0070685_10024014
667 Ga0070706_100000774
668 Ga0070707_100013453
669 Ga0070698_100040093
670 Ga0070699_100285678
671 Ga0070679_100011754
672 Ga0070679_100059287
673 Ga0068853_100003848
674 Ga0068853_100021465
675 Ga0068853_100113834
676 Ga0068853_100201864
677 Ga0070672_100014873
678 Ga0070672_100015318
679 Ga0070672_100023074
680 Ga0070672_100042207
681 Ga0070672_100076842
682 Ga0070672_100219101
683 Ga0070686_100438367
684 Ga0070695_100087923
685 Ga0070693_100007013
686 Ga0070665_100002809
687 Ga0070665_100020551
688 Ga0070665_100271196
689 Ga0068855_100028738
690 Ga0068855_100030912
691 Ga0070664_100015244
692 Ga0070664_100077190
693 Ga0070664_100091990
694 Ga0070664_100151234
695 Ga0070664_100151346
696 Ga0070664_100186076
697 Ga0068857_100020895
698 Ga0068857_100033057
699 Ga0068857_100034604
700 Ga0068854_100044202
701 Ga0068854_100050341
702 Ga0068854_100108458
703 Ga0068856_100076962
704 Ga0068856_100094327
705 Ga0068856_100097570
706 Ga0068852_100002564
707 Ga0068852_100005377
708 Ga0068852_100018459
709 Ga0068852_100039874
710 Ga0068852_100106095
711 Ga0068852_100272059
712 Ga0068859_100016554
713 Ga0068859_100028793
714 Ga0068859_100048826
715 Ga0068864_100002807
716 Ga0068864_100008660
717 Ga0068864_100018273
718 Ga0068864_100020328
719 Ga0068866_10006943
720 Ga0068861_100006804
721 Ga0068861_100009320
722 Ga0068851_10004417
723 Ga0068851_10007694
724 Ga0068851_10035103
725 Ga0068870_10081080
726 Ga0068870_10125350
727 Ga0068863_100017712
728 Ga0068863_100040341
729 Ga0068863_100097577
730 Ga0068858_100002948
731 Ga0068858_100007615
732 Ga0068858_100015770
733 Ga0068858_100029226
734 Ga0068860_100010009
735 Ga0068860_100014939
736 Ga0068860_100411681
737 Ga0068860_100584786
738 Ga0068862_100033542
739 Ga0068862_100089601
740 Ga0075368_10045553
741 Ga0075363_100000527
742 Ga0075363_100033503
743 Ga0075364_10044341
744 Ga0070716_100135331
745 Ga0075362_10005340
746 Ga0075362_10008523
747 Ga0075362_10027164
748 Ga0075362_10062517
749 Ga0075367_10008095
750 Ga0075367_10014712
751 Ga0075366_10000121
752 Ga0075366_10007517
753 Ga0075366_10019512
754 Ga0075366_10060919
755 Ga0075366_10088261
756 Ga0075366_10138108
757 Ga0097621_100023041
758 Ga0097621_100053922
759 Ga0097621_100091208
760 Ga0097621_100216993
761 Ga0075370_10006767
762 Ga0075370_10008461
763 Ga0075370_10009708
764 Ga0068871_100015012
765 Ga0068871_100045463
766 Ga0068871_100053399
767 Ga0068871_100181401
768 Ga0075430_100004038
769 Ga0075431_100059307
770 Ga0068865_100015592
771 Ga0068865_100076369
772 Ga0097620_100016554
773 Ga0097620_100028793
774 Ga0097620_100048825
775 Ga0105240_10002994
776 Ga0105240_10003519
777 Ga0105240_10066177
778 Ga0105245_10010772
779 Ga0105245_10171517
780 Ga0105245_10349307
781 Ga0105243_10004862
782 Ga0105243_10032690
783 Ga0105243_10186790
784 Ga0105241_10396372
785 Ga0105242_10026946
786 Ga0105242_10588803
787 Ga0105248_10015811
788 Ga0105248_10047810
789 Ga0105248_10073255
790 Ga0105248_10156688
791 Ga0105248_10216044
792 Ga0105237_10000373
793 Ga0105237_10025302
794 Ga0105237_10058850
795 Ga0105238_10034361
796 Ga0105238_10060327
797 Ga0105238_10100161
798 Ga0105249_10112011
799 Ga0105249_10184195
800 Ga0105239_10000153
801 Ga0105239_10027477
802 Ga0105246_10064384
803 Ga0157373_10105018
804 Ga0157369_10038803
805 Ga0157374_10014611
806 Ga0157374_10077081
807 Ga0157374_10119941
808 Ga0157374_10285743
809 Ga0157374_10474606
810 Ga0157378_10105341
811 Ga0157378_10406372
812 Ga0163162_10017839
813 Ga0163162_10083144
814 Ga0163162_10110354
815 Ga0157372_10004940
816 Ga0157372_10114535
817 Ga0157372_10123020
818 Ga0157375_10022181
819 Ga0157375_10066799
820 Ga0157375_10141654
821 Ga0157375_10284802
822 Ga0157375_10296146
823 Ga0163163_10005658
824 Ga0157380_10076279
825 Ga0157380_10211354
826 Ga0157380_10211411
827 Ga0157377_10000056
828 Ga0157377_10000805
829 Ga0157377_10144684
830 Ga0157379_10003987
831 Ga0157379_10008560
832 Ga0157379_10026383
833 Ga0157379_10028808
834 Ga0157379_10275173
835 Ga0157379_10531654
836 Ga0157376_10026454
837 Ga0157376_10314793
838 Ga0183362_10001
839 Ga0163161_10025431
840 Ga0163161_10030741
841 Ga0163161_10271306
842 Ga0163161_10357665
843 Ga0209257_1024893
844 Ga0207697_10008136
845 Ga0207656_10117981
846 Ga0207682_10004030
847 Ga0207682_10032112
848 Ga0207682_10035708
849 Ga0207642_10003492
850 Ga0207688_10022252
851 Ga0207680_10007763
852 Ga0207680_10108326
853 Ga0207645_10005522
854 Ga0207645_10015922
855 Ga0207645_10017863
856 Ga0207645_10123767
857 Ga0207645_10136932
858 Ga0207643_10073232
859 Ga0207643_10118162
860 Ga0207705_10388844
861 Ga0207684_10006187
862 Ga0207707_10222688
863 Ga0207695_10012332
864 Ga0207695_10142107
865 Ga0207671_10003108
866 Ga0207660_10002058
867 Ga0207662_10325194
868 Ga0207657_10019640
869 Ga0207657_10038378
870 Ga0207657_10043973
871 Ga0207649_10131540
872 Ga0207649_10323431
873 Ga0207652_10026534
874 Ga0207646_10013956
875 Ga0207681_10004661
876 Ga0207681_10356447
877 Ga0207681_10360024
878 Ga0207694_10035849
879 Ga0207694_10084996
880 Ga0207650_10001129
881 Ga0207650_10014667
882 Ga0207650_10020864
883 Ga0207650_10316698
884 Ga0207659_10000725
885 Ga0207659_10021767
886 Ga0207659_10028803
887 Ga0207659_10045089
888 Ga0207659_10143430
889 Ga0207659_10292433
890 Ga0207687_10029453
891 Ga0207644_10002875
892 Ga0207644_10015017
893 Ga0207644_10023515
894 Ga0207644_10026266
895 Ga0207644_10093758
896 Ga0207644_10102126
897 Ga0207644_10450594
898 Ga0207690_10170343
899 Ga0207706_10011173
900 Ga0207706_10028023
901 Ga0207706_10050549
902 Ga0207706_10061572
903 Ga0207706_10122303
904 Ga0207706_10263520
905 Ga0207686_10021892
906 Ga0207686_10166506
907 Ga0207709_10003289
908 Ga0207709_10007670
909 Ga0207670_10087229
910 Ga0207669_10006230
911 Ga0207669_10014094
912 Ga0207669_10023729
913 Ga0207669_10063940
914 Ga0207669_10134732
915 Ga0207704_10172012
916 Ga0207691_10001003
917 Ga0207691_10032968
918 Ga0207691_10039555
919 Ga0207691_10066609
920 Ga0207691_10230006
921 Ga0207711_10064264
922 Ga0207711_10074216
923 Ga0207711_10138781
924 Ga0207711_10236311
925 Ga0207689_10001429
926 Ga0207689_10005991
927 Ga0207689_10016929
928 Ga0207689_10076742
929 Ga0207661_10139305
930 Ga0207661_10215610
931 Ga0207679_10121815
932 Ga0207679_10147203
933 Ga0207679_10178779
934 Ga0207679_10211251
935 Ga0207679_10300825
936 Ga0207679_10482690
937 Ga0207667_10053192
938 Ga0207667_10177348
939 Ga0207651_10004166
940 Ga0207651_10020668
941 Ga0207651_10025430
942 Ga0207712_10077662
943 Ga0207712_10266027
944 Ga0207668_10132426
945 Ga0207640_10040033
946 Ga0207640_10078618
947 Ga0207658_10000412
948 Ga0207658_10008870
949 Ga0207658_10018001
950 Ga0207658_10021384
951 Ga0207658_10201732
952 Ga0207658_10560159
953 Ga0207677_10003460
954 Ga0207677_10067429
955 Ga0207677_10384818
956 Ga0207703_10004923
957 Ga0207703_10011179
958 Ga0207703_10018286
959 Ga0207703_10065298
960 Ga0207639_10055553
961 Ga0207678_10005750
962 Ga0207678_10393421
963 Ga0207702_10004115
964 Ga0207702_10092676
965 Ga0207702_10175509
966 Ga0207702_10502724
967 Ga0207641_10002951
968 Ga0207641_10020843
969 Ga0207641_10067578
970 Ga0207641_10125257
971 Ga0207641_10169892
972 Ga0207648_10001142
973 Ga0207648_10004128
974 Ga0207648_10010746
975 Ga0207648_10015727
976 Ga0207648_10030829
977 Ga0207648_10063005
978 Ga0207648_10076766
979 Ga0207648_10201255
980 Ga0207676_10001271
981 Ga0207676_10014751
982 Ga0207676_10046806
983 Ga0207676_10194569
984 Ga0207674_10032904
985 Ga0207674_10035803
986 Ga0207674_10036445
987 Ga0207675_100000814
988 Ga0207675_100022248
989 Ga0207675_100058473
990 Ga0207675_100623694
991 Ga0207683_10017025
992 Ga0207683_10042627
993 Ga0207683_10053693
994 Ga0207683_10056428
995 Ga0207683_10197426
996 Ga0207683_10220879
997 Ga0207683_10437297
998 Ga0207698_10489214
999 Ga0207698_10519784
1000 Ga0209968_1000332
1001 Ga0209966_1000014
1002 Ga0268266_10137528
1003 Ga0268265_10030668
1004 Ga0268265_10054442
1005 Ga0268265_10161979
1006 Ga0268264_10005463
1007 Ga0268264_10009954
1008 Ga0268264_10039248
1009 Ga0268264_10255581
1010 Ga0268264_10367418
1011 Ga0307517_10003097
1012 Ga0307515_10000006
1013 Ga0307515_10000944
1014 Ga0307515_10087270
1015 Ga0307515_10147107
1016 Ga0307515_10259925
1017 Ga0307513_10015349
1018 Ga0307513_10025237
1019 Ga0307513_10058530
1020 Ga0307509_10015361
1021 Ga0307508_10022852
1022 Ga0307514_10000395
1023 Ga0307514_10000823
1024 Ga0307516_10093094
1025 Ga0307516_10261153
1026 Ga0307405_10052336
1027 Ga0307405_10150484
1028 Ga0307406_10240894
1029 Ga0307409_100004624
1030 Ga0307416_100022102
1031 Ga0307416_100035014
1032 Ga0307416_100185364
1033 Ga0307415_100002068
1034 Ga0307507_10184860
1035 Ga0373932_0006153
1036 Ga0373961_0068138
1037 Ga0373924_0020497
1038 Ga0373933_0252465
1039 Ga0373937_0027901
1040 Ga0373925_0070651
1041 Ga0395905_0166367
1042 Ga0395905_0221071
1043 Ga0436365_1736074
1044 Ga0436363_0950423
1045 Ga0439438_028376
1046 Ga0451789_0587567
1047 Ga0439450_021283
1048 Ga0450898_005486
1049 Ga0450898_012387
1050 Ga0439459_0067557
1051 Ga0439460_0012950
1052 Ga0451577_0042165
1053 Ga0451577_0253740
1054 Ga0451577_0469405
1055 Ga0451577_0478541
1056 Ga0466965_0038973
1057 Ga0466965_0041846
1058 Ga0453684_0011391
1059 Ga0453684_0058580
1060 Ga0453684_0067005
1061 Ga0453684_0098914
1062 Ga0453684_0144168
1063 Ga0466968_0003831
1064 Ga0451576_0005731
1065 Ga0451576_0007989
1066 Ga0451576_0108627
1067 Ga0495629_0018252
1068 Ga0495580_0109208
1069 Ga0495642_0108249
1070 Ga0495598_0024276
1071 Ga0495645_0119906
1072 Ga0495622_0091134
1073 Ga0495625_0042152
1074 Ga0495625_0203988
1075 Ga0495625_0271450
1076 Ga0495658_0023401
1077 Ga0495658_0223891
1078 Ga0495613_0090441
1079 Ga0495624_0009991
1080 Ga0495671_0124148
1081 Ga0495676_0013187
1082 Ga0495684_0100504
1083 Ga0495684_0344145
1084 Ga0495686_0073479
1085 Ga0495593_0053638
1086 Ga0496100_0008980
1087 Ga0496100_0138224
1088 Ga0496102_0131239
1089 Ga0496104_0018814
1090 Ga0496104_0146185
1091 Ga0496105_0108748
1092 Ga0496106_0020744
1093 Ga0496107_0027251
1094 Ga0496108_0208719
1095 Ga0496108_0286936
1096 Ga0496109_0101277
1097 Ga0496109_0179633
1098 Ga0496109_0598317
1099 Ga0496110_0062644
1100 Ga0496110_0809967
1101 Ga0496111_0023735
1102 Ga0496112_0563167
1103 Ga0496113_0013470
1104 Ga0496114_0030514
1105 Ga0496114_0043366
1106 Ga0496114_0101809
1107 Ga0496114_0170198
1108 Ga0496115_0019008
1109 Ga0501292_000723
1110 Ga0501043_0001706
1111 Ga0501046_0000132
1112 Ga0501047_0000026
1113 Ga0501048_0010931
1114 Ga0501257_004846
1115 nmdc:mga03683_19169_c1
1116 nmdc:mga03683_19557_c1
1117 nmdc:mga03683_26310_c1
1118 nmdc:mga03n38_124949_c1
1119 nmdc:mga03n38_80571_c1
1120 nmdc:mga00v17_104236_c1
1121 nmdc:mga0k408_17025_c1
1122 nmdc:mga0k408_24224_c1
1123 nmdc:mga0k408_278_c1
1124 nmdc:mga0k408_4736_c1
1125 nmdc:mga0k408_93973_c1
1126 nmdc:mga06z11_6097_c1
1127 nmdc:mga06z11_92217_c1
1128 nmdc:mga07m45_165183_c1
1129 nmdc:mga07m45_202_c1
1130 nmdc:mga07m45_25701_c1
1131 nmdc:mga07m45_50595_c1
1132 nmdc:mga07m45_79113_c1
1133 nmdc:mga09592_6905_c1
1134 nmdc:mga0qj67_146302_c1
1135 nmdc:mga06r32_69942_c1
1136 Ga0495601_0103207
1137 Ga0500583_0148380
1138 Ga0500555_021566
1139 Ga0500645_000489
1140 Ga0500645_000501
1141 Ga0501082_0138674
1142 2644304743
1143 2919705311
1144 8048747076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

183

318

0.94

PF00892

EamA

EamA-like transporter family

39

174

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly1.cif.gz_A crystal structure of protein 0.8498 8 293
5i20-assembly2.cif.gz_B crystal structure of protein 0.8436 9 293
5i20-assembly4.cif.gz_D crystal structure of protein 0.8271 9 292
7b0k-assembly1.cif.gz_A membrane protein structure 0.8266 13 294
5i20-assembly1.cif.gz_A crystal structure of protein 0.8203 8 293
ID Description Score Start End Superfamily
af_I1MX93_4_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8458 216 292 1.10.3730.20
af_C6S3G0_14_136_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7816 219 293 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7546 211 292 1.10.3730.20
af_Q8RWH8_5_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7181 210 292 1.10.3730.20
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6929 13 292 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A1I4RNH7-F1-model_v4 Uncharacterized membrane protein 0.9818 5 294 GO:0016020
AF-A0A7G8VZL8-F1-model_v4 DMT family transporter 0.9789 3 294 GO:0016020
AF-A0A844API9-F1-model_v4 EamA family transporter 0.9766 1 297 GO:0016020
AF-A0A7X6DDE1-F1-model_v4 DMT family transporter 0.976 14 296 GO:0016020
AF-A0A1H4BHL8-F1-model_v4 Permease of the drug/metabolite transporter (DMT) superfamily 0.974 1 297 GO:0016020

Map