F465065

General Info

Members Datasets Scaffolds Average Seq Length
572 312 1142 235

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10369211|Ga0114129_103692112
Length 281
Sequence MQRAQTLARAARRQRDRELENWIHEFGDLWTFFNTTPTGMLSPMIDLYFSPTPNGLKLKLFFEESGLPHRVLPVRLSQGEQFKPEFLAISPNNKIPALVDHAPADGGEPLAMFESGAMLLYLAQKIGRFLPHGPRAMGELMQWLFWQVGGLGPMAGQNGHFTAHAPEKLPYAIERYTRETNRLYGVLDRRLAGRDYIVGSDYSIADMACYPWIVPHRSHGQDLQQFPHLARWFARIAARPATQRAYVGVQDAYAPSAQALSDEARRALFGQTSATSGSPSR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
165 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
236 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
269 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
270 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
285 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
291 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
296 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
297 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
298 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
299 2643221559 Lysobacter sp. Root559 Isolate Unclassified
300 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
301 2643221573 Lysobacter sp. Root604 Isolate Unclassified
302 2643221586 Lysobacter sp. Root667 Isolate Unclassified
303 2643221612 Lysobacter sp. Root76 Isolate Unclassified
304 2643221695 Lysobacter sp. Root494 Isolate Unclassified
305 2643221720 Lysobacter sp. Root916 Isolate Unclassified
306 2643221727 Lysobacter sp. Root96 Isolate Unclassified
307 2643221728 Lysobacter sp. Root983 Isolate Unclassified
308 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
309 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
310 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
311 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
312 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0.35
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0.17
Rhizoplane 8.57
Rhizosphere 77.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10369211 3300009147 Bacteria 1897
2 JGI24741J21665_1006124 3300001915 Bacteria 2449
3 JGI24735J21928_10068943 3300002067 Bacteria 1014
4 JGI24735J21928_10073514 3300002067 Bacteria 979
5 JGI25153J46596_10051962 3300003215 Bacteria 1170
6 rootH2_10040930 3300003320 Bacteria 9788
7 JGI25160J50197_1000208 3300003354 Bacteria 48426
8 Ga0006562J51391_1117239 3300003578 Bacteria 4133
9 Ga0055535_1000480 3300003761 Bacteria 36096
10 Ga0055542_1000498 3300003762 Bacteria 36096
11 Ga0065165_1000119 3300005262 Bacteria 134464
12 Ga0065714_10064584 3300005288 Bacteria 32069
13 Ga0070676_10052441 3300005328 Bacteria 2398
14 Ga0070676_10090935 3300005328 Bacteria 1869
15 Ga0070683_100436854 3300005329 Bacteria 1249
16 Ga0070683_100520267 3300005329 Bacteria 1137
17 Ga0070670_100449375 3300005331 Bacteria 1142
18 Ga0068869_100056780 3300005334 Bacteria 2856
19 Ga0068869_100081067 3300005334 Bacteria 2423
20 Ga0068869_100129853 3300005334 Bacteria 1936
21 Ga0070666_10089653 3300005335 Bacteria 2111
22 Ga0070682_100499447 3300005337 Bacteria 942
23 Ga0068868_100105906 3300005338 Bacteria 2281
24 Ga0070660_100162258 3300005339 Bacteria 1801
25 Ga0070689_100066378 3300005340 Bacteria 2811
26 Ga0070668_100014694 3300005347 Bacteria 5851
27 Ga0070668_100066227 3300005347 Bacteria 2803
28 Ga0070668_100075258 3300005347 Bacteria 2636
29 Ga0070668_100290784 3300005347 Bacteria 1368
30 Ga0070669_100002673 3300005353 Bacteria 12838
31 Ga0070669_100063099 3300005353 Bacteria 2726
32 Ga0070669_100063183 3300005353 Bacteria 2725
33 Ga0070675_100063084 3300005354 Bacteria 3063
34 Ga0070671_100150090 3300005355 Bacteria 1968
35 Ga0070673_100085091 3300005364 Bacteria 2573
36 Ga0070667_100087564 3300005367 Bacteria 2673
37 Ga0070667_100148812 3300005367 Bacteria 2055
38 Ga0070709_10294781 3300005434 Bacteria 1183
39 Ga0070700_100047517 3300005441 Bacteria 2656
40 Ga0070663_100015745 3300005455 Bacteria 4891
41 Ga0070663_100047590 3300005455 Bacteria 3038
42 Ga0070663_100102577 3300005455 Bacteria 2137
43 Ga0070663_100114402 3300005455 Bacteria 2031
44 Ga0070663_100120811 3300005455 Bacteria 1979
45 Ga0070663_100317809 3300005455 Bacteria 1251
46 Ga0070678_100183402 3300005456 Bacteria 1715
47 Ga0070662_100048167 3300005457 Bacteria 3069
48 Ga0070662_100057900 3300005457 Bacteria 2817
49 Ga0070681_10040601 3300005458 Bacteria 4661
50 Ga0068867_100000977 3300005459 Bacteria 19533
51 Ga0070698_100229368 3300005471 Bacteria 1790
52 Ga0070698_100312159 3300005471 Bacteria 1503
53 Ga0068853_100011346 3300005539 Bacteria 7237
54 Ga0068853_100012222 3300005539 Bacteria 6981
55 Ga0068853_100083468 3300005539 Bacteria 2799
56 Ga0070672_100004832 3300005543 Bacteria 8856
57 Ga0070672_100093733 3300005543 Bacteria 2426
58 Ga0070672_100286340 3300005543 Bacteria 1394
59 Ga0070696_100034236 3300005546 Bacteria 3494
60 Ga0070665_100012782 3300005548 Bacteria 8458
61 Ga0070665_100235937 3300005548 Bacteria 1829
62 Ga0070665_100259614 3300005548 Bacteria 1739
63 Ga0070665_100286650 3300005548 Bacteria 1649
64 Ga0070665_100806840 3300005548 Bacteria 951
65 Ga0068855_100006688 3300005563 Bacteria 13999
66 Ga0068855_100036599 3300005563 Bacteria 5840
67 Ga0068855_100048401 3300005563 Bacteria 5017
68 Ga0068855_100232030 3300005563 Bacteria 2066
69 Ga0068855_100393111 3300005563 Bacteria 1521
70 Ga0068857_100001325 3300005577 Bacteria 19451
71 Ga0068857_100018771 3300005577 Bacteria 6067
72 Ga0068857_100055534 3300005577 Bacteria 3515
73 Ga0068854_100005095 3300005578 Bacteria 8278
74 Ga0068854_100037766 3300005578 Bacteria 3391
75 Ga0068856_100079863 3300005614 Bacteria 3244
76 Ga0068852_100141840 3300005616 Bacteria 2224
77 Ga0068852_100211265 3300005616 Bacteria 1841
78 Ga0068852_100226744 3300005616 Bacteria 1779
79 Ga0068852_100297830 3300005616 Bacteria 1560
80 Ga0068859_100000070 3300005617 Bacteria 94311
81 Ga0068859_101021260 3300005617 Bacteria 908
82 Ga0068861_100015016 3300005719 Bacteria 5448
83 Ga0068851_10001014 3300005834 Bacteria 12181
84 Ga0068851_10026033 3300005834 Bacteria 2872
85 Ga0068870_10021051 3300005840 Bacteria 3185
86 Ga0068863_100005629 3300005841 Bacteria 12309
87 Ga0068863_100222800 3300005841 Bacteria 1818
88 Ga0068858_100095249 3300005842 Bacteria 2773
89 Ga0068860_100287451 3300005843 Bacteria 1608
90 Ga0068860_100327298 3300005843 Bacteria 1505
91 Ga0068862_100000041 3300005844 Bacteria 166801
92 Ga0068862_100000722 3300005844 Bacteria 33471
93 Ga0068862_100001530 3300005844 Bacteria 21160
94 Ga0081455_10051486 3300005937 Bacteria 3532
95 Ga0081540_1010382 3300005983 Bacteria 6313
96 Ga0070717_10065536 3300006028 Bacteria 3020
97 Ga0075366_10083227 3300006195 Bacteria 1912
98 Ga0075366_10301756 3300006195 Bacteria 980
99 Ga0097621_100048825 3300006237 Bacteria 3436
100 Ga0097621_100133458 3300006237 Bacteria 2115
101 Ga0068871_100266435 3300006358 Bacteria 1496
102 Ga0068871_100373900 3300006358 Bacteria 1265
103 Ga0068871_100629097 3300006358 Bacteria 978
104 Ga0075428_100007767 3300006844 Bacteria 11888
105 Ga0075430_100000458 3300006846 Bacteria 30423
106 Ga0075430_100011525 3300006846 Bacteria 7514
107 Ga0075430_100013283 3300006846 Bacteria 7020
108 Ga0075431_100000243 3300006847 Bacteria 41087
109 Ga0075431_100000267 3300006847 Bacteria 40345
110 Ga0075431_100003216 3300006847 Bacteria 15805
111 Ga0075431_100008297 3300006847 Bacteria 10388
112 Ga0075429_100000445 3300006880 Bacteria 30747
113 Ga0075429_100001924 3300006880 Bacteria 17218
114 Ga0075429_100085573 3300006880 Bacteria 2748
115 Ga0075429_100341034 3300006880 Bacteria 1312
116 Ga0068865_100005556 3300006881 Bacteria 7646
117 Ga0068865_100008801 3300006881 Bacteria 6242
118 Ga0068865_100245651 3300006881 Bacteria 1410
119 Ga0097620_100000070 3300006931 Bacteria 94311
120 Ga0097620_101021339 3300006931 Bacteria 908
121 Ga0105240_10001295 3300009093 Bacteria 43234
122 Ga0105240_10016935 3300009093 Bacteria 9851
123 Ga0105240_10050609 3300009093 Bacteria 5236
124 Ga0105240_10073268 3300009093 Bacteria 4229
125 Ga0111539_10000989 3300009094 Bacteria 37233
126 Ga0111539_10041545 3300009094 Bacteria 5528
127 Ga0105247_10048258 3300009101 Bacteria 2615
128 Ga0105247_10074639 3300009101 Bacteria 2127
129 Ga0114129_10001320 3300009147 Bacteria 33176
130 Ga0114129_10029160 3300009147 Bacteria 7818
131 Ga0114129_10279423 3300009147 Bacteria 2231
132 Ga0114129_10528959 3300009147 Bacteria 1536
133 Ga0105243_10002995 3300009148 Bacteria 13953
134 Ga0105248_10248344 3300009177 Bacteria 2003
135 Ga0105237_10000058 3300009545 Bacteria 146943
136 Ga0105237_10127701 3300009545 Bacteria 2537
137 Ga0105238_10169745 3300009551 Bacteria 2157
138 Ga0105238_10417804 3300009551 Bacteria 1335
139 Ga0105238_10661953 3300009551 Bacteria 1055
140 Ga0105249_10000015 3300009553 Bacteria 282138
141 Ga0105249_10028396 3300009553 Bacteria 5049
142 Ga0105032_101076 3300009979 Bacteria 2541
143 Ga0105239_10001092 3300010375 Bacteria 37501
144 Ga0105239_10041475 3300010375 Bacteria 5044
145 Ga0105239_10054456 3300010375 Bacteria 4388
146 Ga0105239_10169198 3300010375 Bacteria 2443
147 Ga0105239_10238031 3300010375 Bacteria 2043
148 Ga0105246_10081279 3300011119 Bacteria 2309
149 Ga0105246_10518216 3300011119 Bacteria 1016
150 Ga0157320_1004295 3300012481 Bacteria 904
151 Ga0157369_10044126 3300013105 Bacteria 4855
152 Ga0157374_10014689 3300013296 Bacteria 6855
153 Ga0157372_10104556 3300013307 Bacteria 3237
154 Ga0163163_10004056 3300014325 Bacteria 12490
155 Ga0163163_10297383 3300014325 Bacteria 1666
156 Ga0157377_10000098 3300014745 Bacteria 62330
157 Ga0157376_10193719 3300014969 Bacteria 1865
158 Ga0157376_10930007 3300014969 Bacteria 889
159 Ga0213872_10001251 3300021361 Bacteria 17114
160 Ga0213872_10015243 3300021361 Bacteria 3577
161 Ga0213872_10084699 3300021361 Bacteria 1421
162 Ga0213872_10146883 3300021361 Bacteria 1032
163 Ga0209672_101407 3300025228 Bacteria 8788
164 Ga0209258_100447 3300025242 Bacteria 45725
165 Ga0209148_1000438 3300025254 Bacteria 45725
166 Ga0209455_1019625 3300025272 Bacteria 1360
167 Ga0209130_1003726 3300025284 Bacteria 6242
168 Ga0209676_1008257 3300025292 Bacteria 4679
169 Ga0209758_1000698 3300025297 Bacteria 49793
170 Ga0207426_1000215 3300025302 Bacteria 136757
171 Ga0207656_10003294 3300025321 Bacteria 5534
172 Ga0207710_10049082 3300025900 Bacteria 1890
173 Ga0207647_10001327 3300025904 Bacteria 18998
174 Ga0207645_10059917 3300025907 Bacteria 2431
175 Ga0207645_10077640 3300025907 Bacteria 2128
176 Ga0207643_10058623 3300025908 Bacteria 2195
177 Ga0207695_10000520 3300025913 Bacteria 81547
178 Ga0207695_10001752 3300025913 Bacteria 34438
179 Ga0207695_10014966 3300025913 Bacteria 9157
180 Ga0207695_10022447 3300025913 Bacteria 7161
181 Ga0207695_10042746 3300025913 Bacteria 4835
182 Ga0207695_10065145 3300025913 Bacteria 3747
183 Ga0207671_10000026 3300025914 Bacteria 268845
184 Ga0207671_10119440 3300025914 Bacteria 2014
185 Ga0207657_10157735 3300025919 Bacteria 1845
186 Ga0207694_10601416 3300025924 Bacteria 925
187 Ga0207650_10347345 3300025925 Bacteria 1220
188 Ga0207706_10041975 3300025933 Bacteria 4053
189 Ga0207709_10002802 3300025935 Bacteria 10733
190 Ga0207670_10043258 3300025936 Bacteria 2973
191 Ga0207704_10131654 3300025938 Bacteria 1733
192 Ga0207704_10187110 3300025938 Bacteria 1502
193 Ga0207691_10013421 3300025940 Bacteria 7842
194 Ga0207691_10021154 3300025940 Bacteria 6148
195 Ga0207711_10105941 3300025941 Bacteria 2494
196 Ga0207689_10112761 3300025942 Bacteria 2235
197 Ga0207667_10008300 3300025949 Bacteria 12355
198 Ga0207667_10011300 3300025949 Bacteria 10384
199 Ga0207667_10013017 3300025949 Bacteria 9549
200 Ga0207651_10017327 3300025960 Bacteria 4254
201 Ga0207651_10220801 3300025960 Bacteria 1532
202 Ga0207712_10000023 3300025961 Bacteria 282081
203 Ga0207668_10005232 3300025972 Bacteria 7634
204 Ga0207668_10146898 3300025972 Bacteria 1820
205 Ga0207668_10311238 3300025972 Bacteria 1303
206 Ga0207640_10000632 3300025981 Bacteria 20641
207 Ga0207640_10024208 3300025981 Bacteria 3661
208 Ga0207640_10387960 3300025981 Bacteria 1134
209 Ga0207658_10187008 3300025986 Bacteria 1719
210 Ga0207658_10409212 3300025986 Bacteria 1194
211 Ga0207677_10177490 3300026023 Bacteria 1672
212 Ga0207703_10065769 3300026035 Bacteria 2980
213 Ga0207639_10001101 3300026041 Bacteria 18339
214 Ga0207639_10011796 3300026041 Bacteria 6077
215 Ga0207639_10026252 3300026041 Bacteria 4232
216 Ga0207639_10791946 3300026041 Bacteria 883
217 Ga0207678_10015043 3300026067 Bacteria 6808
218 Ga0207678_10016702 3300026067 Bacteria 6446
219 Ga0207678_10061661 3300026067 Bacteria 3225
220 Ga0207678_10089132 3300026067 Bacteria 2637
221 Ga0207678_10128531 3300026067 Bacteria 2161
222 Ga0207678_10210964 3300026067 Bacteria 1661
223 Ga0207708_10034108 3300026075 Bacteria 3870
224 Ga0207641_10004331 3300026088 Bacteria 12321
225 Ga0207641_10306198 3300026088 Bacteria 1502
226 Ga0207648_10000614 3300026089 Bacteria 39971
227 Ga0207648_10077651 3300026089 Bacteria 2895
228 Ga0207676_10402276 3300026095 Bacteria 1280
229 Ga0207674_10000219 3300026116 Bacteria 71283
230 Ga0207674_10038049 3300026116 Bacteria 4999
231 Ga0207674_10053694 3300026116 Bacteria 4106
232 Ga0207675_100000779 3300026118 Bacteria 31810
233 Ga0207683_10006329 3300026121 Bacteria 10139
234 Ga0207698_10037228 3300026142 Bacteria 3581
235 Ga0207698_10829463 3300026142 Bacteria 928
236 Ga0209982_1006591 3300027552 Bacteria 1691
237 Ga0209983_1005918 3300027665 Bacteria 2524
238 Ga0209971_1021303 3300027682 Bacteria 1542
239 Ga0209974_10038082 3300027876 Bacteria 1598
240 Ga0207428_10002156 3300027907 Bacteria 19753
241 Ga0207428_10127428 3300027907 Bacteria 1949
242 Ga0268266_10051840 3300028379 Bacteria 3523
243 Ga0268266_10123388 3300028379 Bacteria 2308
244 Ga0268266_10161255 3300028379 Bacteria 2029
245 Ga0268265_10000137 3300028380 Bacteria 93389
246 Ga0268265_10000164 3300028380 Bacteria 80747
247 Ga0268265_10000547 3300028380 Bacteria 38290
248 Ga0268265_10296873 3300028380 Bacteria 1453
249 Ga0268264_10000512 3300028381 Bacteria 49877
250 Ga0268264_10459757 3300028381 Bacteria 1235
251 Ga0265326_10029055 3300028558 Bacteria 1575
252 Ga0265334_10013502 3300028573 Bacteria 3417
253 Ga0307515_10124638 3300028794 Bacteria 2889
254 Ga0265771_1000454 3300031010 Bacteria 1501
255 Ga0265328_10014265 3300031239 Bacteria 3131
256 Ga0265325_10227146 3300031241 Bacteria 852
257 Ga0265340_10012538 3300031247 Bacteria 4475
258 Ga0265327_10065703 3300031251 Bacteria 1833
259 Ga0265316_10225457 3300031344 Bacteria 1382
260 Ga0307513_10035922 3300031456 Bacteria 5539
261 Ga0307509_10281710 3300031507 Bacteria 1423
262 Ga0307408_100066320 3300031548 Bacteria 2651
263 Ga0307408_100401281 3300031548 Bacteria 1177
264 Ga0265313_10001342 3300031595 Bacteria 23180
265 Ga0265313_10081976 3300031595 Bacteria 1463
266 Ga0265314_10024772 3300031711 Bacteria 4541
267 Ga0265314_10034063 3300031711 Bacteria 3726
268 Ga0265314_10151443 3300031711 Bacteria 1422
269 Ga0265342_10243142 3300031712 Bacteria 963
270 Ga0316576_10063059 3300031727 Bacteria 2720
271 Ga0316578_10179961 3300031728 Bacteria 1274
272 Ga0307405_10613631 3300031731 Bacteria 889
273 Ga0307413_10304380 3300031824 Bacteria 1210
274 Ga0307406_10000297 3300031901 Bacteria 29339
275 Ga0307412_10102449 3300031911 Bacteria 2027
276 Ga0307409_100558808 3300031995 Bacteria 1125
277 Ga0307416_100275560 3300032002 Bacteria 1655
278 Ga0307416_100396638 3300032002 Bacteria 1416
279 Ga0307414_10011862 3300032004 Bacteria 5132
280 Ga0307411_10022689 3300032005 Bacteria 3701
281 Ga0307507_10043872 3300033179 Bacteria 4430
282 Ga0307507_10067439 3300033179 Bacteria 3272
283 Ga0373944_0117281 3300035089 Bacteria 914
284 Ga0316584_0218883 3300036712 Bacteria 1400
285 Ga0316584_0259224 3300036712 Bacteria 1268
286 Ga0395905_0220376 3300037471 Bacteria 1775
287 Ga0436364_0011659 3300037853 Bacteria 94648
288 Ga0237819_02473 3300038705 Bacteria 3701
289 Ga0400483_011190 3300039062 Bacteria 182340
290 Ga0400483_093214 3300039062 Bacteria 200340
291 Ga0400483_215675 3300039062 Bacteria 181282
292 Ga0400483_219863 3300039062 Bacteria 173210
293 Ga0436361_0075622 3300039447 Bacteria 1227
294 Ga0436361_0117668 3300039447 Bacteria 1074
295 Ga0436361_0319126 3300039447 Bacteria 20837
296 Ga0436361_0728505 3300039447 Bacteria 4966
297 Ga0436361_1162608 3300039447 Bacteria 10383
298 Ga0436362_0223885 3300039453 Bacteria 871
299 Ga0439436_0003694 3300041404 Bacteria 4666
300 Ga0439436_0007932 3300041404 Bacteria 3261
301 Ga0439436_0018212 3300041404 Bacteria 2100
302 Ga0439439_0000798 3300041406 Bacteria 5724
303 Ga0451789_0963123 3300041443 Bacteria 981
304 Ga0451855_0860111 3300041511 Bacteria 944
305 Ga0451853_3855578 3300041512 Bacteria 1805
306 Ga0439432_012052 3300042006 Bacteria 2968
307 Ga0439432_018258 3300042006 Bacteria 2345
308 Ga0439449_0004237 3300042007 Bacteria 5543
309 Ga0439449_0023528 3300042007 Bacteria 2303
310 Ga0439452_038264 3300042010 Bacteria 1140
311 Ga0439462_0033408 3300042015 Bacteria 1364
312 Ga0439462_0050636 3300042015 Bacteria 1116
313 Ga0466972_0021849 3300044658 Bacteria 3188
314 Ga0466965_0004446 3300044683 Bacteria 6235
315 Ga0466965_0010823 3300044683 Bacteria 4267
316 Ga0466966_0011388 3300044684 Bacteria 5899
317 Ga0466961_0000285 3300044693 Bacteria 33498
318 Ga0466961_0016695 3300044693 Bacteria 4720
319 Ga0466964_0346105 3300044706 Bacteria 762
320 Ga0453684_0001075 3300044712 Bacteria 86968
321 Ga0466957_0102690 3300044842 Bacteria 1804
322 Ga0466960_0041675 3300044901 Bacteria 2176
323 Ga0466959_0003330 3300045049 Bacteria 10495
324 Ga0466959_0078857 3300045049 Bacteria 2375
325 Ga0451576_0000025 3300045051 Bacteria 427980
326 Ga0466958_0133741 3300045836 Bacteria 1558
327 Ga0466967_0795182 3300045976 Bacteria 939
328 Ga0495590_0038893 3300046457 Bacteria 1659
329 Ga0495641_0107650 3300046461 Bacteria 1244
330 Ga0495580_0008442 3300046472 Bacteria 8194
331 Ga0495605_0086601 3300046474 Bacteria 1457
332 Ga0495605_0096692 3300046474 Bacteria 1362
333 Ga0495594_0187165 3300046499 Bacteria 1179
334 Ga0495583_0007674 3300046506 Bacteria 6724
335 Ga0495606_0000859 3300046507 Bacteria 45541
336 Ga0495616_0069696 3300046513 Bacteria 1704
337 Ga0495648_0003754 3300046524 Bacteria 13221
338 Ga0495648_0091954 3300046524 Bacteria 1695
339 Ga0495666_0141598 3300046526 Bacteria 1121
340 Ga0495622_0070668 3300046557 Bacteria 1611
341 Ga0495634_0348646 3300046642 Bacteria 887
342 Ga0495669_0020406 3300046684 Bacteria 2868
343 Ga0495649_0170941 3300046694 Bacteria 1137
344 Ga0495600_0129549 3300046809 Bacteria 1641
345 Ga0495674_0017846 3300047319 Bacteria 6608
346 Ga0495674_0035618 3300047319 Bacteria 4488
347 Ga0495672_0015871 3300047320 Bacteria 5099
348 Ga0495672_0065825 3300047320 Bacteria 2070
349 Ga0495676_0166764 3300047321 Bacteria 1553
350 Ga0495683_0001829 3300047323 Bacteria 13372
351 Ga0495683_0048498 3300047323 Bacteria 2129
352 Ga0495675_0195634 3300047444 Bacteria 1233
353 Ga0495673_0005404 3300047469 Bacteria 7733
354 Ga0495626_0058031 3300048091 Bacteria 1770
355 Ga0496100_0019100 3300048903 Bacteria 4081
356 Ga0496100_0023537 3300048903 Bacteria 3743
357 Ga0496100_0159035 3300048903 Bacteria 1618
358 Ga0496100_0176487 3300048903 Bacteria 1543
359 Ga0496101_0001443 3300048904 Bacteria 14188
360 Ga0496101_0016189 3300048904 Bacteria 5033
361 Ga0496101_0031944 3300048904 Bacteria 3704
362 Ga0496101_0102884 3300048904 Bacteria 2140
363 Ga0496101_0258968 3300048904 Bacteria 1356
364 Ga0496102_0001539 3300048905 Bacteria 20355
365 Ga0496102_0608027 3300048905 Bacteria 1016
366 Ga0496103_0000371 3300048906 Bacteria 40307
367 Ga0496104_0000303 3300048907 Bacteria 43795
368 Ga0496104_0000713 3300048907 Bacteria 28574
369 Ga0496104_0009732 3300048907 Bacteria 8568
370 Ga0496104_0013391 3300048907 Bacteria 7391
371 Ga0496104_0027609 3300048907 Bacteria 5255
372 Ga0496104_0065720 3300048907 Bacteria 3442
373 Ga0496105_0000554 3300048908 Bacteria 24707
374 Ga0496105_0000693 3300048908 Bacteria 22693
375 Ga0496105_0001496 3300048908 Bacteria 16513
376 Ga0496105_0002549 3300048908 Bacteria 13221
377 Ga0496105_0018364 3300048908 Bacteria 5618
378 Ga0496105_0070818 3300048908 Bacteria 2882
379 Ga0496106_0046413 3300048909 Bacteria 3266
380 Ga0496106_0376745 3300048909 Bacteria 1140
381 Ga0496107_0021284 3300048910 Bacteria 4584
382 Ga0496107_0361471 3300048910 Bacteria 1080
383 Ga0496108_0011366 3300048911 Bacteria 7235
384 Ga0496108_0719938 3300048911 Bacteria 865
385 Ga0496109_0001233 3300048912 Bacteria 21242
386 Ga0496110_0027242 3300048913 Bacteria 4898
387 Ga0496110_0067115 3300048913 Bacteria 3173
388 Ga0496110_0398166 3300048913 Bacteria 1255
389 Ga0496111_0000819 3300048914 Bacteria 16705
390 Ga0496111_0088629 3300048914 Bacteria 2266
391 Ga0496112_0002425 3300048915 Bacteria 15010
392 Ga0496112_0028185 3300048915 Bacteria 5418
393 Ga0496112_0237324 3300048915 Bacteria 1777
394 Ga0496112_0405711 3300048915 Bacteria 1302
395 Ga0496113_0000636 3300048916 Bacteria 17648
396 Ga0496113_0006616 3300048916 Bacteria 7371
397 Ga0496113_0042470 3300048916 Bacteria 3360
398 Ga0496114_0117756 3300048917 Bacteria 2282
399 Ga0496115_0019682 3300048918 Bacteria 5197
400 Ga0496115_0027822 3300048918 Bacteria 4426
401 Ga0496115_0038542 3300048918 Bacteria 3792
402 Ga0496115_0174178 3300048918 Bacteria 1779
403 Ga0496117_0002705 3300048920 Bacteria 21898
404 Ga0496117_0103635 3300048920 Bacteria 1792
405 Ga0496118_0000698 3300048921 Bacteria 54435
406 Ga0496118_0006725 3300048921 Bacteria 12529
407 Ga0496118_0010118 3300048921 Bacteria 9376
408 Ga0496119_0002149 3300048922 Bacteria 22159
409 Ga0496119_0023633 3300048922 Bacteria 4350
410 Ga0496119_0035658 3300048922 Bacteria 3256
411 Ga0496119_0046469 3300048922 Bacteria 2711
412 Ga0496119_0121233 3300048922 Bacteria 1437
413 Ga0496120_0000505 3300048923 Bacteria 60875
414 Ga0496120_0009890 3300048923 Bacteria 6717
415 Ga0496120_0177986 3300048923 Bacteria 1047
416 Ga0496120_0184684 3300048923 Bacteria 1021
417 Ga0496121_0001198 3300048924 Bacteria 45422
418 Ga0496121_0001778 3300048924 Bacteria 34958
419 Ga0496121_0010022 3300048924 Bacteria 10765
420 Ga0496121_0032282 3300048924 Bacteria 4764
421 Ga0496121_0222220 3300048924 Bacteria 1329
422 Ga0496122_0132861 3300048925 Bacteria 1577
423 Ga0496125_0025836 3300048928 Bacteria 5368
424 Ga0496126_0003502 3300048929 Bacteria 19805
425 Ga0496126_0233298 3300048929 Bacteria 1541
426 Ga0495682_0001483 3300049460 Bacteria 12534
427 Ga0495682_0003355 3300049460 Bacteria 7146
428 Ga0501300_012312 3300049523 Bacteria 1247
429 Ga0501031_0002340 3300049568 Bacteria 12000
430 Ga0501031_0004589 3300049568 Bacteria 8956
431 Ga0501032_0098654 3300049569 Bacteria 1935
432 Ga0501032_0121509 3300049569 Bacteria 1726
433 Ga0501033_0050319 3300049570 Bacteria 3091
434 Ga0501033_0081465 3300049570 Bacteria 2374
435 Ga0501033_0409128 3300049570 Bacteria 945
436 Ga0501034_0002289 3300049571 Bacteria 23506
437 Ga0501034_0386157 3300049571 Bacteria 1324
438 Ga0501034_0414282 3300049571 Bacteria 1269
439 Ga0501036_0070548 3300049572 Bacteria 2954
440 Ga0501036_0084941 3300049572 Bacteria 2676
441 Ga0501036_0581690 3300049572 Bacteria 930
442 Ga0501037_0024859 3300049573 Bacteria 4428
443 Ga0501037_0034349 3300049573 Bacteria 3741
444 Ga0501037_0120426 3300049573 Bacteria 1887
445 Ga0501037_0241413 3300049573 Bacteria 1266
446 Ga0501038_0006839 3300049574 Bacteria 10535
447 Ga0501038_0025833 3300049574 Bacteria 5232
448 Ga0501039_0002455 3300049575 Bacteria 13802
449 Ga0501039_0019269 3300049575 Bacteria 5232
450 Ga0501039_0054822 3300049575 Bacteria 3086
451 Ga0501040_0001281 3300049576 Bacteria 15982
452 Ga0501040_0031172 3300049576 Bacteria 3601
453 Ga0501040_0165056 3300049576 Bacteria 1566
454 Ga0501041_0000998 3300049577 Bacteria 15459
455 Ga0501042_0004027 3300049578 Bacteria 9310
456 Ga0501042_0011146 3300049578 Bacteria 6057
457 Ga0501042_0292046 3300049578 Bacteria 1177
458 Ga0501043_0137534 3300049579 Bacteria 1913
459 Ga0501046_0028278 3300049580 Bacteria 4567
460 Ga0501046_0129870 3300049580 Bacteria 1911
461 Ga0501047_0102039 3300049581 Bacteria 2748
462 Ga0501048_0005038 3300049582 Bacteria 10071
463 Ga0501048_0034694 3300049582 Bacteria 3637
464 Ga0501048_0047128 3300049582 Bacteria 3075
465 Ga0501067_0049349 3300049583 Bacteria 2332
466 Ga0501068_0014546 3300049584 Bacteria 4500
467 Ga0501069_0000759 3300049585 Bacteria 15083
468 Ga0501070_0050193 3300049586 Bacteria 3463
469 Ga0501070_0140373 3300049586 Bacteria 1995
470 Ga0501071_0004084 3300049587 Bacteria 9226
471 Ga0501071_0115109 3300049587 Bacteria 1989
472 Ga0501071_0283615 3300049587 Bacteria 1253
473 Ga0501072_0002683 3300049588 Bacteria 13352
474 Ga0501072_0175911 3300049588 Bacteria 1707
475 Ga0501072_0312678 3300049588 Bacteria 1248
476 Ga0501073_0013314 3300049589 Bacteria 5989
477 Ga0501073_0042629 3300049589 Bacteria 3202
478 Ga0501073_0054648 3300049589 Bacteria 2795
479 Ga0501073_0227307 3300049589 Bacteria 1289
480 Ga0501074_0006764 3300049590 Bacteria 8275
481 Ga0501074_0031514 3300049590 Bacteria 3840
482 Ga0501074_0061768 3300049590 Bacteria 2699
483 Ga0501075_0000491 3300049591 Bacteria 23672
484 Ga0501075_0159507 3300049591 Bacteria 1720
485 Ga0501076_0002706 3300049592 Bacteria 12252
486 Ga0501076_0122088 3300049592 Bacteria 2109
487 Ga0501076_0131973 3300049592 Bacteria 2026
488 Ga0501077_0004253 3300049593 Bacteria 8652
489 Ga0501077_0103344 3300049593 Bacteria 1805
490 Ga0501239_002223 3300049672 Bacteria 1745
491 Ga0501079_0012112 3300049741 Bacteria 6583
492 Ga0501080_0019681 3300049742 Bacteria 6251
493 Ga0501080_0064742 3300049742 Bacteria 3400
494 Ga0501080_0186262 3300049742 Bacteria 1908
495 Ga0501080_0187500 3300049742 Bacteria 1902
496 Ga0501080_0374699 3300049742 Bacteria 1283
497 Ga0501081_0001389 3300049743 Bacteria 14771
498 Ga0501083_0002183 3300049744 Bacteria 13384
499 Ga0501083_0003882 3300049744 Bacteria 10497
500 Ga0501083_0014533 3300049744 Bacteria 5505
501 Ga0501083_0241490 3300049744 Bacteria 1176
502 Ga0501241_046467 3300049758 Bacteria 851
503 Ga0501280_001227 3300049776 Bacteria 5001
504 Ga0501282_001588 3300049778 Bacteria 2516
505 Ga0501035_0006601 3300049822 Bacteria 10862
506 Ga0501035_0027804 3300049822 Bacteria 5169
507 Ga0501035_0112301 3300049822 Bacteria 2387
508 Ga0501035_0144195 3300049822 Bacteria 2069
509 Ga0501044_0001614 3300049823 Bacteria 26409
510 Ga0501044_0007794 3300049823 Bacteria 11770
511 Ga0501044_0021241 3300049823 Bacteria 6930
512 Ga0501044_0043349 3300049823 Bacteria 4674
513 Ga0501044_0418010 3300049823 Bacteria 1251
514 Ga0501045_0011691 3300049824 Bacteria 6165
515 nmdc:mga0k408_76839_c1 3300050493 Bacteria 1952
516 nmdc:mga05p37_3848_c1 3300050507 Bacteria 15141
517 nmdc:mga05p37_429170_c1 3300050507 Bacteria 1536
518 nmdc:mga05p37_586549_c1 3300050507 Bacteria 1261
519 nmdc:mga05p37_6663_c1 3300050507 Bacteria 13628
520 nmdc:mga09592_16048_c1 3300050508 Bacteria 6123
521 nmdc:mga09592_29529_c1 3300050508 Bacteria 4559
522 nmdc:mga09592_755_c1 3300050508 Bacteria 24846
523 nmdc:mga0qj67_10964_c1 3300050509 Bacteria 6783
524 nmdc:mga0qj67_741_c1 3300050509 Bacteria 22140
525 nmdc:mga06r32_2020_c1 3300050510 Bacteria 18156
526 nmdc:mga06r32_331256_c1 3300050510 Bacteria 1507
527 nmdc:mga06r32_45332_c1 3300050510 Bacteria 4191
528 nmdc:mga06r32_63_c1 3300050510 Bacteria 68165
529 nmdc:mga08y16_254_c1 3300050511 Bacteria 48008
530 nmdc:mga08y16_57862_c1 3300050511 Bacteria 4050
531 Ga0495601_0355123 3300053077 Bacteria 953
532 Ga0495619_0019882 3300053085 Bacteria 4274
533 Ga0500643_054119 3300053087 Bacteria 1140
534 Ga0500583_0004078 3300053092 Bacteria 4705
535 Ga0500597_027597 3300053120 Bacteria 2308
536 Ga0500652_089760 3300053131 Bacteria 1283
537 Ga0500559_0011170 3300053136 Bacteria 3841
538 Ga0500568_0000435 3300053139 Bacteria 31407
539 Ga0500573_0000016 3300053140 Bacteria 182675
540 Ga0500622_0007927 3300053156 Bacteria 5980
541 Ga0500624_000043 3300053157 Bacteria 90095
542 Ga0500637_0000089 3300053178 Bacteria 32896
543 Ga0501084_0003070 3300054114 Bacteria 13530
544 Ga0501084_0005932 3300054114 Bacteria 10059
545 Ga0501084_0088532 3300054114 Bacteria 2599
546 Ga0501082_0004147 3300060353 Bacteria 12666
547 Ga0501082_0006298 3300060353 Bacteria 10291
548 Ga0501082_0112190 3300060353 Bacteria 2360
549 Ga0530510_0002822 3300061734 Bacteria 11948
550 Ga0530510_0095604 3300061734 Bacteria 2171
551 Ga0530510_0395219 3300061734 Bacteria 1041
552 2523102838 2522572158 Bacteria 6514390
553 2563063185 2562617112 Bacteria 10918404
554 2563065059 2562617112 Bacteria 10918404
555 2572256267 2571042365 Bacteria 3289345
556 2599105892 2597490356 Bacteria 7030811
557 2643816959 2643221559 Bacteria 4424915
558 2643820808 2643221560 Bacteria 4801179
559 2643881244 2643221573 Bacteria 4784121
560 2643939381 2643221586 Bacteria 4446529
561 2644078062 2643221612 Bacteria 4361984
562 2644528590 2643221695 Bacteria 3441323
563 2644662017 2643221720 Bacteria 4694283
564 2644696363 2643221727 Bacteria 4415595
565 2644700155 2643221728 Bacteria 4797149
566 2713477393 2711768613 Bacteria 11048459
567 2713481953 2711768613 Bacteria 11048459
568 2846955677 2846952575 Bacteria 6587527
569 2848862338 2848858292 Bacteria 7391279
570 2921645198 2921643360 Bacteria 11448031
571 2939633067 2939631187 Bacteria 6118131
572 Ga0114129_10369211
573 JGI24741J21665_1006124
574 JGI24735J21928_10068943
575 JGI24735J21928_10073514
576 JGI25153J46596_10051962
577 rootH2_10040930
578 JGI25160J50197_1000208
579 Ga0006562J51391_1117239
580 Ga0055535_1000480
581 Ga0055542_1000498
582 Ga0065165_1000119
583 Ga0065714_10064584
584 Ga0070676_10052441
585 Ga0070676_10090935
586 Ga0070683_100436854
587 Ga0070683_100520267
588 Ga0070670_100449375
589 Ga0068869_100056780
590 Ga0068869_100081067
591 Ga0068869_100129853
592 Ga0070666_10089653
593 Ga0070682_100499447
594 Ga0068868_100105906
595 Ga0070660_100162258
596 Ga0070689_100066378
597 Ga0070668_100014694
598 Ga0070668_100066227
599 Ga0070668_100075258
600 Ga0070668_100290784
601 Ga0070669_100002673
602 Ga0070669_100063099
603 Ga0070669_100063183
604 Ga0070675_100063084
605 Ga0070671_100150090
606 Ga0070673_100085091
607 Ga0070667_100087564
608 Ga0070667_100148812
609 Ga0070709_10294781
610 Ga0070700_100047517
611 Ga0070663_100015745
612 Ga0070663_100047590
613 Ga0070663_100102577
614 Ga0070663_100114402
615 Ga0070663_100120811
616 Ga0070663_100317809
617 Ga0070678_100183402
618 Ga0070662_100048167
619 Ga0070662_100057900
620 Ga0070681_10040601
621 Ga0068867_100000977
622 Ga0070698_100229368
623 Ga0070698_100312159
624 Ga0068853_100011346
625 Ga0068853_100012222
626 Ga0068853_100083468
627 Ga0070672_100004832
628 Ga0070672_100093733
629 Ga0070672_100286340
630 Ga0070696_100034236
631 Ga0070665_100012782
632 Ga0070665_100235937
633 Ga0070665_100259614
634 Ga0070665_100286650
635 Ga0070665_100806840
636 Ga0068855_100006688
637 Ga0068855_100036599
638 Ga0068855_100048401
639 Ga0068855_100232030
640 Ga0068855_100393111
641 Ga0068857_100001325
642 Ga0068857_100018771
643 Ga0068857_100055534
644 Ga0068854_100005095
645 Ga0068854_100037766
646 Ga0068856_100079863
647 Ga0068852_100141840
648 Ga0068852_100211265
649 Ga0068852_100226744
650 Ga0068852_100297830
651 Ga0068859_100000070
652 Ga0068859_101021260
653 Ga0068861_100015016
654 Ga0068851_10001014
655 Ga0068851_10026033
656 Ga0068870_10021051
657 Ga0068863_100005629
658 Ga0068863_100222800
659 Ga0068858_100095249
660 Ga0068860_100287451
661 Ga0068860_100327298
662 Ga0068862_100000041
663 Ga0068862_100000722
664 Ga0068862_100001530
665 Ga0081455_10051486
666 Ga0081540_1010382
667 Ga0070717_10065536
668 Ga0075366_10083227
669 Ga0075366_10301756
670 Ga0097621_100048825
671 Ga0097621_100133458
672 Ga0068871_100266435
673 Ga0068871_100373900
674 Ga0068871_100629097
675 Ga0075428_100007767
676 Ga0075430_100000458
677 Ga0075430_100011525
678 Ga0075430_100013283
679 Ga0075431_100000243
680 Ga0075431_100000267
681 Ga0075431_100003216
682 Ga0075431_100008297
683 Ga0075429_100000445
684 Ga0075429_100001924
685 Ga0075429_100085573
686 Ga0075429_100341034
687 Ga0068865_100005556
688 Ga0068865_100008801
689 Ga0068865_100245651
690 Ga0097620_100000070
691 Ga0097620_101021339
692 Ga0105240_10001295
693 Ga0105240_10016935
694 Ga0105240_10050609
695 Ga0105240_10073268
696 Ga0111539_10000989
697 Ga0111539_10041545
698 Ga0105247_10048258
699 Ga0105247_10074639
700 Ga0114129_10001320
701 Ga0114129_10029160
702 Ga0114129_10279423
703 Ga0114129_10528959
704 Ga0105243_10002995
705 Ga0105248_10248344
706 Ga0105237_10000058
707 Ga0105237_10127701
708 Ga0105238_10169745
709 Ga0105238_10417804
710 Ga0105238_10661953
711 Ga0105249_10000015
712 Ga0105249_10028396
713 Ga0105032_101076
714 Ga0105239_10001092
715 Ga0105239_10041475
716 Ga0105239_10054456
717 Ga0105239_10169198
718 Ga0105239_10238031
719 Ga0105246_10081279
720 Ga0105246_10518216
721 Ga0157320_1004295
722 Ga0157369_10044126
723 Ga0157374_10014689
724 Ga0157372_10104556
725 Ga0163163_10004056
726 Ga0163163_10297383
727 Ga0157377_10000098
728 Ga0157376_10193719
729 Ga0157376_10930007
730 Ga0213872_10001251
731 Ga0213872_10015243
732 Ga0213872_10084699
733 Ga0213872_10146883
734 Ga0209672_101407
735 Ga0209258_100447
736 Ga0209148_1000438
737 Ga0209455_1019625
738 Ga0209130_1003726
739 Ga0209676_1008257
740 Ga0209758_1000698
741 Ga0207426_1000215
742 Ga0207656_10003294
743 Ga0207710_10049082
744 Ga0207647_10001327
745 Ga0207645_10059917
746 Ga0207645_10077640
747 Ga0207643_10058623
748 Ga0207695_10000520
749 Ga0207695_10001752
750 Ga0207695_10014966
751 Ga0207695_10022447
752 Ga0207695_10042746
753 Ga0207695_10065145
754 Ga0207671_10000026
755 Ga0207671_10119440
756 Ga0207657_10157735
757 Ga0207694_10601416
758 Ga0207650_10347345
759 Ga0207706_10041975
760 Ga0207709_10002802
761 Ga0207670_10043258
762 Ga0207704_10131654
763 Ga0207704_10187110
764 Ga0207691_10013421
765 Ga0207691_10021154
766 Ga0207711_10105941
767 Ga0207689_10112761
768 Ga0207667_10008300
769 Ga0207667_10011300
770 Ga0207667_10013017
771 Ga0207651_10017327
772 Ga0207651_10220801
773 Ga0207712_10000023
774 Ga0207668_10005232
775 Ga0207668_10146898
776 Ga0207668_10311238
777 Ga0207640_10000632
778 Ga0207640_10024208
779 Ga0207640_10387960
780 Ga0207658_10187008
781 Ga0207658_10409212
782 Ga0207677_10177490
783 Ga0207703_10065769
784 Ga0207639_10001101
785 Ga0207639_10011796
786 Ga0207639_10026252
787 Ga0207639_10791946
788 Ga0207678_10015043
789 Ga0207678_10016702
790 Ga0207678_10061661
791 Ga0207678_10089132
792 Ga0207678_10128531
793 Ga0207678_10210964
794 Ga0207708_10034108
795 Ga0207641_10004331
796 Ga0207641_10306198
797 Ga0207648_10000614
798 Ga0207648_10077651
799 Ga0207676_10402276
800 Ga0207674_10000219
801 Ga0207674_10038049
802 Ga0207674_10053694
803 Ga0207675_100000779
804 Ga0207683_10006329
805 Ga0207698_10037228
806 Ga0207698_10829463
807 Ga0209982_1006591
808 Ga0209983_1005918
809 Ga0209971_1021303
810 Ga0209974_10038082
811 Ga0207428_10002156
812 Ga0207428_10127428
813 Ga0268266_10051840
814 Ga0268266_10123388
815 Ga0268266_10161255
816 Ga0268265_10000137
817 Ga0268265_10000164
818 Ga0268265_10000547
819 Ga0268265_10296873
820 Ga0268264_10000512
821 Ga0268264_10459757
822 Ga0265326_10029055
823 Ga0265334_10013502
824 Ga0307515_10124638
825 Ga0265771_1000454
826 Ga0265328_10014265
827 Ga0265325_10227146
828 Ga0265340_10012538
829 Ga0265327_10065703
830 Ga0265316_10225457
831 Ga0307513_10035922
832 Ga0307509_10281710
833 Ga0307408_100066320
834 Ga0307408_100401281
835 Ga0265313_10001342
836 Ga0265313_10081976
837 Ga0265314_10024772
838 Ga0265314_10034063
839 Ga0265314_10151443
840 Ga0265342_10243142
841 Ga0316576_10063059
842 Ga0316578_10179961
843 Ga0307405_10613631
844 Ga0307413_10304380
845 Ga0307406_10000297
846 Ga0307412_10102449
847 Ga0307409_100558808
848 Ga0307416_100275560
849 Ga0307416_100396638
850 Ga0307414_10011862
851 Ga0307411_10022689
852 Ga0307507_10043872
853 Ga0307507_10067439
854 Ga0373944_0117281
855 Ga0316584_0218883
856 Ga0316584_0259224
857 Ga0395905_0220376
858 Ga0436364_0011659
859 Ga0237819_02473
860 Ga0400483_011190
861 Ga0400483_093214
862 Ga0400483_215675
863 Ga0400483_219863
864 Ga0436361_0075622
865 Ga0436361_0117668
866 Ga0436361_0319126
867 Ga0436361_0728505
868 Ga0436361_1162608
869 Ga0436362_0223885
870 Ga0439436_0003694
871 Ga0439436_0007932
872 Ga0439436_0018212
873 Ga0439439_0000798
874 Ga0451789_0963123
875 Ga0451855_0860111
876 Ga0451853_3855578
877 Ga0439432_012052
878 Ga0439432_018258
879 Ga0439449_0004237
880 Ga0439449_0023528
881 Ga0439452_038264
882 Ga0439462_0033408
883 Ga0439462_0050636
884 Ga0466972_0021849
885 Ga0466965_0004446
886 Ga0466965_0010823
887 Ga0466966_0011388
888 Ga0466961_0000285
889 Ga0466961_0016695
890 Ga0466964_0346105
891 Ga0453684_0001075
892 Ga0466957_0102690
893 Ga0466960_0041675
894 Ga0466959_0003330
895 Ga0466959_0078857
896 Ga0451576_0000025
897 Ga0466958_0133741
898 Ga0466967_0795182
899 Ga0495590_0038893
900 Ga0495641_0107650
901 Ga0495580_0008442
902 Ga0495605_0086601
903 Ga0495605_0096692
904 Ga0495594_0187165
905 Ga0495583_0007674
906 Ga0495606_0000859
907 Ga0495616_0069696
908 Ga0495648_0003754
909 Ga0495648_0091954
910 Ga0495666_0141598
911 Ga0495622_0070668
912 Ga0495634_0348646
913 Ga0495669_0020406
914 Ga0495649_0170941
915 Ga0495600_0129549
916 Ga0495674_0017846
917 Ga0495674_0035618
918 Ga0495672_0015871
919 Ga0495672_0065825
920 Ga0495676_0166764
921 Ga0495683_0001829
922 Ga0495683_0048498
923 Ga0495675_0195634
924 Ga0495673_0005404
925 Ga0495626_0058031
926 Ga0496100_0019100
927 Ga0496100_0023537
928 Ga0496100_0159035
929 Ga0496100_0176487
930 Ga0496101_0001443
931 Ga0496101_0016189
932 Ga0496101_0031944
933 Ga0496101_0102884
934 Ga0496101_0258968
935 Ga0496102_0001539
936 Ga0496102_0608027
937 Ga0496103_0000371
938 Ga0496104_0000303
939 Ga0496104_0000713
940 Ga0496104_0009732
941 Ga0496104_0013391
942 Ga0496104_0027609
943 Ga0496104_0065720
944 Ga0496105_0000554
945 Ga0496105_0000693
946 Ga0496105_0001496
947 Ga0496105_0002549
948 Ga0496105_0018364
949 Ga0496105_0070818
950 Ga0496106_0046413
951 Ga0496106_0376745
952 Ga0496107_0021284
953 Ga0496107_0361471
954 Ga0496108_0011366
955 Ga0496108_0719938
956 Ga0496109_0001233
957 Ga0496110_0027242
958 Ga0496110_0067115
959 Ga0496110_0398166
960 Ga0496111_0000819
961 Ga0496111_0088629
962 Ga0496112_0002425
963 Ga0496112_0028185
964 Ga0496112_0237324
965 Ga0496112_0405711
966 Ga0496113_0000636
967 Ga0496113_0006616
968 Ga0496113_0042470
969 Ga0496114_0117756
970 Ga0496115_0019682
971 Ga0496115_0027822
972 Ga0496115_0038542
973 Ga0496115_0174178
974 Ga0496117_0002705
975 Ga0496117_0103635
976 Ga0496118_0000698
977 Ga0496118_0006725
978 Ga0496118_0010118
979 Ga0496119_0002149
980 Ga0496119_0023633
981 Ga0496119_0035658
982 Ga0496119_0046469
983 Ga0496119_0121233
984 Ga0496120_0000505
985 Ga0496120_0009890
986 Ga0496120_0177986
987 Ga0496120_0184684
988 Ga0496121_0001198
989 Ga0496121_0001778
990 Ga0496121_0010022
991 Ga0496121_0032282
992 Ga0496121_0222220
993 Ga0496122_0132861
994 Ga0496125_0025836
995 Ga0496126_0003502
996 Ga0496126_0233298
997 Ga0495682_0001483
998 Ga0495682_0003355
999 Ga0501300_012312
1000 Ga0501031_0002340
1001 Ga0501031_0004589
1002 Ga0501032_0098654
1003 Ga0501032_0121509
1004 Ga0501033_0050319
1005 Ga0501033_0081465
1006 Ga0501033_0409128
1007 Ga0501034_0002289
1008 Ga0501034_0386157
1009 Ga0501034_0414282
1010 Ga0501036_0070548
1011 Ga0501036_0084941
1012 Ga0501036_0581690
1013 Ga0501037_0024859
1014 Ga0501037_0034349
1015 Ga0501037_0120426
1016 Ga0501037_0241413
1017 Ga0501038_0006839
1018 Ga0501038_0025833
1019 Ga0501039_0002455
1020 Ga0501039_0019269
1021 Ga0501039_0054822
1022 Ga0501040_0001281
1023 Ga0501040_0031172
1024 Ga0501040_0165056
1025 Ga0501041_0000998
1026 Ga0501042_0004027
1027 Ga0501042_0011146
1028 Ga0501042_0292046
1029 Ga0501043_0137534
1030 Ga0501046_0028278
1031 Ga0501046_0129870
1032 Ga0501047_0102039
1033 Ga0501048_0005038
1034 Ga0501048_0034694
1035 Ga0501048_0047128
1036 Ga0501067_0049349
1037 Ga0501068_0014546
1038 Ga0501069_0000759
1039 Ga0501070_0050193
1040 Ga0501070_0140373
1041 Ga0501071_0004084
1042 Ga0501071_0115109
1043 Ga0501071_0283615
1044 Ga0501072_0002683
1045 Ga0501072_0175911
1046 Ga0501072_0312678
1047 Ga0501073_0013314
1048 Ga0501073_0042629
1049 Ga0501073_0054648
1050 Ga0501073_0227307
1051 Ga0501074_0006764
1052 Ga0501074_0031514
1053 Ga0501074_0061768
1054 Ga0501075_0000491
1055 Ga0501075_0159507
1056 Ga0501076_0002706
1057 Ga0501076_0122088
1058 Ga0501076_0131973
1059 Ga0501077_0004253
1060 Ga0501077_0103344
1061 Ga0501239_002223
1062 Ga0501079_0012112
1063 Ga0501080_0019681
1064 Ga0501080_0064742
1065 Ga0501080_0186262
1066 Ga0501080_0187500
1067 Ga0501080_0374699
1068 Ga0501081_0001389
1069 Ga0501083_0002183
1070 Ga0501083_0003882
1071 Ga0501083_0014533
1072 Ga0501083_0241490
1073 Ga0501241_046467
1074 Ga0501280_001227
1075 Ga0501282_001588
1076 Ga0501035_0006601
1077 Ga0501035_0027804
1078 Ga0501035_0112301
1079 Ga0501035_0144195
1080 Ga0501044_0001614
1081 Ga0501044_0007794
1082 Ga0501044_0021241
1083 Ga0501044_0043349
1084 Ga0501044_0418010
1085 Ga0501045_0011691
1086 nmdc:mga0k408_76839_c1
1087 nmdc:mga05p37_3848_c1
1088 nmdc:mga05p37_429170_c1
1089 nmdc:mga05p37_586549_c1
1090 nmdc:mga05p37_6663_c1
1091 nmdc:mga09592_16048_c1
1092 nmdc:mga09592_29529_c1
1093 nmdc:mga09592_755_c1
1094 nmdc:mga0qj67_10964_c1
1095 nmdc:mga0qj67_741_c1
1096 nmdc:mga06r32_2020_c1
1097 nmdc:mga06r32_331256_c1
1098 nmdc:mga06r32_45332_c1
1099 nmdc:mga06r32_63_c1
1100 nmdc:mga08y16_254_c1
1101 nmdc:mga08y16_57862_c1
1102 Ga0495601_0355123
1103 Ga0495619_0019882
1104 Ga0500643_054119
1105 Ga0500583_0004078
1106 Ga0500597_027597
1107 Ga0500652_089760
1108 Ga0500559_0011170
1109 Ga0500568_0000435
1110 Ga0500573_0000016
1111 Ga0500622_0007927
1112 Ga0500624_000043
1113 Ga0500637_0000089
1114 Ga0501084_0003070
1115 Ga0501084_0005932
1116 Ga0501084_0088532
1117 Ga0501082_0004147
1118 Ga0501082_0006298
1119 Ga0501082_0112190
1120 Ga0530510_0002822
1121 Ga0530510_0095604
1122 Ga0530510_0395219
1123 2523102838
1124 2563063185
1125 2563065059
1126 2572256267
1127 2599105892
1128 2643816959
1129 2643820808
1130 2643881244
1131 2643939381
1132 2644078062
1133 2644528590
1134 2644662017
1135 2644696363
1136 2644700155
1137 2713477393
1138 2713481953
1139 2846955677
1140 2848862338
1141 2921645198
1142 2939633067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

153

240

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

52

125

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

160

246

0.89

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

43

124

0.89

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

170

235

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

47

129

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9846 1 200
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9807 1 198
4mf6-assembly1.cif.gz_A crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit 0.9713 2 199
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9676 3 199
4ikh-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound 0.9672 2 199
ID Description Score Start End Superfamily
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 1 1 84 3.40.30.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9997 3 86 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9771 1 84 3.40.30.10
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9591 2 84 3.40.30.10
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.959 94 204 1.20.1050.130
ID Description Score Start End GO Terms
AF-A0A0S8AWI8-F1-model_v4 Glutathione S-transferase 1.001 1 101 GO:0016740
AF-A0A522J4D5-F1-model_v4 Thiol:disulfide oxidoreductase 1.001 1 84
AF-A0A379WQP5-F1-model_v4 Glutathione-S transferase 0.9987 1 110 GO:0015036
GO:0016740
AF-A0A535B6S1-F1-model_v4 Thiol:disulfide oxidoreductase 0.9967 1 82
AF-A0A3D5Y447-F1-model_v4 Thiol:disulfide oxidoreductase 0.9965 1 71

Map