F465072

General Info

Members Datasets Scaffolds Average Seq Length
572 324 441 311

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10355498|Ga0163162_103554982
Length 372
Sequence MGTSGLFFQFMSVPGDFLTVIRSLSQPFEHKSLPIDKFKARCAQAPKTPQLCLKCRPLNDRRCPMNPDALATLHTHLLTALQTVPAETRRLFHGRGRCWPGLEQLTVDWLQGVVLVSLFKEPDAAELEALKQMLVHIDWSVYGAHTVALQHRYLPQSTTEWLLGEVVDELTITEGGLRYLIDLGKKQNSGLFLDMRYGRNWVREQAQGLRVLNLFAYTCGFSVAAIEGGAEHVVNLDMARGALSRGRDNHRLNGHDLSKVTFLGHDLFKSWAKVTNSGPYDLVIIDPPSFQKGSFLLTKDYQRVLRRLPDLLTAQGTVLACMNDPAFGEDFLIDGVTREAPGLRFEQRLENPPEFPDIDPQSGLKALVFRQG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231021 Pseudomonas sp. GM78 Isolate Nodule
11 2511231022 Pseudomonas sp. GM79 Isolate Nodule
12 2511231024 Pseudomonas sp. GM84 Isolate Nodule
13 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
14 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
15 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
16 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
17 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
18 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
19 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
20 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
21 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
22 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
23 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
24 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
25 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
26 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
27 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
28 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
29 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
30 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
31 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
32 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
33 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
34 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
35 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
36 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
37 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
38 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
39 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
40 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
41 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
42 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
43 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
44 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
45 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
46 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
47 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
48 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
49 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
50 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
51 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
52 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
53 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
54 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
55 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
56 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
57 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
58 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
59 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
60 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
61 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
62 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
63 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
64 2765235841 Pseudomonas putida AA7 Isolate Unclassified
65 2773857670 Pseudomonas sp. 478 Isolate Unclassified
66 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
67 2784132072 Pseudomonas sp. 460 Isolate Unclassified
68 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
69 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
70 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
71 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
72 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
73 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
74 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
75 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
76 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
77 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
78 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
79 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
80 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
81 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
82 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
83 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
84 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
85 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
86 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
87 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
88 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
89 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
90 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
91 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
92 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
93 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
94 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
95 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
96 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
97 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
98 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
99 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
100 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
101 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
102 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
103 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
104 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
105 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
106 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
107 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
108 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
109 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
110 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
111 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
112 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
113 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
114 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
115 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
116 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
117 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
118 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
119 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
120 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
121 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
122 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
123 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
124 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
125 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
126 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
127 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
128 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
129 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
130 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
133 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
134 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
135 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
156 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
196 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
197 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
198 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
199 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
200 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
201 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
202 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
203 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
204 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
205 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
208 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
211 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
215 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
216 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
217 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
278 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
305 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
306 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
307 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
308 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
309 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
310 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
311 8052494512 Pseudomonas putida LD6 Isolate Unclassified
312 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
313 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
314 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
315 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
316 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
317 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
318 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
319 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
320 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
321 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
322 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
323 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
324 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.1
Metatranscriptomes 0
Isolates 22.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 5.24
Nodule 1.92
Rhizoplane 6.99
Rhizosphere 68.36
Stem 0
Stem Tuber 0
Unclassified 17.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1683 2124908027 Bacteria 7205
2 JGI25162J39368_1000014 3300002737 Bacteria 328873
3 JGI25163J39215_1000142 3300002771 Bacteria 28366
4 JGI25164J39214_1000015 3300002772 Bacteria 217395
5 JGI25165J46597_1000027 3300003214 Bacteria 328873
6 Ga0055538_1000146 3300003751 Bacteria 49213
7 Ga0055539_1000196 3300003752 Bacteria 49213
8 Ga0055533_1000198 3300003756 Bacteria 49213
9 Ga0055525_1000268 3300003759 Bacteria 49213
10 Ga0055536_1000050 3300003781 Bacteria 112647
11 Ga0055536_1000148 3300003781 Bacteria 59845
12 Ga0055536_1000256 3300003781 Bacteria 41876
13 Ga0055541_1000129 3300003841 Bacteria 49340
14 Ga0065714_10000657 3300005288 Bacteria 3140
15 Ga0065714_10007277 3300005288 Bacteria 4795
16 Ga0065714_10022941 3300005288 Bacteria 2531
17 Ga0065714_10075127 3300005288 Bacteria 2944
18 Ga0065714_10105305 3300005288 Bacteria 1568
19 Ga0065704_10008784 3300005289 Bacteria 2585
20 Ga0065704_10032342 3300005289 Bacteria 1260
21 Ga0065704_10075416 3300005289 Bacteria 5603
22 Ga0065712_10067898 3300005290 Bacteria 22086
23 Ga0070670_100221064 3300005331 Bacteria 1648
24 Ga0070661_100005856 3300005344 Bacteria 8451
25 Ga0068853_100017511 3300005539 Bacteria 5913
26 Ga0070665_100300877 3300005548 Bacteria 1607
27 Ga0070664_100008194 3300005564 Bacteria 8451
28 Ga0068851_10000763 3300005834 Bacteria 13863
29 Ga0075364_10069913 3300006051 Bacteria 2310
30 Ga0099823_1000543 3300006944 Bacteria 25860
31 Ga0105251_10000034 3300009011 Bacteria 118842
32 Ga0105251_10003786 3300009011 Bacteria 10811
33 Ga0105251_10006021 3300009011 Bacteria 7819
34 Ga0105251_10007673 3300009011 Bacteria 6601
35 Ga0105251_10012158 3300009011 Bacteria 4884
36 Ga0105251_10018748 3300009011 Bacteria 3670
37 Ga0105251_10024831 3300009011 Bacteria 3073
38 Ga0105251_10053196 3300009011 Bacteria 1925
39 Ga0105244_10000378 3300009036 Bacteria 41394
40 Ga0105244_10004850 3300009036 Bacteria 9121
41 Ga0105244_10005690 3300009036 Bacteria 8227
42 Ga0105244_10011740 3300009036 Bacteria 5225
43 Ga0105244_10021025 3300009036 Bacteria 3616
44 Ga0105244_10038738 3300009036 Bacteria 2485
45 Ga0105244_10046959 3300009036 Bacteria 2216
46 Ga0105250_10000063 3300009092 Bacteria 101870
47 Ga0105250_10000090 3300009092 Bacteria 80516
48 Ga0105250_10079776 3300009092 Bacteria 1326
49 Ga0105243_10002712 3300009148 Bacteria 14724
50 Ga0105243_10011148 3300009148 Bacteria 6799
51 Ga0105243_10054871 3300009148 Bacteria 3165
52 Ga0105243_10059116 3300009148 Bacteria 3058
53 Ga0105242_10000890 3300009176 Bacteria 23191
54 Ga0105237_10014204 3300009545 Bacteria 8338
55 Ga0105249_10537972 3300009553 Bacteria 1217
56 Ga0157373_10007278 3300013100 Bacteria 8249
57 Ga0157373_10065097 3300013100 Bacteria 2580
58 Ga0157373_10109647 3300013100 Bacteria 1940
59 Ga0157371_10000379 3300013102 Bacteria 55919
60 Ga0157371_10000899 3300013102 Bacteria 33483
61 Ga0157371_10004548 3300013102 Bacteria 12074
62 Ga0157370_10001536 3300013104 Bacteria 28541
63 Ga0157370_10050682 3300013104 Bacteria 3967
64 Ga0157369_10009021 3300013105 Bacteria 11421
65 Ga0157369_10011491 3300013105 Bacteria 10055
66 Ga0157369_10036746 3300013105 Bacteria 5365
67 Ga0157369_10041782 3300013105 Bacteria 5003
68 Ga0157369_10283603 3300013105 Bacteria 1725
69 Ga0163162_10001806 3300013306 Bacteria 20093
70 Ga0163162_10355498 3300013306 Bacteria 1598
71 Ga0163162_10552771 3300013306 Bacteria 1279
72 Ga0157372_10001089 3300013307 Bacteria 29596
73 Ga0157372_10002158 3300013307 Bacteria 21397
74 Ga0157372_10055263 3300013307 Bacteria 4433
75 Ga0157375_10010699 3300013308 Bacteria 8083
76 Ga0157375_10012693 3300013308 Bacteria 7479
77 Ga0157375_10245496 3300013308 Bacteria 1951
78 Ga0182008_10002066 3300014497 Bacteria 12867
79 Ga0182008_10002587 3300014497 Bacteria 11237
80 Ga0182006_1003067 3300015261 Bacteria 8761
81 Ga0182006_1009531 3300015261 Bacteria 4348
82 Ga0182006_1037229 3300015261 Bacteria 1930
83 Ga0182006_1061687 3300015261 Bacteria 1413
84 Ga0182007_10039462 3300015262 Bacteria 1580
85 Ga0182005_1043554 3300015265 Bacteria 1220
86 Ga0163161_10003244 3300017792 Bacteria 11434
87 Ga0163161_10018441 3300017792 Bacteria 4890
88 Ga0163161_10032208 3300017792 Bacteria 3742
89 Ga0163161_10108741 3300017792 Bacteria 2070
90 Ga0209435_101076 3300025206 Bacteria 3799
91 Ga0209760_100012 3300025207 Bacteria 185483
92 Ga0209784_100058 3300025224 Bacteria 167327
93 Ga0209566_100045 3300025225 Bacteria 258557
94 Ga0209674_100096 3300025226 Bacteria 167418
95 Ga0209147_100056 3300025229 Bacteria 258557
96 Ga0209563_100064 3300025230 Bacteria 258557
97 Ga0207427_100003 3300025231 Bacteria 1035004
98 Ga0209437_100002 3300025233 Bacteria 1574801
99 Ga0209437_108523 3300025233 Bacteria 1637
100 Ga0209258_100243 3300025242 Bacteria 100317
101 Ga0209646_1000343 3300025246 Bacteria 34528
102 Ga0209677_100053 3300025253 Bacteria 167537
103 Ga0209233_1000004 3300025261 Bacteria 1574798
104 Ga0209676_1000154 3300025292 Bacteria 166013
105 Ga0209676_1001957 3300025292 Bacteria 16534
106 Ga0209676_1053294 3300025292 Bacteria 1050
107 Ga0207656_10013123 3300025321 Bacteria 3160
108 Ga0207696_1000010 3300025711 Bacteria 534681
109 Ga0207696_1000041 3300025711 Bacteria 311695
110 Ga0207696_1000045 3300025711 Bacteria 296484
111 Ga0207696_1005499 3300025711 Bacteria 5252
112 Ga0207655_1000191 3300025728 Bacteria 108382
113 Ga0207655_1000461 3300025728 Bacteria 53372
114 Ga0207655_1000645 3300025728 Bacteria 41696
115 Ga0207655_1005901 3300025728 Bacteria 8209
116 Ga0207655_1014416 3300025728 Bacteria 4468
117 Ga0207655_1018962 3300025728 Bacteria 3622
118 Ga0207655_1043260 3300025728 Bacteria 1907
119 Ga0207713_1000030 3300025735 Bacteria 284027
120 Ga0207713_1001465 3300025735 Bacteria 18733
121 Ga0207713_1002877 3300025735 Bacteria 12078
122 Ga0207713_1007782 3300025735 Bacteria 6256
123 Ga0207713_1014926 3300025735 Bacteria 4008
124 Ga0207713_1019446 3300025735 Bacteria 3322
125 Ga0207713_1022980 3300025735 Bacteria 2946
126 Ga0207713_1043522 3300025735 Bacteria 1855
127 Ga0207713_1044392 3300025735 Bacteria 1826
128 Ga0207713_1054789 3300025735 Bacteria 1561
129 Ga0207671_10000165 3300025914 Bacteria 103178
130 Ga0207650_10005529 3300025925 Bacteria 8623
131 Ga0207650_10006721 3300025925 Bacteria 7843
132 Ga0207706_10012856 3300025933 Bacteria 7619
133 Ga0207686_10081058 3300025934 Bacteria 2117
134 Ga0207709_10001850 3300025935 Bacteria 14094
135 Ga0207709_10038465 3300025935 Bacteria 2849
136 Ga0207679_10000036 3300025945 Bacteria 133834
137 Ga0207639_10012322 3300026041 Bacteria 5954
138 Ga0209389_1000018 3300027296 Bacteria 179898
139 Ga0209371_1000369 3300027312 Bacteria 48517
140 Ga0268266_10394209 3300028379 Bacteria 1308
141 Ga0307517_10124519 3300028786 Bacteria 1887
142 Ga0268256_1000314 3300030500 Bacteria 48518
143 Ga0307511_10085440 3300030521 Bacteria 2182
144 Ga0265316_10236402 3300031344 Bacteria 1344
145 Ga0307509_10146074 3300031507 Bacteria 2291
146 Ga0307405_10003786 3300031731 Bacteria 7028
147 Ga0439438_000720 3300041405 Bacteria 14801
148 Ga0439438_000868 3300041405 Bacteria 13505
149 Ga0439438_001708 3300041405 Bacteria 9661
150 Ga0439447_000261 3300041407 Bacteria 18544
151 Ga0439447_003495 3300041407 Bacteria 5579
152 Ga0439466_0000243 3300041411 Bacteria 21378
153 Ga0439466_0000837 3300041411 Bacteria 11712
154 Ga0439466_0000966 3300041411 Bacteria 11046
155 Ga0439466_0009635 3300041411 Bacteria 3610
156 Ga0439466_0041736 3300041411 Bacteria 1529
157 Ga0439465_0009066 3300041413 Bacteria 3136
158 Ga0439437_001677 3300042000 Bacteria 2346
159 Ga0439432_002727 3300042006 Bacteria 6602
160 Ga0439432_009241 3300042006 Bacteria 3442
161 Ga0439432_046241 3300042006 Bacteria 1367
162 Ga0439451_005403 3300042009 Bacteria 2605
163 Ga0439452_000332 3300042010 Bacteria 29434
164 Ga0439452_000618 3300042010 Bacteria 17964
165 Ga0439456_000032 3300042013 Bacteria 52233
166 Ga0439456_005691 3300042013 Bacteria 2534
167 Ga0439456_008907 3300042013 Bacteria 2072
168 Ga0450911_000041 3300042115 Bacteria 58329
169 Ga0450911_000218 3300042115 Bacteria 22469
170 Ga0450911_000727 3300042115 Bacteria 9558
171 Ga0450919_001308 3300042121 Bacteria 3251
172 Ga0450890_000630 3300042127 Bacteria 5127
173 Ga0450900_007941 3300042136 Bacteria 1316
174 Ga0450902_000710 3300042137 Bacteria 4243
175 Ga0450902_000711 3300042137 Bacteria 4239
176 Ga0450902_006162 3300042137 Bacteria 1831
177 Ga0450903_013998 3300042138 Bacteria 1272
178 Ga0450904_000034 3300042139 Bacteria 30716
179 Ga0450905_000795 3300042142 Bacteria 3895
180 Ga0450905_004670 3300042142 Bacteria 1819
181 Ga0450906_008321 3300042145 Bacteria 2011
182 Ga0450907_000001 3300042146 Bacteria 236562
183 Ga0450907_000713 3300042146 Bacteria 8561
184 Ga0450910_001479 3300042147 Bacteria 2968
185 Ga0439446_0001760 3300042156 Bacteria 5040
186 Ga0450908_000102 3300042184 Bacteria 17114
187 Ga0450909_000419 3300042185 Bacteria 5464
188 Ga0450909_000420 3300042185 Bacteria 5456
189 Ga0439434_0000001 3300042435 Bacteria 86314
190 Ga0439434_0019871 3300042435 Bacteria 2015
191 Ga0439464_0001775 3300042439 Bacteria 5195
192 Ga0439464_0002031 3300042439 Bacteria 4912
193 Ga0450916_002079 3300042530 Bacteria 2079
194 Ga0450918_013150 3300042531 Bacteria 1440
195 Ga0450893_0001994 3300042532 Bacteria 3182
196 Ga0450901_000565 3300042533 Bacteria 4362
197 Ga0451577_0069376 3300042876 Bacteria 3143
198 Ga0439440_0005669 3300042993 Bacteria 2484
199 Ga0495617_008823 3300046452 Bacteria 3472
200 Ga0495617_027136 3300046452 Bacteria 1927
201 Ga0495627_000009 3300046453 Bacteria 463964
202 Ga0495627_004523 3300046453 Bacteria 5802
203 Ga0495627_004617 3300046453 Bacteria 5715
204 Ga0495603_0004814 3300046455 Bacteria 8066
205 Ga0495603_0006243 3300046455 Bacteria 7125
206 Ga0495603_0021165 3300046455 Bacteria 3937
207 Ga0495590_0024757 3300046457 Bacteria 2114
208 Ga0495591_000044 3300046458 Bacteria 145782
209 Ga0495591_000558 3300046458 Bacteria 28646
210 Ga0495591_001688 3300046458 Bacteria 13201
211 Ga0495591_003673 3300046458 Bacteria 7802
212 Ga0495638_0180311 3300046460 Bacteria 1205
213 Ga0495653_0004419 3300046463 Bacteria 11367
214 Ga0495653_0019288 3300046463 Bacteria 5530
215 Ga0495653_0059167 3300046463 Bacteria 2909
216 Ga0495653_0125245 3300046463 Bacteria 1825
217 Ga0495650_0002379 3300046471 Bacteria 15437
218 Ga0495650_0020151 3300046471 Bacteria 3259
219 Ga0495582_0001789 3300046473 Bacteria 12138
220 Ga0495605_0000319 3300046474 Bacteria 50232
221 Ga0495605_0000572 3300046474 Bacteria 29906
222 Ga0495605_0006718 3300046474 Bacteria 6580
223 Ga0495605_0008096 3300046474 Bacteria 5946
224 Ga0495639_0003018 3300046475 Bacteria 7331
225 Ga0495639_0011805 3300046475 Bacteria 3768
226 Ga0495584_0000054 3300046491 Bacteria 85945
227 Ga0495584_0000086 3300046491 Bacteria 64500
228 Ga0495584_0028451 3300046491 Bacteria 2832
229 Ga0495585_0000441 3300046492 Bacteria 39743
230 Ga0495585_0001050 3300046492 Bacteria 22855
231 Ga0495585_0005507 3300046492 Bacteria 7969
232 Ga0495594_0001999 3300046499 Bacteria 10621
233 Ga0495607_0000033 3300046501 Bacteria 149382
234 Ga0495607_0001071 3300046501 Bacteria 24981
235 Ga0495607_0001195 3300046501 Bacteria 23459
236 Ga0495607_0002338 3300046501 Bacteria 15520
237 Ga0495607_0004716 3300046501 Bacteria 9973
238 Ga0495607_0037859 3300046501 Bacteria 2893
239 Ga0495607_0087626 3300046501 Bacteria 1694
240 Ga0495607_0106713 3300046501 Bacteria 1490
241 Ga0495607_0115783 3300046501 Bacteria 1414
242 Ga0495607_0127717 3300046501 Bacteria 1327
243 Ga0495583_0000824 3300046506 Bacteria 37940
244 Ga0495583_0001526 3300046506 Bacteria 22957
245 Ga0495583_0106973 3300046506 Bacteria 1188
246 Ga0495606_0000293 3300046507 Bacteria 86455
247 Ga0495606_0006235 3300046507 Bacteria 11075
248 Ga0495606_0011906 3300046507 Bacteria 7036
249 Ga0495606_0012538 3300046507 Bacteria 6789
250 Ga0495606_0023146 3300046507 Bacteria 4510
251 Ga0495610_0004251 3300046512 Bacteria 10666
252 Ga0495610_0008874 3300046512 Bacteria 6441
253 Ga0495610_0015580 3300046512 Bacteria 4409
254 Ga0495610_0016042 3300046512 Bacteria 4330
255 Ga0495616_0024226 3300046513 Bacteria 3257
256 Ga0495620_0000200 3300046515 Bacteria 45504
257 Ga0495620_0000985 3300046515 Bacteria 17572
258 Ga0495620_0003703 3300046515 Bacteria 8727
259 Ga0495628_0352701 3300046516 Bacteria 1081
260 Ga0495630_0011457 3300046517 Bacteria 6420
261 Ga0495630_0076355 3300046517 Bacteria 2524
262 Ga0495630_0085983 3300046517 Bacteria 2374
263 Ga0495630_0409187 3300046517 Bacteria 1039
264 Ga0495631_0000002 3300046518 Bacteria 178694
265 Ga0495631_0011222 3300046518 Bacteria 4410
266 Ga0495631_0051953 3300046518 Bacteria 1790
267 Ga0495632_0003728 3300046519 Bacteria 10675
268 Ga0495632_0004432 3300046519 Bacteria 9544
269 Ga0495632_0016929 3300046519 Bacteria 4040
270 Ga0495632_0159633 3300046519 Bacteria 1039
271 Ga0495637_0000968 3300046520 Bacteria 18289
272 Ga0495637_0003101 3300046520 Bacteria 8877
273 Ga0495637_0008065 3300046520 Bacteria 5186
274 Ga0495637_0023055 3300046520 Bacteria 2833
275 Ga0495643_0000148 3300046522 Bacteria 113969
276 Ga0495643_0000451 3300046522 Bacteria 52778
277 Ga0495643_0000488 3300046522 Bacteria 50207
278 Ga0495643_0001627 3300046522 Bacteria 19823
279 Ga0495643_0021627 3300046522 Bacteria 3686
280 Ga0495643_0043375 3300046522 Bacteria 2448
281 Ga0495643_0096824 3300046522 Bacteria 1517
282 Ga0495644_0010930 3300046523 Bacteria 3498
283 Ga0495648_0001343 3300046524 Bacteria 24306
284 Ga0495648_0003677 3300046524 Bacteria 13401
285 Ga0495648_0009232 3300046524 Bacteria 7670
286 Ga0495648_0083189 3300046524 Bacteria 1814
287 Ga0495666_0010679 3300046526 Bacteria 4579
288 Ga0495666_0048420 3300046526 Bacteria 2047
289 Ga0495666_0102421 3300046526 Bacteria 1348
290 Ga0495654_0001726 3300046530 Bacteria 14686
291 Ga0495654_0004313 3300046530 Bacteria 8481
292 Ga0495654_0005997 3300046530 Bacteria 6978
293 Ga0495654_0012671 3300046530 Bacteria 4526
294 Ga0495654_0056920 3300046530 Bacteria 1889
295 Ga0495586_0104443 3300046535 Bacteria 1574
296 Ga0495587_0000989 3300046536 Bacteria 18668
297 Ga0495587_0041805 3300046536 Bacteria 2734
298 Ga0495609_0019722 3300046538 Bacteria 3118
299 Ga0495597_0000008 3300046542 Bacteria 232976
300 Ga0495597_0003494 3300046542 Bacteria 9115
301 Ga0495597_0060268 3300046542 Bacteria 1656
302 Ga0495597_0160787 3300046542 Bacteria 916
303 Ga0495645_0262349 3300046543 Bacteria 1143
304 Ga0495622_0005999 3300046557 Bacteria 5644
305 Ga0495633_0015369 3300046558 Bacteria 3972
306 Ga0495633_0018563 3300046558 Bacteria 3529
307 Ga0495668_0019820 3300046616 Bacteria 3871
308 Ga0495634_0000572 3300046642 Bacteria 35710
309 Ga0495611_0013483 3300046648 Bacteria 3481
310 Ga0495625_0002382 3300046660 Bacteria 20439
311 Ga0495625_0011666 3300046660 Bacteria 7148
312 Ga0495625_0014699 3300046660 Bacteria 6235
313 Ga0495625_0018987 3300046660 Bacteria 5350
314 Ga0495625_0040030 3300046660 Bacteria 3421
315 Ga0495635_0000115 3300046663 Bacteria 47781
316 Ga0495659_0007080 3300046664 Bacteria 3549
317 Ga0495661_0000066 3300046665 Bacteria 127316
318 Ga0495661_0000464 3300046665 Bacteria 42993
319 Ga0495661_0004926 3300046665 Bacteria 9553
320 Ga0495661_0007882 3300046665 Bacteria 7399
321 Ga0495661_0009465 3300046665 Bacteria 6687
322 Ga0495661_0013546 3300046665 Bacteria 5473
323 Ga0495588_0008021 3300046674 Bacteria 4827
324 Ga0495657_0026028 3300046675 Bacteria 4148
325 Ga0495623_0000178 3300046679 Bacteria 39932
326 Ga0495623_0019830 3300046679 Bacteria 4346
327 Ga0495646_0008931 3300046680 Bacteria 6363
328 Ga0495646_0136524 3300046680 Bacteria 1375
329 Ga0495670_0000103 3300046691 Bacteria 37384
330 Ga0495671_0000138 3300046692 Bacteria 64535
331 Ga0495671_0000525 3300046692 Bacteria 29114
332 Ga0495671_0001213 3300046692 Bacteria 17655
333 Ga0495671_0017302 3300046692 Bacteria 3838
334 Ga0495671_0023616 3300046692 Bacteria 3211
335 Ga0495671_0026346 3300046692 Bacteria 3016
336 Ga0495671_0098668 3300046692 Bacteria 1428
337 Ga0495649_0000241 3300046694 Bacteria 48093
338 Ga0495589_0005352 3300046794 Bacteria 6771
339 Ga0495589_0039957 3300046794 Bacteria 2343
340 Ga0495660_0000209 3300046810 Bacteria 59831
341 Ga0495660_0000311 3300046810 Bacteria 44220
342 Ga0495660_0001030 3300046810 Bacteria 20218
343 Ga0495660_0013736 3300046810 Bacteria 4693
344 Ga0495660_0036178 3300046810 Bacteria 2755
345 Ga0495604_0153679 3300047317 Bacteria 1632
346 Ga0495672_0005703 3300047320 Bacteria 9809
347 Ga0495672_0006243 3300047320 Bacteria 9294
348 Ga0495672_0119239 3300047320 Bacteria 1405
349 Ga0495680_0000459 3300047322 Bacteria 45776
350 Ga0495680_0017091 3300047322 Bacteria 6206
351 Ga0495680_0037726 3300047322 Bacteria 3869
352 Ga0495683_0000188 3300047323 Bacteria 60018
353 Ga0495683_0008472 3300047323 Bacteria 5499
354 Ga0495679_001080 3300047446 Bacteria 16522
355 Ga0495679_003997 3300047446 Bacteria 6940
356 Ga0495679_004309 3300047446 Bacteria 6598
357 Ga0495679_010795 3300047446 Bacteria 3563
358 Ga0495673_0000093 3300047469 Bacteria 185841
359 Ga0495673_0000210 3300047469 Bacteria 88390
360 Ga0495673_0000715 3300047469 Bacteria 32151
361 Ga0495673_0000815 3300047469 Bacteria 29262
362 Ga0495673_0006805 3300047469 Bacteria 6676
363 Ga0495673_0007716 3300047469 Bacteria 6144
364 Ga0495673_0008286 3300047469 Bacteria 5861
365 Ga0495681_0000075 3300047470 Bacteria 89696
366 Ga0495681_0003026 3300047470 Bacteria 11814
367 Ga0495681_0006882 3300047470 Bacteria 7377
368 Ga0495681_0014278 3300047470 Bacteria 4560
369 Ga0495686_0279668 3300047472 Bacteria 928
370 Ga0495593_0014975 3300047673 Bacteria 4402
371 Ga0495593_0064586 3300047673 Bacteria 1910
372 Ga0495593_0070078 3300047673 Bacteria 1822
373 Ga0495602_0156085 3300048088 Bacteria 1787
374 Ga0495626_0000065 3300048091 Bacteria 141689
375 Ga0495626_0010091 3300048091 Bacteria 5069
376 Ga0496102_0000073 3300048905 Bacteria 149887
377 Ga0496103_0000363 3300048906 Bacteria 40883
378 Ga0496110_0320328 3300048913 Bacteria 1412
379 Ga0496112_0102108 3300048915 Bacteria 2838
380 Ga0496114_0004290 3300048917 Bacteria 11034
381 Ga0496114_0040554 3300048917 Bacteria 3855
382 Ga0496115_0060793 3300048918 Bacteria 3045
383 Ga0496116_0000046 3300048919 Bacteria 323643
384 Ga0496117_0001271 3300048920 Bacteria 37415
385 Ga0496117_0002656 3300048920 Bacteria 22160
386 Ga0496117_0002915 3300048920 Bacteria 20699
387 Ga0496117_0004322 3300048920 Bacteria 15803
388 Ga0496117_0018422 3300048920 Bacteria 5781
389 Ga0496117_0044975 3300048920 Bacteria 3193
390 Ga0496117_0179102 3300048920 Bacteria 1221
391 Ga0496118_0009756 3300048921 Bacteria 9629
392 Ga0496118_0013294 3300048921 Bacteria 7799
393 Ga0496118_0021881 3300048921 Bacteria 5609
394 Ga0496118_0028497 3300048921 Bacteria 4701
395 Ga0496118_0040994 3300048921 Bacteria 3673
396 Ga0496119_0000541 3300048922 Bacteria 51479
397 Ga0496119_0020822 3300048922 Bacteria 4764
398 Ga0496119_0023509 3300048922 Bacteria 4366
399 Ga0496120_0004162 3300048923 Bacteria 12424
400 Ga0496120_0015956 3300048923 Bacteria 4929
401 Ga0496121_0000093 3300048924 Bacteria 212965
402 Ga0496121_0003044 3300048924 Bacteria 24325
403 Ga0496121_0080727 3300048924 Bacteria 2577
404 Ga0496122_0001401 3300048925 Bacteria 39147
405 Ga0496122_0001577 3300048925 Bacteria 35833
406 Ga0496122_0025436 3300048925 Bacteria 5140
407 Ga0496122_0141576 3300048925 Bacteria 1503
408 Ga0496123_0000303 3300048926 Bacteria 95638
409 Ga0496123_0000437 3300048926 Bacteria 74882
410 Ga0496123_0015658 3300048926 Bacteria 6205
411 Ga0496123_0078240 3300048926 Bacteria 2027
412 Ga0496124_0000338 3300048927 Bacteria 85856
413 Ga0496124_0001949 3300048927 Bacteria 28205
414 Ga0496124_0004408 3300048927 Bacteria 16421
415 Ga0496124_0009729 3300048927 Bacteria 9841
416 Ga0496124_0009976 3300048927 Bacteria 9702
417 Ga0496124_0029732 3300048927 Bacteria 4861
418 Ga0496124_0043945 3300048927 Bacteria 3837
419 Ga0496124_0079026 3300048927 Bacteria 2710
420 Ga0496124_0163063 3300048927 Bacteria 1735
421 Ga0496125_0000861 3300048928 Bacteria 48649
422 Ga0496125_0003893 3300048928 Bacteria 17632
423 Ga0496125_0004096 3300048928 Bacteria 17057
424 Ga0496125_0005291 3300048928 Bacteria 14440
425 Ga0496125_0035093 3300048928 Bacteria 4407
426 Ga0496125_0076252 3300048928 Bacteria 2590
427 Ga0496125_0078884 3300048928 Bacteria 2528
428 Ga0496125_0101283 3300048928 Bacteria 2120
429 Ga0496125_0158435 3300048928 Bacteria 1542
430 Ga0496126_0032170 3300048929 Bacteria 4945
431 Ga0496126_0034832 3300048929 Bacteria 4724
432 Ga0496126_0063381 3300048929 Bacteria 3313
433 Ga0496126_0071857 3300048929 Bacteria 3079
434 Ga0495678_002643 3300049459 Bacteria 11898
435 Ga0495678_084975 3300049459 Bacteria 1128
436 Ga0495682_0000554 3300049460 Bacteria 25641
437 Ga0495682_0005133 3300049460 Bacteria 5483
438 Ga0501034_0000084 3300049571 Bacteria 168283
439 Ga0501226_000019 3300049853 Bacteria 143773
440 Ga0500659_0001721 3300053135 Bacteria 13666
441 Ga0500634_0007555 3300053161 Bacteria 5374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0160787 Ga0495597_0160787_39_839 266
2 3300047472 Ga0495686_0279668 Ga0495686_0279668_82_903 266
3 3300046522 Ga0495643_0096824 Ga0495643_0096824_563_1471 274
4 3300048913 Ga0496110_0320328 Ga0496110_0320328_29_934 299
5 iso_pu_bacteria 2599185167 2599401788 299
6 iso_pu_bacteria 2599185179 2599454021 299
7 iso_pu_bacteria 2599185190 2599515595 299
8 iso_pu_bacteria 2599185191 2599521300 299
9 iso_pu_bacteria 2599185290 2599894974 299
10 iso_pu_bacteria 2834028612 2834030033 299
11 iso_pu_bacteria 2908446538 2908449997 299
12 iso_pu_bacteria 2931390751 2931394172 299
13 iso_pu_bacteria 2945928738 2945933710 299
14 iso_pu_bacteria 2946006987 2946010118 299
15 iso_pu_bacteria 8054285046 8054288391 299
16 iso_pu_bacteria 8055817908 8055820626 299
17 iso_pu_bacteria 8056161164 8056166316 299
18 3300009036 Ga0105244_10011740 Ga0105244_100117402 300
19 3300048917 Ga0496114_0004290 Ga0496114_0004290_10003_10908 300
20 3300048920 Ga0496117_0002915 Ga0496117_0002915_17528_18433 300
21 3300048921 Ga0496118_0040994 Ga0496118_0040994_74_979 300
22 3300048927 Ga0496124_0004408 Ga0496124_0004408_2522_3427 300
23 3300048928 Ga0496125_0035093 Ga0496125_0035093_2758_3663 300
24 iso_pu_bacteria 2597489888 2597863778 301
25 iso_pu_bacteria 2597489889 2597869992 301
26 iso_pu_bacteria 2599185189 2599509230 301
27 iso_pu_bacteria 2600255296 2601690520 301
28 iso_pu_bacteria 2643221571 2643869854 301
29 iso_pu_bacteria 2643221713 2644621096 301
30 iso_pu_bacteria 2721755607 2723248949 301
31 iso_pu_bacteria 2842826826 2842831665 301
32 iso_pu_bacteria 2842837860 2842840082 301
33 iso_pu_bacteria 2860867994 2860870876 301
34 iso_pu_bacteria 2929189879 2929192338 301
35 iso_pu_bacteria 2946027586 2946031104 301
36 iso_pu_bacteria 2947233263 2947237613 301
37 iso_pu_bacteria 8054347763 8054348114 301
38 iso_pu_bacteria 8055878733 8055878982 301
39 iso_pu_bacteria 8056131705 8056134555 301
40 iso_pu_bacteria 8056148874 8056154599 301
41 3300005288 Ga0065714_10075127 Ga0065714_100751271 303
42 3300005331 Ga0070670_100221064 Ga0070670_1002210641 303
43 3300005539 Ga0068853_100017511 Ga0068853_1000175114 303
44 3300005834 Ga0068851_10000763 Ga0068851_100007631 303
45 3300009011 Ga0105251_10007673 Ga0105251_100076733 303
46 3300013100 Ga0157373_10109647 Ga0157373_101096471 303
47 3300013104 Ga0157370_10050682 Ga0157370_100506822 303
48 3300013105 Ga0157369_10036746 Ga0157369_100367465 303
49 3300013105 Ga0157369_10041782 Ga0157369_100417824 303
50 3300013308 Ga0157375_10012693 Ga0157375_100126934 303
51 3300013308 Ga0157375_10245496 Ga0157375_102454962 303
52 3300015261 Ga0182006_1037229 Ga0182006_10372293 303
53 3300015262 Ga0182007_10039462 Ga0182007_100394621 303
54 3300017792 Ga0163161_10018441 Ga0163161_100184414 303
55 3300025321 Ga0207656_10013123 Ga0207656_100131234 303
56 3300025925 Ga0207650_10005529 Ga0207650_1000552910 303
57 3300025933 Ga0207706_10012856 Ga0207706_100128562 303
58 3300026041 Ga0207639_10012322 Ga0207639_100123224 303
59 3300028786 Ga0307517_10124519 Ga0307517_101245192 303
60 3300030521 Ga0307511_10085440 Ga0307511_100854402 303
61 3300031507 Ga0307509_10146074 Ga0307509_101460742 303
62 3300042006 Ga0439432_009241 Ga0439432_009241_1033_1947 303
63 3300046506 Ga0495583_0000824 Ga0495583_0000824_34380_35294 303
64 3300046530 Ga0495654_0005997 Ga0495654_0005997_1614_2528 303
65 3300046665 Ga0495661_0013546 Ga0495661_0013546_2727_3641 303
66 3300047446 Ga0495679_001080 Ga0495679_001080_14582_15496 303
67 3300047446 Ga0495679_010795 Ga0495679_010795_1089_2003 303
68 3300048922 Ga0496119_0020822 Ga0496119_0020822_3687_4601 303
69 3300048923 Ga0496120_0015956 Ga0496120_0015956_3843_4757 303
70 3300048926 Ga0496123_0015658 Ga0496123_0015658_3821_4738 303
71 3300048928 Ga0496125_0003893 Ga0496125_0003893_12884_13801 303
72 3300048928 Ga0496125_0076252 Ga0496125_0076252_1171_2085 303
73 3300053161 Ga0500634_0007555 Ga0500634_0007555_1767_2681 303
74 iso_pu_bacteria 2511231024 2511376196 303
75 iso_pu_bacteria 2554235231 2555249241 303
76 iso_pu_bacteria 2599185288 2599881220 303
77 iso_pu_bacteria 2599185303 2599949492 303
78 iso_pu_bacteria 2600255389 2602012539 303
79 iso_pu_bacteria 2619619299 2621299430 303
80 iso_pu_bacteria 2675903420 2677900987 303
81 iso_pu_bacteria 2738541265 2738675073 303
82 iso_pu_bacteria 2738541282 2738753572 303
83 iso_pu_bacteria 2738541294 2738810360 303
84 iso_pu_bacteria 2738541303 2738862484 303
85 iso_pu_bacteria 2738541309 2738897720 303
86 iso_pu_bacteria 2765235841 2765582838 303
87 iso_pu_bacteria 2808606385 2808978371 303
88 iso_pu_bacteria 2808606388 2808994102 303
89 iso_pu_bacteria 2816332298 2817490793 303
90 iso_pu_bacteria 2823421272 2823422434 303
91 iso_pu_bacteria 2852612431 2852617603 303
92 iso_pu_bacteria 2852667396 2852672278 303
93 iso_pu_bacteria 2912963787 2912965385 303
94 iso_pu_bacteria 2919155634 2919157766 303
95 iso_pu_bacteria 2945961074 2945964068 303
96 iso_pu_bacteria 3007872151 3007876820 303
97 iso_pu_bacteria 8034962539 8034964285 303
98 iso_pu_bacteria 8054503363 8054505979 303
99 iso_pu_bacteria 8054929484 8054930081 303
100 iso_pu_bacteria 8056115690 8056119706 303
101 3300003751 Ga0055538_1000146 Ga0055538_100014638 305
102 3300003752 Ga0055539_1000196 Ga0055539_100019638 305
103 3300003756 Ga0055533_1000198 Ga0055533_100019838 305
104 3300003759 Ga0055525_1000268 Ga0055525_100026838 305
105 3300003841 Ga0055541_1000129 Ga0055541_100012938 305
106 3300009011 Ga0105251_10000034 Ga0105251_100000349 305
107 3300009092 Ga0105250_10000063 Ga0105250_100000636 305
108 3300025206 Ga0209435_101076 Ga0209435_1010761 305
109 3300025224 Ga0209784_100058 Ga0209784_1000583 305
110 3300025225 Ga0209566_100045 Ga0209566_1000453 305
111 3300025226 Ga0209674_100096 Ga0209674_1000963 305
112 3300025229 Ga0209147_100056 Ga0209147_1000563 305
113 3300025230 Ga0209563_100064 Ga0209563_1000643 305
114 3300025233 Ga0209437_108523 Ga0209437_1085232 305
115 3300025242 Ga0209258_100243 Ga0209258_1002433 305
116 3300025246 Ga0209646_1000343 Ga0209646_100034311 305
117 3300025253 Ga0209677_100053 Ga0209677_1000533 305
118 3300025711 Ga0207696_1000045 Ga0207696_1000045209 305
119 3300025735 Ga0207713_1000030 Ga0207713_1000030199 305
120 3300025925 Ga0207650_10006721 Ga0207650_100067213 305
121 3300046530 Ga0495654_0056920 Ga0495654_0056920_22_942 305
122 3300048928 Ga0496125_0078884 Ga0496125_0078884_732_1652 305
123 iso_pu_bacteria 2842805378 2842809016 306
124 3300005289 Ga0065704_10008784 Ga0065704_100087842 307
125 3300005289 Ga0065704_10032342 Ga0065704_100323421 307
126 3300005289 Ga0065704_10075416 Ga0065704_100754162 307
127 3300005344 Ga0070661_100005856 Ga0070661_1000058563 307
128 3300005548 Ga0070665_100300877 Ga0070665_1003008772 307
129 3300005564 Ga0070664_100008194 Ga0070664_1000081943 307
130 3300006051 Ga0075364_10069913 Ga0075364_100699132 307
131 3300009011 Ga0105251_10003786 Ga0105251_100037865 307
132 3300009011 Ga0105251_10006021 Ga0105251_100060215 307
133 3300009011 Ga0105251_10018748 Ga0105251_100187482 307
134 3300009011 Ga0105251_10024831 Ga0105251_100248311 307
135 3300009011 Ga0105251_10053196 Ga0105251_100531962 307
136 3300009036 Ga0105244_10000378 Ga0105244_100003789 307
137 3300009036 Ga0105244_10005690 Ga0105244_100056907 307
138 3300009036 Ga0105244_10038738 Ga0105244_100387382 307
139 3300009092 Ga0105250_10000090 Ga0105250_1000009033 307
140 3300009092 Ga0105250_10079776 Ga0105250_100797761 307
141 3300009148 Ga0105243_10011148 Ga0105243_100111483 307
142 3300009148 Ga0105243_10059116 Ga0105243_100591163 307
143 3300009176 Ga0105242_10000890 Ga0105242_100008902 307
144 3300009545 Ga0105237_10014204 Ga0105237_100142042 307
145 3300013100 Ga0157373_10007278 Ga0157373_100072787 307
146 3300013105 Ga0157369_10011491 Ga0157369_100114917 307
147 3300013306 Ga0163162_10355498 Ga0163162_103554982 307
148 3300013306 Ga0163162_10552771 Ga0163162_105527711 307
149 3300013307 Ga0157372_10002158 Ga0157372_1000215812 307
150 3300013307 Ga0157372_10055263 Ga0157372_100552632 307
151 3300013308 Ga0157375_10010699 Ga0157375_100106996 307
152 3300014497 Ga0182008_10002587 Ga0182008_1000258713 307
153 3300017792 Ga0163161_10108741 Ga0163161_101087411 307
154 3300025292 Ga0209676_1001957 Ga0209676_10019576 307
155 3300025711 Ga0207696_1000010 Ga0207696_1000010366 307
156 3300025711 Ga0207696_1000041 Ga0207696_100004132 307
157 3300025728 Ga0207655_1000191 Ga0207655_100019174 307
158 3300025728 Ga0207655_1000461 Ga0207655_100046110 307
159 3300025728 Ga0207655_1000645 Ga0207655_10006459 307
160 3300025728 Ga0207655_1014416 Ga0207655_10144162 307
161 3300025735 Ga0207713_1001465 Ga0207713_10014656 307
162 3300025735 Ga0207713_1002877 Ga0207713_100287710 307
163 3300025735 Ga0207713_1007782 Ga0207713_10077824 307
164 3300025735 Ga0207713_1014926 Ga0207713_10149264 307
165 3300025735 Ga0207713_1022980 Ga0207713_10229801 307
166 3300025735 Ga0207713_1054789 Ga0207713_10547892 307
167 3300025914 Ga0207671_10000165 Ga0207671_1000016596 307
168 3300025934 Ga0207686_10081058 Ga0207686_100810582 307
169 3300025935 Ga0207709_10038465 Ga0207709_100384653 307
170 3300025945 Ga0207679_10000036 Ga0207679_100000367 307
171 3300027312 Ga0209371_1000369 Ga0209371_100036942 307
172 3300028379 Ga0268266_10394209 Ga0268266_103942092 307
173 3300030500 Ga0268256_1000314 Ga0268256_100031412 307
174 3300031344 Ga0265316_10236402 Ga0265316_102364022 307
175 3300031731 Ga0307405_10003786 Ga0307405_100037863 307
176 3300041405 Ga0439438_001708 Ga0439438_001708_6356_7279 307
177 3300042013 Ga0439456_000032 Ga0439456_000032_4534_5493 307
178 3300042136 Ga0450900_007941 Ga0450900_007941_146_1069 307
179 3300042137 Ga0450902_000711 Ga0450902_000711_3302_4225 307
180 3300042142 Ga0450905_000795 Ga0450905_000795_80_1003 307
181 3300042439 Ga0439464_0001775 Ga0439464_0001775_2287_3216 307
182 3300042533 Ga0450901_000565 Ga0450901_000565_2219_3142 307
183 3300046453 Ga0495627_004617 Ga0495627_004617_1008_1934 307
184 3300046458 Ga0495591_003673 Ga0495591_003673_2977_3903 307
185 3300046501 Ga0495607_0115783 Ga0495607_0115783_255_1181 307
186 3300046507 Ga0495606_0012538 Ga0495606_0012538_1632_2558 307
187 3300046515 Ga0495620_0000200 Ga0495620_0000200_14233_15159 307
188 3300046519 Ga0495632_0003728 Ga0495632_0003728_2647_3573 307
189 3300046522 Ga0495643_0000451 Ga0495643_0000451_22042_22968 307
190 3300046522 Ga0495643_0000488 Ga0495643_0000488_35371_36297 307
191 3300046524 Ga0495648_0001343 Ga0495648_0001343_11222_12148 307
192 3300046665 Ga0495661_0000464 Ga0495661_0000464_38077_39003 307
193 3300046794 Ga0495589_0005352 Ga0495589_0005352_1481_2407 307
194 3300048917 Ga0496114_0040554 Ga0496114_0040554_2079_3005 307
195 3300048920 Ga0496117_0001271 Ga0496117_0001271_30122_31048 307
196 3300048920 Ga0496117_0004322 Ga0496117_0004322_4292_5218 307
197 3300048920 Ga0496117_0018422 Ga0496117_0018422_1030_1956 307
198 3300048920 Ga0496117_0044975 Ga0496117_0044975_1058_1984 307
199 3300048921 Ga0496118_0009756 Ga0496118_0009756_4152_5078 307
200 3300048921 Ga0496118_0021881 Ga0496118_0021881_3053_3979 307
201 3300048921 Ga0496118_0028497 Ga0496118_0028497_183_1109 307
202 3300048922 Ga0496119_0000541 Ga0496119_0000541_42778_43704 307
203 3300048922 Ga0496119_0023509 Ga0496119_0023509_3064_3990 307
204 3300048923 Ga0496120_0004162 Ga0496120_0004162_7730_8656 307
205 3300048925 Ga0496122_0001401 Ga0496122_0001401_34297_35223 307
206 3300048925 Ga0496122_0025436 Ga0496122_0025436_55_981 307
207 3300048925 Ga0496122_0141576 Ga0496122_0141576_380_1306 307
208 3300048926 Ga0496123_0000437 Ga0496123_0000437_16677_17603 307
209 3300048926 Ga0496123_0078240 Ga0496123_0078240_623_1549 307
210 3300048927 Ga0496124_0000338 Ga0496124_0000338_76119_77045 307
211 3300048927 Ga0496124_0009729 Ga0496124_0009729_2229_3155 307
212 3300048927 Ga0496124_0009976 Ga0496124_0009976_293_1282 307
213 3300048927 Ga0496124_0043945 Ga0496124_0043945_1728_2654 307
214 3300048927 Ga0496124_0079026 Ga0496124_0079026_1452_2378 307
215 3300048927 Ga0496124_0163063 Ga0496124_0163063_127_1053 307
216 3300048928 Ga0496125_0000861 Ga0496125_0000861_47510_48436 307
217 3300048928 Ga0496125_0004096 Ga0496125_0004096_8809_9735 307
218 3300048928 Ga0496125_0158435 Ga0496125_0158435_520_1446 307
219 3300048929 Ga0496126_0032170 Ga0496126_0032170_390_1316 307
220 3300048929 Ga0496126_0034832 Ga0496126_0034832_3760_4686 307
221 3300048929 Ga0496126_0063381 Ga0496126_0063381_178_1104 307
222 3300048929 Ga0496126_0071857 Ga0496126_0071857_640_1566 307
223 iso_pu_bacteria 2510065053 2510284365 307
224 iso_pu_bacteria 2510065055 2510295480 307
225 iso_pu_bacteria 2510065058 2510312451 307
226 iso_pu_bacteria 2511231004 2511258505 307
227 iso_pu_bacteria 2511231008 2511280038 307
228 iso_pu_bacteria 2511231016 2511327807 307
229 iso_pu_bacteria 2511231018 2511340463 307
230 iso_pu_bacteria 2511231019 2511346659 307
231 iso_pu_bacteria 2511231021 2511353572 307
232 iso_pu_bacteria 2554235132 2554816330 307
233 iso_pu_bacteria 2554235341 2555669442 307
234 iso_pu_bacteria 2599185155 2599326965 307
235 iso_pu_bacteria 2599185160 2599353554 307
236 iso_pu_bacteria 2599185161 2599363954 307
237 iso_pu_bacteria 2599185162 2599370274 307
238 iso_pu_bacteria 2599185163 2599372581 307
239 iso_pu_bacteria 2599185164 2599378662 307
240 iso_pu_bacteria 2599185165 2599383961 307
241 iso_pu_bacteria 2599185166 2599391440 307
242 iso_pu_bacteria 2599185168 2599407686 307
243 iso_pu_bacteria 2599185181 2599460388 307
244 iso_pu_bacteria 2599185182 2599470787 307
245 iso_pu_bacteria 2599185185 2599484613 307
246 iso_pu_bacteria 2599185186 2599489409 307
247 iso_pu_bacteria 2599185257 2599802118 307
248 iso_pu_bacteria 2599185356 2600212997 307
249 iso_pu_bacteria 2600254931 2600367394 307
250 iso_pu_bacteria 2600255283 2601624334 307
251 iso_pu_bacteria 2600255313 2601773165 307
252 iso_pu_bacteria 2606217733 2608380271 307
253 iso_pu_bacteria 2643221633 2644186967 307
254 iso_pu_bacteria 2667528171 2671094872 307
255 iso_pu_bacteria 2671180172 2671769066 307
256 iso_pu_bacteria 2738541271 2738691701 307
257 iso_pu_bacteria 2738543016 2739267475 307
258 iso_pu_bacteria 2738543020 2739289108 307
259 iso_pu_bacteria 2738543021 2739294420 307
260 iso_pu_bacteria 2773857670 2774118897 307
261 iso_pu_bacteria 2773857672 2774131546 307
262 iso_pu_bacteria 2784132072 2784312536 307
263 iso_pu_bacteria 2806310737 2807409422 307
264 iso_pu_bacteria 2806310745 2807457724 307
265 iso_pu_bacteria 2808606377 2808930231 307
266 iso_pu_bacteria 2808606381 2808952204 307
267 iso_pu_bacteria 2811994881 2812367432 307
268 iso_pu_bacteria 2818991464 2819705774 307
269 iso_pu_bacteria 2826581358 2826584706 307
270 iso_pu_bacteria 2842815866 2842816470 307
271 iso_pu_bacteria 2842849001 2842850053 307
272 iso_pu_bacteria 2844665904 2844669933 307
273 iso_pu_bacteria 2860339153 2860342426 307
274 iso_pu_bacteria 2917070673 2917073257 307
275 iso_pu_bacteria 2917832318 2917833095 307
276 iso_pu_bacteria 2919125081 2919127420 307
277 iso_pu_bacteria 2919456309 2919459097 307
278 iso_pu_bacteria 2923519811 2923521480 307
279 iso_pu_bacteria 2931396565 2931402509 307
280 iso_pu_bacteria 2935353572 2935357743 307
281 iso_pu_bacteria 2939651529 2939655218 307
282 iso_pu_bacteria 2974298342 2974301790 307
283 iso_pu_bacteria 2984499530 2984500644 307
284 iso_pu_bacteria 2984504281 2984507156 307
285 iso_pu_bacteria 3007511990 3007514984 307
286 iso_pu_bacteria 3007619802 3007620251 307
287 iso_pu_bacteria 3007803356 3007803595 307
288 iso_pu_bacteria 637000220 637319778 307
289 iso_pu_bacteria 8011350971 8011351588 307
290 iso_pu_bacteria 8016728285 8016730755 307
291 iso_pu_bacteria 8052494512 8052498434 307
292 iso_pu_bacteria 8056120720 8056122407 307
293 iso_pu_bacteria 8056137416 8056141362 307
294 iso_pu_bacteria 8056155041 8056156883 307
295 3300006944 Ga0099823_1000543 Ga0099823_100054313 308
296 3300025728 Ga0207655_1043260 Ga0207655_10432603 308
297 3300027296 Ga0209389_1000018 Ga0209389_1000018123 308
298 3300042006 Ga0439432_002727 Ga0439432_002727_2926_3882 308
299 3300049571 Ga0501034_0000084 Ga0501034_0000084_9757_10713 308
300 3300053135 Ga0500659_0001721 Ga0500659_0001721_3081_4037 308
301 3300046463 Ga0495653_0004419 Ga0495653_0004419_10327_11295 309
302 3300046492 Ga0495585_0001050 Ga0495585_0001050_13465_14397 309
303 3300046507 Ga0495606_0006235 Ga0495606_0006235_8721_9689 309
304 3300046665 Ga0495661_0000066 Ga0495661_0000066_112878_113810 309
305 3300013104 Ga0157370_10001536 Ga0157370_1000153626 310
306 3300042876 Ga0451577_0069376 Ga0451577_0069376_685_1617 310
307 2124908027 MRS2a_Contig_1683 MRS2a_00542950 311
308 3300002737 JGI25162J39368_1000014 JGI25162J39368_1000014110 311
309 3300002771 JGI25163J39215_1000142 JGI25163J39215_100014211 311
310 3300002772 JGI25164J39214_1000015 JGI25164J39214_1000015102 311
311 3300003214 JGI25165J46597_1000027 JGI25165J46597_1000027208 311
312 3300003781 Ga0055536_1000050 Ga0055536_100005073 311
313 3300003781 Ga0055536_1000148 Ga0055536_100014842 311
314 3300003781 Ga0055536_1000256 Ga0055536_100025619 311
315 3300005288 Ga0065714_10000657 Ga0065714_100006571 311
316 3300005288 Ga0065714_10007277 Ga0065714_100072773 311
317 3300005288 Ga0065714_10022941 Ga0065714_100229412 311
318 3300005288 Ga0065714_10105305 Ga0065714_101053051 311
319 3300005290 Ga0065712_10067898 Ga0065712_1006789826 311
320 3300009011 Ga0105251_10012158 Ga0105251_100121585 311
321 3300009036 Ga0105244_10004850 Ga0105244_100048507 311
322 3300009036 Ga0105244_10021025 Ga0105244_100210251 311
323 3300009036 Ga0105244_10046959 Ga0105244_100469593 311
324 3300009148 Ga0105243_10002712 Ga0105243_100027124 311
325 3300009148 Ga0105243_10054871 Ga0105243_100548712 311
326 3300009553 Ga0105249_10537972 Ga0105249_105379721 311
327 3300013100 Ga0157373_10065097 Ga0157373_100650973 311
328 3300013102 Ga0157371_10000379 Ga0157371_1000037942 311
329 3300013102 Ga0157371_10000899 Ga0157371_100008994 311
330 3300013102 Ga0157371_10004548 Ga0157371_100045489 311
331 3300013105 Ga0157369_10009021 Ga0157369_100090217 311
332 3300013105 Ga0157369_10283603 Ga0157369_102836032 311
333 3300013306 Ga0163162_10001806 Ga0163162_100018063 311
334 3300013307 Ga0157372_10001089 Ga0157372_1000108926 311
335 3300014497 Ga0182008_10002066 Ga0182008_100020664 311
336 3300015261 Ga0182006_1003067 Ga0182006_10030675 311
337 3300015261 Ga0182006_1009531 Ga0182006_10095313 311
338 3300015261 Ga0182006_1061687 Ga0182006_10616871 311
339 3300015265 Ga0182005_1043554 Ga0182005_10435542 311
340 3300017792 Ga0163161_10003244 Ga0163161_1000324410 311
341 3300017792 Ga0163161_10032208 Ga0163161_100322083 311
342 3300025207 Ga0209760_100012 Ga0209760_100012130 311
343 3300025231 Ga0207427_100003 Ga0207427_100003686 311
344 3300025233 Ga0209437_100002 Ga0209437_100002327 311
345 3300025261 Ga0209233_1000004 Ga0209233_10000041098 311
346 3300025292 Ga0209676_1000154 Ga0209676_100015442 311
347 3300025292 Ga0209676_1053294 Ga0209676_10532941 311
348 3300025711 Ga0207696_1005499 Ga0207696_10054997 311
349 3300025728 Ga0207655_1005901 Ga0207655_10059019 311
350 3300025728 Ga0207655_1018962 Ga0207655_10189623 311
351 3300025735 Ga0207713_1019446 Ga0207713_10194463 311
352 3300025735 Ga0207713_1043522 Ga0207713_10435222 311
353 3300025735 Ga0207713_1044392 Ga0207713_10443922 311
354 3300025935 Ga0207709_10001850 Ga0207709_1000185014 311
355 3300041405 Ga0439438_000720 Ga0439438_000720_13364_14299 311
356 3300041405 Ga0439438_000868 Ga0439438_000868_9824_10762 311
357 3300041407 Ga0439447_000261 Ga0439447_000261_7520_8461 311
358 3300041407 Ga0439447_003495 Ga0439447_003495_3903_4838 311
359 3300041411 Ga0439466_0000243 Ga0439466_0000243_11573_12514 311
360 3300041411 Ga0439466_0000837 Ga0439466_0000837_7520_8461 311
361 3300041411 Ga0439466_0000966 Ga0439466_0000966_7454_8389 311
362 3300041411 Ga0439466_0009635 Ga0439466_0009635_2315_3256 311
363 3300041411 Ga0439466_0041736 Ga0439466_0041736_115_1053 311
364 3300041413 Ga0439465_0009066 Ga0439465_0009066_1555_2496 311
365 3300042000 Ga0439437_001677 Ga0439437_001677_426_1364 311
366 3300042006 Ga0439432_046241 Ga0439432_046241_239_1180 311
367 3300042009 Ga0439451_005403 Ga0439451_005403_1284_2225 311
368 3300042010 Ga0439452_000332 Ga0439452_000332_733_1668 311
369 3300042010 Ga0439452_000618 Ga0439452_000618_6939_7880 311
370 3300042013 Ga0439456_005691 Ga0439456_005691_838_1779 311
371 3300042013 Ga0439456_008907 Ga0439456_008907_275_1216 311
372 3300042115 Ga0450911_000041 Ga0450911_000041_41509_42447 311
373 3300042115 Ga0450911_000218 Ga0450911_000218_10479_11420 311
374 3300042115 Ga0450911_000727 Ga0450911_000727_3220_4161 311
375 3300042121 Ga0450919_001308 Ga0450919_001308_518_1459 311
376 3300042127 Ga0450890_000630 Ga0450890_000630_1331_2272 311
377 3300042137 Ga0450902_000710 Ga0450902_000710_10_945 311
378 3300042137 Ga0450902_006162 Ga0450902_006162_653_1588 311
379 3300042138 Ga0450903_013998 Ga0450903_013998_215_1156 311
380 3300042139 Ga0450904_000034 Ga0450904_000034_17751_18689 311
381 3300042142 Ga0450905_004670 Ga0450905_004670_36_971 311
382 3300042145 Ga0450906_008321 Ga0450906_008321_1008_1946 311
383 3300042146 Ga0450907_000001 Ga0450907_000001_113404_114345 311
384 3300042146 Ga0450907_000713 Ga0450907_000713_6512_7453 311
385 3300042147 Ga0450910_001479 Ga0450910_001479_1227_2168 311
386 3300042156 Ga0439446_0001760 Ga0439446_0001760_3971_4912 311
387 3300042184 Ga0450908_000102 Ga0450908_000102_6170_7108 311
388 3300042185 Ga0450909_000419 Ga0450909_000419_4317_5258 311
389 3300042185 Ga0450909_000420 Ga0450909_000420_226_1164 311
390 3300042435 Ga0439434_0000001 Ga0439434_0000001_63453_64394 311
391 3300042435 Ga0439434_0019871 Ga0439434_0019871_88_1026 311
392 3300042439 Ga0439464_0002031 Ga0439464_0002031_2504_3442 311
393 3300042530 Ga0450916_002079 Ga0450916_002079_797_1735 311
394 3300042531 Ga0450918_013150 Ga0450918_013150_193_1134 311
395 3300042532 Ga0450893_0001994 Ga0450893_0001994_652_1590 311
396 3300042993 Ga0439440_0005669 Ga0439440_0005669_332_1270 311
397 3300046452 Ga0495617_008823 Ga0495617_008823_1667_2608 311
398 3300046452 Ga0495617_027136 Ga0495617_027136_774_1709 311
399 3300046453 Ga0495627_000009 Ga0495627_000009_113716_114672 311
400 3300046453 Ga0495627_004523 Ga0495627_004523_3898_4845 311
401 3300046455 Ga0495603_0004814 Ga0495603_0004814_3391_4332 311
402 3300046455 Ga0495603_0006243 Ga0495603_0006243_4924_5865 311
403 3300046455 Ga0495603_0021165 Ga0495603_0021165_426_1361 311
404 3300046457 Ga0495590_0024757 Ga0495590_0024757_590_1528 311
405 3300046458 Ga0495591_000044 Ga0495591_000044_137739_138695 311
406 3300046458 Ga0495591_000558 Ga0495591_000558_10918_11865 311
407 3300046458 Ga0495591_001688 Ga0495591_001688_1502_2437 311
408 3300046460 Ga0495638_0180311 Ga0495638_0180311_131_1081 311
409 3300046463 Ga0495653_0019288 Ga0495653_0019288_2590_3531 311
410 3300046463 Ga0495653_0059167 Ga0495653_0059167_692_1633 311
411 3300046463 Ga0495653_0125245 Ga0495653_0125245_69_1010 311
412 3300046471 Ga0495650_0002379 Ga0495650_0002379_3070_4011 311
413 3300046471 Ga0495650_0020151 Ga0495650_0020151_2282_3232 311
414 3300046473 Ga0495582_0001789 Ga0495582_0001789_213_1154 311
415 3300046474 Ga0495605_0000319 Ga0495605_0000319_45118_46074 311
416 3300046474 Ga0495605_0000572 Ga0495605_0000572_26357_27298 311
417 3300046474 Ga0495605_0006718 Ga0495605_0006718_109_1059 311
418 3300046474 Ga0495605_0008096 Ga0495605_0008096_3570_4511 311
419 3300046475 Ga0495639_0003018 Ga0495639_0003018_6306_7247 311
420 3300046475 Ga0495639_0011805 Ga0495639_0011805_708_1649 311
421 3300046491 Ga0495584_0000054 Ga0495584_0000054_49190_50131 311
422 3300046491 Ga0495584_0000086 Ga0495584_0000086_11191_12129 311
423 3300046491 Ga0495584_0028451 Ga0495584_0028451_649_1599 311
424 3300046492 Ga0495585_0000441 Ga0495585_0000441_21470_22405 311
425 3300046492 Ga0495585_0005507 Ga0495585_0005507_6021_6962 311
426 3300046499 Ga0495594_0001999 Ga0495594_0001999_1398_2339 311
427 3300046501 Ga0495607_0000033 Ga0495607_0000033_140670_141623 311
428 3300046501 Ga0495607_0001071 Ga0495607_0001071_20485_21423 311
429 3300046501 Ga0495607_0001195 Ga0495607_0001195_21375_22316 311
430 3300046501 Ga0495607_0002338 Ga0495607_0002338_8197_9150 311
431 3300046501 Ga0495607_0004716 Ga0495607_0004716_4468_5406 311
432 3300046501 Ga0495607_0037859 Ga0495607_0037859_1222_2295 311
433 3300046501 Ga0495607_0087626 Ga0495607_0087626_343_1299 311
434 3300046501 Ga0495607_0106713 Ga0495607_0106713_462_1412 311
435 3300046501 Ga0495607_0127717 Ga0495607_0127717_174_1112 311
436 3300046506 Ga0495583_0001526 Ga0495583_0001526_3474_4415 311
437 3300046506 Ga0495583_0106973 Ga0495583_0106973_207_1142 311
438 3300046507 Ga0495606_0000293 Ga0495606_0000293_60721_61710 311
439 3300046507 Ga0495606_0011906 Ga0495606_0011906_1833_2783 311
440 3300046507 Ga0495606_0023146 Ga0495606_0023146_636_1577 311
441 3300046512 Ga0495610_0004251 Ga0495610_0004251_8310_9251 311
442 3300046512 Ga0495610_0008874 Ga0495610_0008874_3808_4749 311
443 3300046512 Ga0495610_0015580 Ga0495610_0015580_985_1926 311
444 3300046512 Ga0495610_0016042 Ga0495610_0016042_1696_2646 311
445 3300046513 Ga0495616_0024226 Ga0495616_0024226_458_1393 311
446 3300046515 Ga0495620_0000985 Ga0495620_0000985_8605_9546 311
447 3300046515 Ga0495620_0003703 Ga0495620_0003703_4125_5075 311
448 3300046516 Ga0495628_0352701 Ga0495628_0352701_121_1062 311
449 3300046517 Ga0495630_0011457 Ga0495630_0011457_5270_6211 311
450 3300046517 Ga0495630_0076355 Ga0495630_0076355_1343_2284 311
451 3300046517 Ga0495630_0085983 Ga0495630_0085983_901_1842 311
452 3300046517 Ga0495630_0409187 Ga0495630_0409187_14_955 311
453 3300046518 Ga0495631_0000002 Ga0495631_0000002_152296_153237 311
454 3300046518 Ga0495631_0011222 Ga0495631_0011222_1140_2078 311
455 3300046518 Ga0495631_0051953 Ga0495631_0051953_380_1330 311
456 3300046519 Ga0495632_0004432 Ga0495632_0004432_6376_7326 311
457 3300046519 Ga0495632_0016929 Ga0495632_0016929_2297_3238 311
458 3300046519 Ga0495632_0159633 Ga0495632_0159633_24_965 311
459 3300046520 Ga0495637_0000968 Ga0495637_0000968_7269_8207 311
460 3300046520 Ga0495637_0003101 Ga0495637_0003101_2925_3881 311
461 3300046520 Ga0495637_0008065 Ga0495637_0008065_1069_2010 311
462 3300046520 Ga0495637_0023055 Ga0495637_0023055_1510_2451 311
463 3300046522 Ga0495643_0000148 Ga0495643_0000148_55847_56875 311
464 3300046522 Ga0495643_0001627 Ga0495643_0001627_17667_18686 311
465 3300046522 Ga0495643_0021627 Ga0495643_0021627_1871_2809 311
466 3300046522 Ga0495643_0043375 Ga0495643_0043375_1293_2366 311
467 3300046523 Ga0495644_0010930 Ga0495644_0010930_1461_2402 311
468 3300046524 Ga0495648_0003677 Ga0495648_0003677_12016_12957 311
469 3300046524 Ga0495648_0009232 Ga0495648_0009232_1310_2248 311
470 3300046524 Ga0495648_0083189 Ga0495648_0083189_49_990 311
471 3300046526 Ga0495666_0010679 Ga0495666_0010679_1514_2455 311
472 3300046526 Ga0495666_0048420 Ga0495666_0048420_898_1839 311
473 3300046526 Ga0495666_0102421 Ga0495666_0102421_66_1007 311
474 3300046530 Ga0495654_0001726 Ga0495654_0001726_11153_12103 311
475 3300046530 Ga0495654_0004313 Ga0495654_0004313_1257_2330 311
476 3300046530 Ga0495654_0012671 Ga0495654_0012671_2474_3415 311
477 3300046535 Ga0495586_0104443 Ga0495586_0104443_566_1507 311
478 3300046536 Ga0495587_0000989 Ga0495587_0000989_10380_11321 311
479 3300046536 Ga0495587_0041805 Ga0495587_0041805_1676_2617 311
480 3300046538 Ga0495609_0019722 Ga0495609_0019722_1870_2808 311
481 3300046542 Ga0495597_0000008 Ga0495597_0000008_224903_225859 311
482 3300046542 Ga0495597_0003494 Ga0495597_0003494_1437_2372 311
483 3300046542 Ga0495597_0060268 Ga0495597_0060268_595_1533 311
484 3300046543 Ga0495645_0262349 Ga0495645_0262349_11_952 311
485 3300046557 Ga0495622_0005999 Ga0495622_0005999_2229_3170 311
486 3300046558 Ga0495633_0015369 Ga0495633_0015369_1295_2233 311
487 3300046558 Ga0495633_0018563 Ga0495633_0018563_590_1531 311
488 3300046616 Ga0495668_0019820 Ga0495668_0019820_2731_3708 311
489 3300046642 Ga0495634_0000572 Ga0495634_0000572_13412_14353 311
490 3300046648 Ga0495611_0013483 Ga0495611_0013483_1473_2408 311
491 3300046660 Ga0495625_0002382 Ga0495625_0002382_17255_18196 311
492 3300046660 Ga0495625_0011666 Ga0495625_0011666_4178_5119 311
493 3300046660 Ga0495625_0014699 Ga0495625_0014699_4846_5802 311
494 3300046660 Ga0495625_0018987 Ga0495625_0018987_303_1331 311
495 3300046660 Ga0495625_0040030 Ga0495625_0040030_1001_1939 311
496 3300046663 Ga0495635_0000115 Ga0495635_0000115_22537_23478 311
497 3300046664 Ga0495659_0007080 Ga0495659_0007080_1912_2850 311
498 3300046665 Ga0495661_0004926 Ga0495661_0004926_3516_4466 311
499 3300046665 Ga0495661_0007882 Ga0495661_0007882_4544_5482 311
500 3300046665 Ga0495661_0009465 Ga0495661_0009465_2027_2968 311
501 3300046674 Ga0495588_0008021 Ga0495588_0008021_475_1410 311
502 3300046675 Ga0495657_0026028 Ga0495657_0026028_2054_2995 311
503 3300046679 Ga0495623_0000178 Ga0495623_0000178_3283_4224 311
504 3300046679 Ga0495623_0019830 Ga0495623_0019830_460_1401 311
505 3300046680 Ga0495646_0008931 Ga0495646_0008931_136_1077 311
506 3300046680 Ga0495646_0136524 Ga0495646_0136524_260_1201 311
507 3300046691 Ga0495670_0000103 Ga0495670_0000103_31809_32747 311
508 3300046692 Ga0495671_0000138 Ga0495671_0000138_52372_53310 311
509 3300046692 Ga0495671_0000525 Ga0495671_0000525_17264_18205 311
510 3300046692 Ga0495671_0001213 Ga0495671_0001213_5156_6184 311
511 3300046692 Ga0495671_0017302 Ga0495671_0017302_444_1385 311
512 3300046692 Ga0495671_0023616 Ga0495671_0023616_1628_2578 311
513 3300046692 Ga0495671_0026346 Ga0495671_0026346_1394_2335 311
514 3300046692 Ga0495671_0098668 Ga0495671_0098668_22_960 311
515 3300046694 Ga0495649_0000241 Ga0495649_0000241_5043_6032 311
516 3300046794 Ga0495589_0039957 Ga0495589_0039957_1309_2250 311
517 3300046810 Ga0495660_0000209 Ga0495660_0000209_22754_23731 311
518 3300046810 Ga0495660_0000311 Ga0495660_0000311_8646_9602 311
519 3300046810 Ga0495660_0001030 Ga0495660_0001030_101_1036 311
520 3300046810 Ga0495660_0013736 Ga0495660_0013736_1464_2405 311
521 3300046810 Ga0495660_0036178 Ga0495660_0036178_49_1077 311
522 3300047317 Ga0495604_0153679 Ga0495604_0153679_122_1063 311
523 3300047320 Ga0495672_0005703 Ga0495672_0005703_7095_8042 311
524 3300047320 Ga0495672_0006243 Ga0495672_0006243_6448_7383 311
525 3300047320 Ga0495672_0119239 Ga0495672_0119239_237_1193 311
526 3300047322 Ga0495680_0000459 Ga0495680_0000459_41871_42812 311
527 3300047322 Ga0495680_0017091 Ga0495680_0017091_45_986 311
528 3300047322 Ga0495680_0037726 Ga0495680_0037726_1659_2600 311
529 3300047323 Ga0495683_0000188 Ga0495683_0000188_49935_50876 311
530 3300047323 Ga0495683_0008472 Ga0495683_0008472_3140_4078 311
531 3300047446 Ga0495679_003997 Ga0495679_003997_5671_6612 311
532 3300047446 Ga0495679_004309 Ga0495679_004309_3841_4779 311
533 3300047469 Ga0495673_0000093 Ga0495673_0000093_36564_37505 311
534 3300047469 Ga0495673_0000210 Ga0495673_0000210_67907_68857 311
535 3300047469 Ga0495673_0000715 Ga0495673_0000715_3769_4710 311
536 3300047469 Ga0495673_0000815 Ga0495673_0000815_4843_5793 311
537 3300047469 Ga0495673_0006805 Ga0495673_0006805_1778_2845 311
538 3300047469 Ga0495673_0007716 Ga0495673_0007716_3907_4851 311
539 3300047469 Ga0495673_0008286 Ga0495673_0008286_2233_3183 311
540 3300047470 Ga0495681_0000075 Ga0495681_0000075_66992_67927 311
541 3300047470 Ga0495681_0003026 Ga0495681_0003026_3595_4536 311
542 3300047470 Ga0495681_0006882 Ga0495681_0006882_2026_2967 311
543 3300047470 Ga0495681_0014278 Ga0495681_0014278_1983_2933 311
544 3300047673 Ga0495593_0014975 Ga0495593_0014975_1411_2352 311
545 3300047673 Ga0495593_0064586 Ga0495593_0064586_865_1806 311
546 3300047673 Ga0495593_0070078 Ga0495593_0070078_801_1742 311
547 3300048088 Ga0495602_0156085 Ga0495602_0156085_334_1275 311
548 3300048091 Ga0495626_0000065 Ga0495626_0000065_45282_46232 311
549 3300048091 Ga0495626_0010091 Ga0495626_0010091_1535_2473 311
550 3300048905 Ga0496102_0000073 Ga0496102_0000073_46349_47290 311
551 3300048906 Ga0496103_0000363 Ga0496103_0000363_38546_39487 311
552 3300048915 Ga0496112_0102108 Ga0496112_0102108_368_1312 311
553 3300048918 Ga0496115_0060793 Ga0496115_0060793_1006_1947 311
554 3300048919 Ga0496116_0000046 Ga0496116_0000046_98670_99611 311
555 3300048920 Ga0496117_0002656 Ga0496117_0002656_11363_12304 311
556 3300048920 Ga0496117_0179102 Ga0496117_0179102_242_1183 311
557 3300048921 Ga0496118_0013294 Ga0496118_0013294_889_1830 311
558 3300048924 Ga0496121_0000093 Ga0496121_0000093_114523_115464 311
559 3300048924 Ga0496121_0003044 Ga0496121_0003044_3402_4346 311
560 3300048924 Ga0496121_0080727 Ga0496121_0080727_783_1730 311
561 3300048925 Ga0496122_0001577 Ga0496122_0001577_5059_6000 311
562 3300048926 Ga0496123_0000303 Ga0496123_0000303_88397_89338 311
563 3300048927 Ga0496124_0001949 Ga0496124_0001949_11622_12560 311
564 3300048927 Ga0496124_0029732 Ga0496124_0029732_1357_2319 311
565 3300048928 Ga0496125_0005291 Ga0496125_0005291_10789_11730 311
566 3300048928 Ga0496125_0101283 Ga0496125_0101283_56_997 311
567 3300049459 Ga0495678_002643 Ga0495678_002643_7401_8339 311
568 3300049459 Ga0495678_084975 Ga0495678_084975_128_1069 311
569 3300049460 Ga0495682_0000554 Ga0495682_0000554_19205_20140 311
570 3300049460 Ga0495682_0005133 Ga0495682_0005133_4213_5148 311
571 3300049853 Ga0501226_000019 Ga0501226_000019_137023_137961 311
572 iso_pu_bacteria 2511231022 2511362445 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10672

Methyltrans_SAM

S-adenosylmethionine-dependent methyltransferase

89

370

0.98

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

199

324

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vse-assembly4.cif.gz_D crystal structure of methyltransferase 0.8414 6 309
3vse-assembly1.cif.gz_A crystal structure of methyltransferase 0.8399 6 309
3cjr-assembly1.cif.gz_A ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin. 0.8365 147 310
2zbp-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine 0.8341 134 310
3vse-assembly3.cif.gz_C crystal structure of methyltransferase 0.8308 4 309
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9117 149 216 3.40.50.150
2b78A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8993 110 310 3.40.50.150
3vseC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8983 110 309 3.40.50.150
2b78A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8668 110 310 3.40.50.150
af_Q4CXS4_6_191_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8547 137 228 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3M3QZN4-F1-model_v4 deleted 0.9854 1 309
AF-A0A0N8RP03-F1-model_v4 Methyltransferase 0.9836 1 309 GO:0006364
GO:0008168
GO:0032259
AF-A0A085VH38-F1-model_v4 Methyltransferase 0.9825 1 310 GO:0006364
GO:0008168
GO:0032259
AF-A0A7W4QFD8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9804 1 310 GO:0006364
GO:0008168
GO:0032259
AF-A0A2T3N4Q5-F1-model_v4 Methyltransferase 0.9796 1 310 GO:0006364
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
89.85 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map