F465076

General Info

Members Datasets Scaffolds Average Seq Length
572 315 1144 154

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1017798|Ga0209257_10177983
Length 178
Sequence MGLSCDEPLIRGMRRVEASLSVNRMSDAPPPFVPGAFVGAAHHYRARVYFEDTDLSGIVYHANYLRYMERARSDMLRLAGIDQRAAMESGEGAWAVTDLAIKYKSPAKLDDDLLVVSTVEAVRGASVIIAQRILRGQDTLTEGRVTAAFLSPQGRPRRQLLDWTQRFTAIMNGDIPPC

Samples

Sample ID Description Type Environment
1 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
194 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
282 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
285 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
293 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
294 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
300 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
301 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
302 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
303 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
304 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
305 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
306 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
307 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
308 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
309 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
310 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
311 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
312 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
313 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
314 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
315 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.87
Bulb 0
Endosphere 16.26
Nodule 0
Rhizoplane 3.67
Rhizosphere 72.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209257_1017798 3300025304 Bacteria 2776
2 ARcpr5yngRDRAFT_c008091 3300000043 Bacteria 914
3 JGI24741J21665_1002867 3300001915 Bacteria 4332
4 JGI24740J21852_10010370 3300001979 Bacteria 3596
5 JGI24739J22299_10050356 3300001989 Bacteria 1347
6 JGI24737J22298_10000868 3300001990 Bacteria 10796
7 JGI24737J22298_10019634 3300001990 Bacteria 2160
8 JGI24735J21928_10163293 3300002067 Bacteria 644
9 JGI24744J21845_10047019 3300002077 Bacteria 800
10 JGI25165J46597_1021686 3300003214 Bacteria 839
11 JGI25153J46596_10014335 3300003215 Bacteria 3300
12 Ga0055525_1000099 3300003759 Bacteria 136491
13 Ga0055542_1000177 3300003762 Bacteria 78838
14 Ga0055529_1000350 3300003763 Bacteria 51011
15 Ga0055537_1001791 3300003773 Bacteria 7833
16 Ga0055524_1000118 3300003775 Bacteria 93202
17 Ga0055536_1000786 3300003781 Bacteria 21146
18 Ga0055536_1001470 3300003781 Bacteria 14151
19 Ga0055534_1009752 3300003784 Bacteria 2060
20 Ga0055530_10000927 3300003791 Bacteria 24053
21 Ga0055530_10065525 3300003791 Bacteria 797
22 Ga0055531_10000073 3300003794 Bacteria 109510
23 Ga0055531_10002693 3300003794 Bacteria 11700
24 Ga0055531_10005219 3300003794 Bacteria 7635
25 Ga0065165_1012937 3300005262 Bacteria 3354
26 Ga0065704_10002639 3300005289 Bacteria 6825
27 Ga0065707_10810303 3300005295 Bacteria 596
28 Ga0070658_10001732 3300005327 Bacteria 18381
29 Ga0070658_10296224 3300005327 Bacteria 1379
30 Ga0070658_10415927 3300005327 Bacteria 1156
31 Ga0070658_10556077 3300005327 Bacteria 993
32 Ga0070658_11176979 3300005327 Bacteria 666
33 Ga0070676_10052188 3300005328 Bacteria 2403
34 Ga0070670_100004155 3300005331 Bacteria 12108
35 Ga0070666_10000171 3300005335 Bacteria 44565
36 Ga0070666_10468089 3300005335 Bacteria 911
37 Ga0070682_100946291 3300005337 Bacteria 711
38 Ga0070660_100014004 3300005339 Bacteria 5771
39 Ga0070660_100537338 3300005339 Bacteria 974
40 Ga0070661_100247116 3300005344 Bacteria 1376
41 Ga0070661_100669272 3300005344 Bacteria 844
42 Ga0070668_100064809 3300005347 Bacteria 2833
43 Ga0070668_100082090 3300005347 Bacteria 2528
44 Ga0070669_100000001 3300005353 Bacteria 537589
45 Ga0070669_100521421 3300005353 Bacteria 988
46 Ga0070675_100142892 3300005354 Bacteria 2047
47 Ga0070671_100000007 3300005355 Bacteria 250397
48 Ga0070673_100491618 3300005364 Bacteria 1109
49 Ga0070659_100075682 3300005366 Bacteria 2683
50 Ga0070659_100300332 3300005366 Bacteria 1339
51 Ga0070659_100339687 3300005366 Bacteria 1258
52 Ga0070659_100506321 3300005366 Bacteria 1030
53 Ga0070659_100605568 3300005366 Bacteria 942
54 Ga0070705_100018159 3300005440 Bacteria 3682
55 Ga0070708_100233045 3300005445 Bacteria 1728
56 Ga0070708_101092331 3300005445 Bacteria 747
57 Ga0070663_100395515 3300005455 Bacteria 1128
58 Ga0070678_100000062 3300005456 Bacteria 39682
59 Ga0070678_100263580 3300005456 Bacteria 1450
60 Ga0070678_100879404 3300005456 Bacteria 818
61 Ga0070678_101034116 3300005456 Bacteria 756
62 Ga0070662_100044890 3300005457 Bacteria 3168
63 Ga0070662_100083112 3300005457 Bacteria 2389
64 Ga0070681_11028143 3300005458 Bacteria 744
65 Ga0068867_100652708 3300005459 Bacteria 923
66 Ga0070707_101050074 3300005468 Bacteria 780
67 Ga0070679_100111539 3300005530 Bacteria 2721
68 Ga0070679_100203743 3300005530 Bacteria 1943
69 Ga0070679_100380299 3300005530 Bacteria 1359
70 Ga0070679_100894110 3300005530 Bacteria 831
71 Ga0070679_101253611 3300005530 Bacteria 687
72 Ga0068853_100005064 3300005539 Bacteria 10281
73 Ga0068853_100107531 3300005539 Bacteria 2473
74 Ga0068853_100318884 3300005539 Bacteria 1440
75 Ga0070672_100114964 3300005543 Bacteria 2197
76 Ga0070672_100857742 3300005543 Bacteria 801
77 Ga0070686_100078349 3300005544 Bacteria 2182
78 Ga0070686_100271183 3300005544 Bacteria 1248
79 Ga0070665_100000257 3300005548 Bacteria 87607
80 Ga0070665_100026918 3300005548 Bacteria 5792
81 Ga0070665_100317545 3300005548 Bacteria 1562
82 Ga0068855_100067871 3300005563 Bacteria 4153
83 Ga0068855_100654726 3300005563 Bacteria 1128
84 Ga0070664_100056966 3300005564 Bacteria 3321
85 Ga0070664_100088627 3300005564 Bacteria 2675
86 Ga0068857_100034690 3300005577 Bacteria 4462
87 Ga0068857_100176493 3300005577 Bacteria 1944
88 Ga0068854_100634953 3300005578 Bacteria 915
89 Ga0068856_100455097 3300005614 Bacteria 1301
90 Ga0068856_100648535 3300005614 Bacteria 1076
91 Ga0068856_100662448 3300005614 Bacteria 1064
92 Ga0070702_100475154 3300005615 Bacteria 912
93 Ga0070702_101745409 3300005615 Bacteria 518
94 Ga0068859_100008227 3300005617 Bacteria 10581
95 Ga0068859_100012050 3300005617 Bacteria 8686
96 Ga0068859_100253494 3300005617 Bacteria 1850
97 Ga0068859_100329522 3300005617 Bacteria 1621
98 Ga0068864_100000352 3300005618 Bacteria 40434
99 Ga0068864_100000809 3300005618 Bacteria 26301
100 Ga0068861_100002527 3300005719 Bacteria 11948
101 Ga0068861_100364904 3300005719 Bacteria 1271
102 Ga0068851_10086805 3300005834 Bacteria 1642
103 Ga0068870_10470415 3300005840 Bacteria 832
104 Ga0068863_100001863 3300005841 Bacteria 20967
105 Ga0068863_100008510 3300005841 Bacteria 10020
106 Ga0068858_100000132 3300005842 Bacteria 77767
107 Ga0068858_100000444 3300005842 Bacteria 43311
108 Ga0068858_100025759 3300005842 Bacteria 5471
109 Ga0068858_100150250 3300005842 Bacteria 2190
110 Ga0068860_100001597 3300005843 Bacteria 24343
111 Ga0068860_100018882 3300005843 Bacteria 6699
112 Ga0068862_100000198 3300005844 Bacteria 66534
113 Ga0068862_100000468 3300005844 Bacteria 43578
114 Ga0075362_10103281 3300006177 Bacteria 1335
115 Ga0075366_10026369 3300006195 Bacteria 3404
116 Ga0075366_10541421 3300006195 Bacteria 721
117 Ga0097621_100092357 3300006237 Bacteria 2535
118 Ga0075370_10186363 3300006353 Bacteria 1222
119 Ga0068871_100012351 3300006358 Bacteria 6292
120 Ga0097620_100008228 3300006931 Bacteria 10581
121 Ga0097620_100012050 3300006931 Bacteria 8686
122 Ga0097620_100253502 3300006931 Bacteria 1850
123 Ga0097620_100329527 3300006931 Bacteria 1621
124 Ga0105250_10062733 3300009092 Bacteria 1495
125 Ga0105245_10001310 3300009098 Bacteria 22494
126 Ga0105247_10002160 3300009101 Bacteria 13576
127 Ga0105247_10041373 3300009101 Bacteria 2820
128 Ga0105243_10008648 3300009148 Bacteria 7809
129 Ga0105243_10197056 3300009148 Bacteria 1764
130 Ga0105243_10711200 3300009148 Bacteria 980
131 Ga0105241_10000907 3300009174 Bacteria 22391
132 Ga0105248_10010177 3300009177 Bacteria 10359
133 Ga0105248_10108107 3300009177 Bacteria 3136
134 Ga0105237_10151277 3300009545 Bacteria 2317
135 Ga0105237_10212383 3300009545 Bacteria 1935
136 Ga0105238_10097256 3300009551 Bacteria 2930
137 Ga0105238_10286983 3300009551 Bacteria 1628
138 Ga0105238_11276190 3300009551 Bacteria 760
139 Ga0105249_10000015 3300009553 Bacteria 282138
140 Ga0105249_10024855 3300009553 Bacteria 5388
141 Ga0105249_10609447 3300009553 Bacteria 1147
142 Ga0105249_10618946 3300009553 Bacteria 1138
143 Ga0105239_10451832 3300010375 Bacteria 1458
144 Ga0105239_10688452 3300010375 Bacteria 1169
145 Ga0105239_10810072 3300010375 Bacteria 1073
146 Ga0105246_10233367 3300011119 Bacteria 1450
147 Ga0157373_10162726 3300013100 Bacteria 1570
148 Ga0157371_10000110 3300013102 Bacteria 124933
149 Ga0157371_10016286 3300013102 Bacteria 5552
150 Ga0157371_10064604 3300013102 Bacteria 2593
151 Ga0157371_10152703 3300013102 Bacteria 1647
152 Ga0157370_10084072 3300013104 Bacteria 2992
153 Ga0157370_10392105 3300013104 Bacteria 1278
154 Ga0157370_10553862 3300013104 Bacteria 1054
155 Ga0157369_10087393 3300013105 Bacteria 3329
156 Ga0157369_10110306 3300013105 Bacteria 2925
157 Ga0157369_10456426 3300013105 Bacteria 1323
158 Ga0157369_10633682 3300013105 Bacteria 1103
159 Ga0157374_10185921 3300013296 Bacteria 2031
160 Ga0157374_10900523 3300013296 Bacteria 902
161 Ga0157378_10301527 3300013297 Bacteria 1551
162 Ga0163162_10016899 3300013306 Bacteria 7134
163 Ga0163162_10059576 3300013306 Bacteria 3850
164 Ga0163162_12084194 3300013306 Bacteria 650
165 Ga0163162_12853360 3300013306 Bacteria 556
166 Ga0157372_10043701 3300013307 Bacteria 4962
167 Ga0157372_10419405 3300013307 Bacteria 1560
168 Ga0157375_10270124 3300013308 Bacteria 1862
169 Ga0157375_10886306 3300013308 Bacteria 1037
170 Ga0163163_10072059 3300014325 Bacteria 3444
171 Ga0163163_11521021 3300014325 Bacteria 730
172 Ga0157380_10083412 3300014326 Bacteria 2618
173 Ga0182008_10055086 3300014497 Bacteria 1967
174 Ga0157377_10255225 3300014745 Bacteria 1138
175 Ga0157379_10028314 3300014968 Bacteria 4986
176 Ga0157376_10163363 3300014969 Bacteria 2021
177 Ga0163161_10951769 3300017792 Bacteria 730
178 Ga0209436_113379 3300025208 Bacteria 1346
179 Ga0209674_114896 3300025226 Bacteria 682
180 Ga0209563_100081 3300025230 Bacteria 199455
181 Ga0209437_107618 3300025233 Bacteria 1752
182 Ga0207425_1024809 3300025245 Bacteria 1242
183 Ga0209026_1015349 3300025250 Bacteria 1258
184 Ga0209026_1028036 3300025250 Bacteria 842
185 Ga0209677_101398 3300025253 Bacteria 10480
186 Ga0209148_1000008 3300025254 Bacteria 1504371
187 Ga0209233_1000107 3300025261 Bacteria 267399
188 Ga0209233_1009720 3300025261 Bacteria 2915
189 Ga0209565_1000011 3300025263 Bacteria 637062
190 Ga0209455_1000002 3300025272 Bacteria 1505459
191 Ga0209673_1034050 3300025273 Bacteria 1544
192 Ga0209675_1000082 3300025291 Bacteria 153550
193 Ga0209675_1016022 3300025291 Bacteria 2200
194 Ga0209676_1000130 3300025292 Bacteria 185796
195 Ga0209676_1000424 3300025292 Bacteria 74314
196 Ga0209676_1000567 3300025292 Bacteria 55724
197 Ga0209676_1068856 3300025292 Bacteria 849
198 Ga0209025_1004580 3300025294 Bacteria 11868
199 Ga0209758_1000017 3300025297 Bacteria 754393
200 Ga0209758_1008619 3300025297 Bacteria 6550
201 Ga0209050_1000017 3300025298 Bacteria 728928
202 Ga0209050_1000209 3300025298 Bacteria 130884
203 Ga0209050_1003944 3300025298 Bacteria 10487
204 Ga0209050_1017686 3300025298 Bacteria 2822
205 Ga0209050_1029022 3300025298 Bacteria 1780
206 Ga0209256_1000016 3300025299 Bacteria 599092
207 Ga0209257_1000027 3300025304 Bacteria 703541
208 Ga0209257_1000151 3300025304 Bacteria 191408
209 Ga0209257_1000202 3300025304 Bacteria 147246
210 Ga0209257_1001465 3300025304 Bacteria 27825
211 Ga0207697_10000442 3300025315 Bacteria 23401
212 Ga0207656_10015529 3300025321 Bacteria 2948
213 Ga0207656_10458978 3300025321 Bacteria 644
214 Ga0207710_10005275 3300025900 Bacteria 5584
215 Ga0207710_10020610 3300025900 Bacteria 2820
216 Ga0207688_10021092 3300025901 Bacteria 3558
217 Ga0207680_10001461 3300025903 Bacteria 11187
218 Ga0207645_10057309 3300025907 Bacteria 2487
219 Ga0207705_10000134 3300025909 Bacteria 79513
220 Ga0207705_10003314 3300025909 Bacteria 12245
221 Ga0207705_10394010 3300025909 Bacteria 1071
222 Ga0207705_10963648 3300025909 Bacteria 660
223 Ga0207654_10001172 3300025911 Bacteria 14044
224 Ga0207695_10094763 3300025913 Bacteria 2991
225 Ga0207695_10141814 3300025913 Bacteria 2351
226 Ga0207671_10005848 3300025914 Bacteria 11176
227 Ga0207671_10126060 3300025914 Bacteria 1961
228 Ga0207657_10006696 3300025919 Bacteria 11910
229 Ga0207657_10152247 3300025919 Bacteria 1883
230 Ga0207657_10799588 3300025919 Bacteria 729
231 Ga0207649_10000414 3300025920 Bacteria 31530
232 Ga0207649_10180856 3300025920 Bacteria 1476
233 Ga0207652_10003472 3300025921 Bacteria 12998
234 Ga0207652_10167542 3300025921 Bacteria 1970
235 Ga0207652_11247424 3300025921 Bacteria 646
236 Ga0207646_10253259 3300025922 Bacteria 1591
237 Ga0207681_10000002 3300025923 Bacteria 985597
238 Ga0207681_10418442 3300025923 Bacteria 1085
239 Ga0207694_10004909 3300025924 Bacteria 10378
240 Ga0207694_10064134 3300025924 Bacteria 2863
241 Ga0207694_10159379 3300025924 Bacteria 1822
242 Ga0207694_10594460 3300025924 Bacteria 930
243 Ga0207650_10015111 3300025925 Bacteria 5371
244 Ga0207659_10216225 3300025926 Bacteria 1538
245 Ga0207687_10000473 3300025927 Bacteria 27414
246 Ga0207644_10000002 3300025931 Bacteria 942221
247 Ga0207644_10530876 3300025931 Bacteria 973
248 Ga0207690_10000828 3300025932 Bacteria 19829
249 Ga0207690_10013582 3300025932 Bacteria 4896
250 Ga0207690_10246360 3300025932 Bacteria 1378
251 Ga0207690_10323728 3300025932 Bacteria 1212
252 Ga0207690_10355870 3300025932 Bacteria 1159
253 Ga0207706_10067155 3300025933 Bacteria 3155
254 Ga0207706_10098375 3300025933 Bacteria 2574
255 Ga0207709_10000146 3300025935 Bacteria 98521
256 Ga0207669_10000471 3300025937 Bacteria 17580
257 Ga0207691_10082465 3300025940 Bacteria 2888
258 Ga0207711_10122361 3300025941 Bacteria 2324
259 Ga0207679_10048490 3300025945 Bacteria 3092
260 Ga0207679_10078059 3300025945 Bacteria 2521
261 Ga0207667_10000001 3300025949 Bacteria 1178522
262 Ga0207667_10063856 3300025949 Bacteria 3846
263 Ga0207667_10427562 3300025949 Bacteria 1347
264 Ga0207712_10000023 3300025961 Bacteria 282081
265 Ga0207712_10039787 3300025961 Bacteria 3223
266 Ga0207712_10387379 3300025961 Bacteria 1171
267 Ga0207712_10393001 3300025961 Bacteria 1163
268 Ga0207668_10001858 3300025972 Bacteria 12320
269 Ga0207668_10006951 3300025972 Bacteria 6716
270 Ga0207668_10088813 3300025972 Bacteria 2265
271 Ga0207640_10005612 3300025981 Bacteria 6841
272 Ga0207658_10024359 3300025986 Bacteria 4234
273 Ga0207703_10001433 3300026035 Bacteria 21778
274 Ga0207703_10002023 3300026035 Bacteria 17904
275 Ga0207703_10034502 3300026035 Bacteria 4015
276 Ga0207703_10275647 3300026035 Bacteria 1525
277 Ga0207639_10009868 3300026041 Bacteria 6595
278 Ga0207639_10014011 3300026041 Bacteria 5626
279 Ga0207639_10036461 3300026041 Bacteria 3644
280 Ga0207639_10107400 3300026041 Bacteria 2267
281 Ga0207678_10011541 3300026067 Bacteria 7760
282 Ga0207678_10137931 3300026067 Bacteria 2081
283 Ga0207678_10239854 3300026067 Bacteria 1553
284 Ga0207678_10461977 3300026067 Bacteria 1104
285 Ga0207678_11411564 3300026067 Bacteria 615
286 Ga0207708_10656681 3300026075 Bacteria 893
287 Ga0207702_10006202 3300026078 Bacteria 10336
288 Ga0207641_10001745 3300026088 Bacteria 20982
289 Ga0207641_10071718 3300026088 Bacteria 2980
290 Ga0207648_10221977 3300026089 Bacteria 1680
291 Ga0207648_10284817 3300026089 Bacteria 1478
292 Ga0207676_10000383 3300026095 Bacteria 37759
293 Ga0207676_10000930 3300026095 Bacteria 22649
294 Ga0207676_10940477 3300026095 Bacteria 849
295 Ga0207676_11322589 3300026095 Bacteria 716
296 Ga0207674_10000811 3300026116 Bacteria 40585
297 Ga0207674_10117180 3300026116 Bacteria 2634
298 Ga0207674_10171207 3300026116 Bacteria 2125
299 Ga0207675_100005628 3300026118 Bacteria 11998
300 Ga0207675_100158507 3300026118 Bacteria 2158
301 Ga0207683_10791567 3300026121 Bacteria 880
302 Ga0207683_10938767 3300026121 Bacteria 803
303 Ga0207698_10003029 3300026142 Bacteria 10072
304 Ga0207698_10187215 3300026142 Bacteria 1840
305 Ga0268266_10000036 3300028379 Bacteria 348910
306 Ga0268266_10019585 3300028379 Bacteria 5765
307 Ga0268266_10066701 3300028379 Bacteria 3113
308 Ga0268266_10310268 3300028379 Bacteria 1474
309 Ga0268265_10000021 3300028380 Bacteria 272292
310 Ga0268265_10001875 3300028380 Bacteria 16712
311 Ga0268265_11283327 3300028380 Bacteria 732
312 Ga0268264_10000071 3300028381 Bacteria 267236
313 Ga0268264_10003059 3300028381 Bacteria 14488
314 Ga0307517_10115254 3300028786 Bacteria 2018
315 Ga0307513_10019526 3300031456 Bacteria 8067
316 Ga0307513_10057432 3300031456 Bacteria 4144
317 Ga0307513_10057681 3300031456 Bacteria 4134
318 Ga0307509_10038934 3300031507 Bacteria 5182
319 Ga0307408_100212563 3300031548 Bacteria 1573
320 Ga0307408_101121754 3300031548 Bacteria 730
321 Ga0307508_10000356 3300031616 Bacteria 55624
322 Ga0307413_10039051 3300031824 Bacteria 2757
323 Ga0307413_10135813 3300031824 Bacteria 1691
324 Ga0307413_10237446 3300031824 Bacteria 1343
325 Ga0307413_10393417 3300031824 Bacteria 1084
326 Ga0307406_10295307 3300031901 Bacteria 1242
327 Ga0307406_10844222 3300031901 Bacteria 776
328 Ga0307407_11349170 3300031903 Bacteria 561
329 Ga0307412_10016340 3300031911 Bacteria 4420
330 Ga0307412_10077047 3300031911 Bacteria 2292
331 Ga0307412_10090369 3300031911 Bacteria 2140
332 Ga0307409_101735891 3300031995 Bacteria 653
333 Ga0307416_101141521 3300032002 Bacteria 884
334 Ga0307416_102033351 3300032002 Bacteria 677
335 Ga0307416_102337355 3300032002 Bacteria 635
336 Ga0307416_102843201 3300032002 Bacteria 579
337 Ga0307414_10000090 3300032004 Bacteria 78448
338 Ga0307414_10001972 3300032004 Bacteria 10631
339 Ga0307414_10003123 3300032004 Bacteria 8793
340 Ga0307414_10013210 3300032004 Bacteria 4910
341 Ga0307414_10215518 3300032004 Bacteria 1572
342 Ga0307414_10252622 3300032004 Bacteria 1466
343 Ga0307414_10296448 3300032004 Bacteria 1366
344 Ga0307414_10470376 3300032004 Bacteria 1106
345 Ga0307414_10892214 3300032004 Bacteria 815
346 Ga0307411_10175401 3300032005 Bacteria 1621
347 Ga0307411_10908576 3300032005 Bacteria 783
348 Ga0307411_11089969 3300032005 Bacteria 719
349 Ga0307411_11093621 3300032005 Bacteria 718
350 Ga0307510_10004538 3300033180 Bacteria 16340
351 Ga0307510_10082035 3300033180 Bacteria 3122
352 Ga0307510_10536628 3300033180 Bacteria 615
353 Ga0307510_10572945 3300033180 Bacteria 578
354 Ga0373923_0027044 3300035111 Bacteria 2286
355 Ga0436364_1384628 3300037853 Bacteria 1786
356 Ga0439461_0002790 3300041410 Bacteria 2822
357 Ga0439466_0049020 3300041411 Bacteria 1388
358 Ga0439465_0003006 3300041413 Bacteria 5511
359 Ga0439465_0003406 3300041413 Bacteria 5187
360 Ga0451791_1557663 3300041451 Bacteria 638
361 Ga0451806_247895 3300041462 Bacteria 765
362 Ga0451837_1492165 3300041494 Bacteria 824
363 Ga0451853_0466089 3300041512 Bacteria 564
364 Ga0439431_0000298 3300041997 Bacteria 10201
365 Ga0439431_0066277 3300041997 Bacteria 957
366 Ga0439442_011459 3300042002 Bacteria 1806
367 Ga0439443_006941 3300042003 Bacteria 1564
368 Ga0439445_0002640 3300042004 Bacteria 3992
369 Ga0439445_0031735 3300042004 Bacteria 1374
370 Ga0439432_013725 3300042006 Bacteria 2750
371 Ga0439452_008745 3300042010 Bacteria 3026
372 Ga0439452_045041 3300042010 Bacteria 1027
373 Ga0439457_103321 3300042014 Bacteria 665
374 Ga0439462_0003860 3300042015 Bacteria 3616
375 Ga0439462_0141927 3300042015 Bacteria 673
376 Ga0450894_019123 3300042131 Bacteria 919
377 Ga0450898_038420 3300042134 Bacteria 899
378 Ga0439446_0032481 3300042156 Bacteria 1514
379 Ga0439434_0012951 3300042435 Bacteria 2471
380 Ga0439434_0014528 3300042435 Bacteria 2342
381 Ga0451576_0477161 3300045051 Bacteria 1310
382 Ga0495617_011485 3300046452 Bacteria 3021
383 Ga0495627_005135 3300046453 Bacteria 5341
384 Ga0495627_182167 3300046453 Bacteria 581
385 Ga0495638_0000261 3300046460 Bacteria 70934
386 Ga0495638_0158766 3300046460 Bacteria 1306
387 Ga0495650_0000428 3300046471 Bacteria 68082
388 Ga0495585_0006171 3300046492 Bacteria 7471
389 Ga0495585_0076455 3300046492 Bacteria 1819
390 Ga0495585_0573747 3300046492 Bacteria 532
391 Ga0495607_0150459 3300046501 Bacteria 1192
392 Ga0495583_0000613 3300046506 Bacteria 48224
393 Ga0495583_0003258 3300046506 Bacteria 12618
394 Ga0495583_0003422 3300046506 Bacteria 12097
395 Ga0495606_0000534 3300046507 Bacteria 61311
396 Ga0495606_0029826 3300046507 Bacteria 3822
397 Ga0495616_0175147 3300046513 Bacteria 957
398 Ga0495620_0078456 3300046515 Bacteria 1339
399 Ga0495637_0073246 3300046520 Bacteria 1378
400 Ga0495643_0002713 3300046522 Bacteria 13632
401 Ga0495643_0041533 3300046522 Bacteria 2507
402 Ga0495643_0077147 3300046522 Bacteria 1741
403 Ga0495643_0109813 3300046522 Bacteria 1403
404 Ga0495643_0181888 3300046522 Bacteria 1021
405 Ga0495643_0321513 3300046522 Bacteria 699
406 Ga0495648_0037222 3300046524 Bacteria 3129
407 Ga0495663_0006859 3300046525 Bacteria 3141
408 Ga0495663_0067794 3300046525 Bacteria 1132
409 Ga0495642_0016668 3300046528 Bacteria 2866
410 Ga0495654_0022239 3300046530 Bacteria 3294
411 Ga0495654_0099878 3300046530 Bacteria 1337
412 Ga0495621_0035277 3300046539 Bacteria 1732
413 Ga0495597_0019553 3300046542 Bacteria 3168
414 Ga0495597_0122557 3300046542 Bacteria 1083
415 Ga0495597_0193910 3300046542 Bacteria 816
416 Ga0495622_0052122 3300046557 Bacteria 1898
417 Ga0495622_0062854 3300046557 Bacteria 1718
418 Ga0495622_0095558 3300046557 Bacteria 1364
419 Ga0495633_0003594 3300046558 Bacteria 10261
420 Ga0495633_0034185 3300046558 Bacteria 2446
421 Ga0495668_0000031 3300046616 Bacteria 256576
422 Ga0495668_0000431 3300046616 Bacteria 54273
423 Ga0495668_0006711 3300046616 Bacteria 7496
424 Ga0495668_0026365 3300046616 Bacteria 3298
425 Ga0495668_0340921 3300046616 Bacteria 822
426 Ga0495611_0023914 3300046648 Bacteria 2654
427 Ga0495611_0269231 3300046648 Bacteria 788
428 Ga0495625_0000115 3300046660 Bacteria 122861
429 Ga0495625_0000584 3300046660 Bacteria 52916
430 Ga0495625_0016790 3300046660 Bacteria 5749
431 Ga0495625_0050383 3300046660 Bacteria 2988
432 Ga0495625_0123182 3300046660 Bacteria 1762
433 Ga0495625_0242222 3300046660 Bacteria 1173
434 Ga0495661_0036418 3300046665 Bacteria 3082
435 Ga0495669_0000129 3300046684 Bacteria 48558
436 Ga0495670_0155465 3300046691 Bacteria 1200
437 Ga0495671_0048528 3300046692 Bacteria 2118
438 Ga0495649_0420650 3300046694 Bacteria 669
439 Ga0495600_0070961 3300046809 Bacteria 2276
440 Ga0495660_0080049 3300046810 Bacteria 1715
441 Ga0495660_0168774 3300046810 Bacteria 1067
442 Ga0495683_0017363 3300047323 Bacteria 3732
443 Ga0495683_0026257 3300047323 Bacteria 2980
444 Ga0495687_000109 3300047443 Bacteria 125648
445 Ga0495687_000745 3300047443 Bacteria 35355
446 Ga0495677_0002458 3300047445 Bacteria 7278
447 Ga0495677_0039944 3300047445 Bacteria 1715
448 Ga0495681_0059972 3300047470 Bacteria 1757
449 Ga0495681_0158364 3300047470 Bacteria 945
450 Ga0495686_0019868 3300047472 Bacteria 4484
451 Ga0495686_0024023 3300047472 Bacteria 4009
452 Ga0495686_0172631 3300047472 Bacteria 1257
453 Ga0495686_0382762 3300047472 Bacteria 759
454 Ga0495615_0004873 3300048090 Bacteria 2374
455 Ga0496101_0086577 3300048904 Bacteria 2324
456 Ga0496102_0000329 3300048905 Bacteria 59006
457 Ga0496102_0149084 3300048905 Bacteria 2197
458 Ga0496102_1182908 3300048905 Bacteria 684
459 Ga0496103_0000164 3300048906 Bacteria 70089
460 Ga0496103_0273311 3300048906 Bacteria 1087
461 Ga0496104_0009543 3300048907 Bacteria 8637
462 Ga0496104_0030262 3300048907 Bacteria 5029
463 Ga0496105_0002044 3300048908 Bacteria 14589
464 Ga0496105_0003939 3300048908 Bacteria 11099
465 Ga0496106_1144792 3300048909 Bacteria 608
466 Ga0496110_0007556 3300048913 Bacteria 8682
467 Ga0496111_0004277 3300048914 Bacteria 8997
468 Ga0496113_0079972 3300048916 Bacteria 2503
469 Ga0496114_0004070 3300048917 Bacteria 11293
470 Ga0496114_0026588 3300048917 Bacteria 4739
471 Ga0496115_0000174 3300048918 Bacteria 59745
472 Ga0496115_0551857 3300048918 Bacteria 921
473 Ga0496115_1400741 3300048918 Bacteria 516
474 Ga0496116_0002115 3300048919 Bacteria 21160
475 Ga0496117_0000432 3300048920 Bacteria 69975
476 Ga0496117_0146496 3300048920 Bacteria 1405
477 Ga0496118_0000127 3300048921 Bacteria 135377
478 Ga0496119_0010430 3300048922 Bacteria 7818
479 Ga0496120_0031188 3300048923 Bacteria 3231
480 Ga0496121_0000335 3300048924 Bacteria 98310
481 Ga0496121_0001019 3300048924 Bacteria 49980
482 Ga0496121_0012335 3300048924 Bacteria 9345
483 Ga0496122_0025958 3300048925 Bacteria 5071
484 Ga0496122_0356953 3300048925 Bacteria 760
485 Ga0496123_0015873 3300048926 Bacteria 6148
486 Ga0496124_0000011 3300048927 Bacteria 524145
487 Ga0496124_0142966 3300048927 Bacteria 1886
488 Ga0496125_0000426 3300048928 Bacteria 78122
489 Ga0496126_0002487 3300048929 Bacteria 24799
490 Ga0496126_0093942 3300048929 Bacteria 2633
491 Ga0496126_0241961 3300048929 Bacteria 1507
492 Ga0496126_0423409 3300048929 Bacteria 1076
493 Ga0495682_0043922 3300049460 Bacteria 1636
494 Ga0501032_0005481 3300049569 Bacteria 9414
495 Ga0501033_0009713 3300049570 Bacteria 7396
496 Ga0501033_0029819 3300049570 Bacteria 4100
497 Ga0501034_0054377 3300049571 Bacteria 4030
498 Ga0501034_0273875 3300049571 Bacteria 1628
499 Ga0501036_0200449 3300049572 Bacteria 1678
500 Ga0501037_0014768 3300049573 Bacteria 5745
501 Ga0501037_0645597 3300049573 Bacteria 708
502 Ga0501038_0008635 3300049574 Bacteria 9354
503 Ga0501038_0862213 3300049574 Bacteria 670
504 Ga0501039_0098042 3300049575 Bacteria 2286
505 Ga0501043_0119222 3300049579 Bacteria 2069
506 Ga0501046_0243036 3300049580 Bacteria 1327
507 Ga0501047_0377297 3300049581 Bacteria 1253
508 Ga0501073_0723247 3300049589 Bacteria 687
509 Ga0501080_0233944 3300049742 Bacteria 1679
510 Ga0501241_024725 3300049758 Bacteria 1116
511 Ga0501035_0011784 3300049822 Bacteria 8095
512 Ga0501035_0136736 3300049822 Bacteria 2133
513 Ga0501035_0274299 3300049822 Bacteria 1427
514 Ga0501044_0023014 3300049823 Bacteria 6631
515 nmdc:mga03683_113102_c1 3300050489 Bacteria 1202
516 nmdc:mga03683_51105_c1 3300050489 Bacteria 1724
517 nmdc:mga00v17_246391_c1 3300050491 Bacteria 1159
518 nmdc:mga0k408_250037_c1 3300050493 Bacteria 1059
519 nmdc:mga0k408_411602_c1 3300050493 Bacteria 804
520 nmdc:mga0sz30_254334_c1 3300050516 Bacteria 782
521 Ga0495612_0308906 3300053078 Bacteria 710
522 Ga0500610_0000456 3300053079 Bacteria 12612
523 Ga0500643_001747 3300053087 Bacteria 12029
524 Ga0500643_005361 3300053087 Bacteria 5542
525 Ga0500643_017248 3300053087 Bacteria 2421
526 Ga0500643_022690 3300053087 Bacteria 2016
527 Ga0500643_030141 3300053087 Bacteria 1664
528 Ga0500647_0048958 3300053091 Bacteria 2032
529 Ga0500651_0175706 3300053093 Bacteria 1274
530 Ga0500556_0000025 3300053104 Bacteria 167307
531 Ga0500557_032917 3300053105 Bacteria 1583
532 Ga0500562_028609 3300053108 Bacteria 1465
533 Ga0500592_006915 3300053116 Bacteria 1806
534 Ga0500594_0043626 3300053118 Bacteria 1237
535 Ga0500595_002662 3300053119 Bacteria 8690
536 Ga0500595_042042 3300053119 Bacteria 1465
537 Ga0500642_0000001 3300053130 Bacteria 1468402
538 Ga0500642_0005597 3300053130 Bacteria 4068
539 Ga0500652_069529 3300053131 Bacteria 1457
540 Ga0500658_0073794 3300053134 Bacteria 1445
541 Ga0500559_0020051 3300053136 Bacteria 2825
542 Ga0500559_0049535 3300053136 Bacteria 1851
543 Ga0500559_0081786 3300053136 Bacteria 1469
544 Ga0500568_0002101 3300053139 Bacteria 12039
545 Ga0500568_0228566 3300053139 Bacteria 679
546 Ga0500588_0365806 3300053146 Bacteria 548
547 Ga0500590_000464 3300053148 Bacteria 13814
548 Ga0500604_0042659 3300053151 Bacteria 1376
549 Ga0500604_0290542 3300053151 Bacteria 567
550 Ga0500616_0119233 3300053153 Bacteria 1263
551 Ga0500627_0000003 3300053158 Bacteria 178186
552 Ga0500627_0141156 3300053158 Bacteria 1088
553 Ga0500636_0001503 3300053177 Bacteria 12686
554 Ga0500645_000001 3300053730 Bacteria 455558
555 Ga0500645_000238 3300053730 Bacteria 41275
556 Ga0500596_001544 3300053735 Bacteria 4667
557 2643819682 2643221560 Bacteria 4801179
558 2643834061 2643221563 Bacteria 4726935
559 2643951888 2643221588 Bacteria 3692460
560 2644054987 2643221608 Bacteria 4724829
561 2644128062 2643221622 Bacteria 4212502
562 2830078546 2830075706 Bacteria 3855215
563 2852654495 2852653556 Bacteria 4050083
564 2852683986 2852680915 Bacteria 4100189
565 2895884364 2895880812 Bacteria 11255272
566 2928031021 2928027323 Bacteria 4382488
567 2984556735 2984555340 Bacteria 4247089
568 2984565095 2984564862 Bacteria 4339992
569 2990267145 2990265787 Bacteria 3943888
570 2993356168 2993356040 Bacteria 4247105
571 2993694098 2993693658 Bacteria 4040749
572 8057101408 8057101203 Bacteria 5034064
573 Ga0209257_1017798
574 ARcpr5yngRDRAFT_c008091
575 JGI24741J21665_1002867
576 JGI24740J21852_10010370
577 JGI24739J22299_10050356
578 JGI24737J22298_10000868
579 JGI24737J22298_10019634
580 JGI24735J21928_10163293
581 JGI24744J21845_10047019
582 JGI25165J46597_1021686
583 JGI25153J46596_10014335
584 Ga0055525_1000099
585 Ga0055542_1000177
586 Ga0055529_1000350
587 Ga0055537_1001791
588 Ga0055524_1000118
589 Ga0055536_1000786
590 Ga0055536_1001470
591 Ga0055534_1009752
592 Ga0055530_10000927
593 Ga0055530_10065525
594 Ga0055531_10000073
595 Ga0055531_10002693
596 Ga0055531_10005219
597 Ga0065165_1012937
598 Ga0065704_10002639
599 Ga0065707_10810303
600 Ga0070658_10001732
601 Ga0070658_10296224
602 Ga0070658_10415927
603 Ga0070658_10556077
604 Ga0070658_11176979
605 Ga0070676_10052188
606 Ga0070670_100004155
607 Ga0070666_10000171
608 Ga0070666_10468089
609 Ga0070682_100946291
610 Ga0070660_100014004
611 Ga0070660_100537338
612 Ga0070661_100247116
613 Ga0070661_100669272
614 Ga0070668_100064809
615 Ga0070668_100082090
616 Ga0070669_100000001
617 Ga0070669_100521421
618 Ga0070675_100142892
619 Ga0070671_100000007
620 Ga0070673_100491618
621 Ga0070659_100075682
622 Ga0070659_100300332
623 Ga0070659_100339687
624 Ga0070659_100506321
625 Ga0070659_100605568
626 Ga0070705_100018159
627 Ga0070708_100233045
628 Ga0070708_101092331
629 Ga0070663_100395515
630 Ga0070678_100000062
631 Ga0070678_100263580
632 Ga0070678_100879404
633 Ga0070678_101034116
634 Ga0070662_100044890
635 Ga0070662_100083112
636 Ga0070681_11028143
637 Ga0068867_100652708
638 Ga0070707_101050074
639 Ga0070679_100111539
640 Ga0070679_100203743
641 Ga0070679_100380299
642 Ga0070679_100894110
643 Ga0070679_101253611
644 Ga0068853_100005064
645 Ga0068853_100107531
646 Ga0068853_100318884
647 Ga0070672_100114964
648 Ga0070672_100857742
649 Ga0070686_100078349
650 Ga0070686_100271183
651 Ga0070665_100000257
652 Ga0070665_100026918
653 Ga0070665_100317545
654 Ga0068855_100067871
655 Ga0068855_100654726
656 Ga0070664_100056966
657 Ga0070664_100088627
658 Ga0068857_100034690
659 Ga0068857_100176493
660 Ga0068854_100634953
661 Ga0068856_100455097
662 Ga0068856_100648535
663 Ga0068856_100662448
664 Ga0070702_100475154
665 Ga0070702_101745409
666 Ga0068859_100008227
667 Ga0068859_100012050
668 Ga0068859_100253494
669 Ga0068859_100329522
670 Ga0068864_100000352
671 Ga0068864_100000809
672 Ga0068861_100002527
673 Ga0068861_100364904
674 Ga0068851_10086805
675 Ga0068870_10470415
676 Ga0068863_100001863
677 Ga0068863_100008510
678 Ga0068858_100000132
679 Ga0068858_100000444
680 Ga0068858_100025759
681 Ga0068858_100150250
682 Ga0068860_100001597
683 Ga0068860_100018882
684 Ga0068862_100000198
685 Ga0068862_100000468
686 Ga0075362_10103281
687 Ga0075366_10026369
688 Ga0075366_10541421
689 Ga0097621_100092357
690 Ga0075370_10186363
691 Ga0068871_100012351
692 Ga0097620_100008228
693 Ga0097620_100012050
694 Ga0097620_100253502
695 Ga0097620_100329527
696 Ga0105250_10062733
697 Ga0105245_10001310
698 Ga0105247_10002160
699 Ga0105247_10041373
700 Ga0105243_10008648
701 Ga0105243_10197056
702 Ga0105243_10711200
703 Ga0105241_10000907
704 Ga0105248_10010177
705 Ga0105248_10108107
706 Ga0105237_10151277
707 Ga0105237_10212383
708 Ga0105238_10097256
709 Ga0105238_10286983
710 Ga0105238_11276190
711 Ga0105249_10000015
712 Ga0105249_10024855
713 Ga0105249_10609447
714 Ga0105249_10618946
715 Ga0105239_10451832
716 Ga0105239_10688452
717 Ga0105239_10810072
718 Ga0105246_10233367
719 Ga0157373_10162726
720 Ga0157371_10000110
721 Ga0157371_10016286
722 Ga0157371_10064604
723 Ga0157371_10152703
724 Ga0157370_10084072
725 Ga0157370_10392105
726 Ga0157370_10553862
727 Ga0157369_10087393
728 Ga0157369_10110306
729 Ga0157369_10456426
730 Ga0157369_10633682
731 Ga0157374_10185921
732 Ga0157374_10900523
733 Ga0157378_10301527
734 Ga0163162_10016899
735 Ga0163162_10059576
736 Ga0163162_12084194
737 Ga0163162_12853360
738 Ga0157372_10043701
739 Ga0157372_10419405
740 Ga0157375_10270124
741 Ga0157375_10886306
742 Ga0163163_10072059
743 Ga0163163_11521021
744 Ga0157380_10083412
745 Ga0182008_10055086
746 Ga0157377_10255225
747 Ga0157379_10028314
748 Ga0157376_10163363
749 Ga0163161_10951769
750 Ga0209436_113379
751 Ga0209674_114896
752 Ga0209563_100081
753 Ga0209437_107618
754 Ga0207425_1024809
755 Ga0209026_1015349
756 Ga0209026_1028036
757 Ga0209677_101398
758 Ga0209148_1000008
759 Ga0209233_1000107
760 Ga0209233_1009720
761 Ga0209565_1000011
762 Ga0209455_1000002
763 Ga0209673_1034050
764 Ga0209675_1000082
765 Ga0209675_1016022
766 Ga0209676_1000130
767 Ga0209676_1000424
768 Ga0209676_1000567
769 Ga0209676_1068856
770 Ga0209025_1004580
771 Ga0209758_1000017
772 Ga0209758_1008619
773 Ga0209050_1000017
774 Ga0209050_1000209
775 Ga0209050_1003944
776 Ga0209050_1017686
777 Ga0209050_1029022
778 Ga0209256_1000016
779 Ga0209257_1000027
780 Ga0209257_1000151
781 Ga0209257_1000202
782 Ga0209257_1001465
783 Ga0207697_10000442
784 Ga0207656_10015529
785 Ga0207656_10458978
786 Ga0207710_10005275
787 Ga0207710_10020610
788 Ga0207688_10021092
789 Ga0207680_10001461
790 Ga0207645_10057309
791 Ga0207705_10000134
792 Ga0207705_10003314
793 Ga0207705_10394010
794 Ga0207705_10963648
795 Ga0207654_10001172
796 Ga0207695_10094763
797 Ga0207695_10141814
798 Ga0207671_10005848
799 Ga0207671_10126060
800 Ga0207657_10006696
801 Ga0207657_10152247
802 Ga0207657_10799588
803 Ga0207649_10000414
804 Ga0207649_10180856
805 Ga0207652_10003472
806 Ga0207652_10167542
807 Ga0207652_11247424
808 Ga0207646_10253259
809 Ga0207681_10000002
810 Ga0207681_10418442
811 Ga0207694_10004909
812 Ga0207694_10064134
813 Ga0207694_10159379
814 Ga0207694_10594460
815 Ga0207650_10015111
816 Ga0207659_10216225
817 Ga0207687_10000473
818 Ga0207644_10000002
819 Ga0207644_10530876
820 Ga0207690_10000828
821 Ga0207690_10013582
822 Ga0207690_10246360
823 Ga0207690_10323728
824 Ga0207690_10355870
825 Ga0207706_10067155
826 Ga0207706_10098375
827 Ga0207709_10000146
828 Ga0207669_10000471
829 Ga0207691_10082465
830 Ga0207711_10122361
831 Ga0207679_10048490
832 Ga0207679_10078059
833 Ga0207667_10000001
834 Ga0207667_10063856
835 Ga0207667_10427562
836 Ga0207712_10000023
837 Ga0207712_10039787
838 Ga0207712_10387379
839 Ga0207712_10393001
840 Ga0207668_10001858
841 Ga0207668_10006951
842 Ga0207668_10088813
843 Ga0207640_10005612
844 Ga0207658_10024359
845 Ga0207703_10001433
846 Ga0207703_10002023
847 Ga0207703_10034502
848 Ga0207703_10275647
849 Ga0207639_10009868
850 Ga0207639_10014011
851 Ga0207639_10036461
852 Ga0207639_10107400
853 Ga0207678_10011541
854 Ga0207678_10137931
855 Ga0207678_10239854
856 Ga0207678_10461977
857 Ga0207678_11411564
858 Ga0207708_10656681
859 Ga0207702_10006202
860 Ga0207641_10001745
861 Ga0207641_10071718
862 Ga0207648_10221977
863 Ga0207648_10284817
864 Ga0207676_10000383
865 Ga0207676_10000930
866 Ga0207676_10940477
867 Ga0207676_11322589
868 Ga0207674_10000811
869 Ga0207674_10117180
870 Ga0207674_10171207
871 Ga0207675_100005628
872 Ga0207675_100158507
873 Ga0207683_10791567
874 Ga0207683_10938767
875 Ga0207698_10003029
876 Ga0207698_10187215
877 Ga0268266_10000036
878 Ga0268266_10019585
879 Ga0268266_10066701
880 Ga0268266_10310268
881 Ga0268265_10000021
882 Ga0268265_10001875
883 Ga0268265_11283327
884 Ga0268264_10000071
885 Ga0268264_10003059
886 Ga0307517_10115254
887 Ga0307513_10019526
888 Ga0307513_10057432
889 Ga0307513_10057681
890 Ga0307509_10038934
891 Ga0307408_100212563
892 Ga0307408_101121754
893 Ga0307508_10000356
894 Ga0307413_10039051
895 Ga0307413_10135813
896 Ga0307413_10237446
897 Ga0307413_10393417
898 Ga0307406_10295307
899 Ga0307406_10844222
900 Ga0307407_11349170
901 Ga0307412_10016340
902 Ga0307412_10077047
903 Ga0307412_10090369
904 Ga0307409_101735891
905 Ga0307416_101141521
906 Ga0307416_102033351
907 Ga0307416_102337355
908 Ga0307416_102843201
909 Ga0307414_10000090
910 Ga0307414_10001972
911 Ga0307414_10003123
912 Ga0307414_10013210
913 Ga0307414_10215518
914 Ga0307414_10252622
915 Ga0307414_10296448
916 Ga0307414_10470376
917 Ga0307414_10892214
918 Ga0307411_10175401
919 Ga0307411_10908576
920 Ga0307411_11089969
921 Ga0307411_11093621
922 Ga0307510_10004538
923 Ga0307510_10082035
924 Ga0307510_10536628
925 Ga0307510_10572945
926 Ga0373923_0027044
927 Ga0436364_1384628
928 Ga0439461_0002790
929 Ga0439466_0049020
930 Ga0439465_0003006
931 Ga0439465_0003406
932 Ga0451791_1557663
933 Ga0451806_247895
934 Ga0451837_1492165
935 Ga0451853_0466089
936 Ga0439431_0000298
937 Ga0439431_0066277
938 Ga0439442_011459
939 Ga0439443_006941
940 Ga0439445_0002640
941 Ga0439445_0031735
942 Ga0439432_013725
943 Ga0439452_008745
944 Ga0439452_045041
945 Ga0439457_103321
946 Ga0439462_0003860
947 Ga0439462_0141927
948 Ga0450894_019123
949 Ga0450898_038420
950 Ga0439446_0032481
951 Ga0439434_0012951
952 Ga0439434_0014528
953 Ga0451576_0477161
954 Ga0495617_011485
955 Ga0495627_005135
956 Ga0495627_182167
957 Ga0495638_0000261
958 Ga0495638_0158766
959 Ga0495650_0000428
960 Ga0495585_0006171
961 Ga0495585_0076455
962 Ga0495585_0573747
963 Ga0495607_0150459
964 Ga0495583_0000613
965 Ga0495583_0003258
966 Ga0495583_0003422
967 Ga0495606_0000534
968 Ga0495606_0029826
969 Ga0495616_0175147
970 Ga0495620_0078456
971 Ga0495637_0073246
972 Ga0495643_0002713
973 Ga0495643_0041533
974 Ga0495643_0077147
975 Ga0495643_0109813
976 Ga0495643_0181888
977 Ga0495643_0321513
978 Ga0495648_0037222
979 Ga0495663_0006859
980 Ga0495663_0067794
981 Ga0495642_0016668
982 Ga0495654_0022239
983 Ga0495654_0099878
984 Ga0495621_0035277
985 Ga0495597_0019553
986 Ga0495597_0122557
987 Ga0495597_0193910
988 Ga0495622_0052122
989 Ga0495622_0062854
990 Ga0495622_0095558
991 Ga0495633_0003594
992 Ga0495633_0034185
993 Ga0495668_0000031
994 Ga0495668_0000431
995 Ga0495668_0006711
996 Ga0495668_0026365
997 Ga0495668_0340921
998 Ga0495611_0023914
999 Ga0495611_0269231
1000 Ga0495625_0000115
1001 Ga0495625_0000584
1002 Ga0495625_0016790
1003 Ga0495625_0050383
1004 Ga0495625_0123182
1005 Ga0495625_0242222
1006 Ga0495661_0036418
1007 Ga0495669_0000129
1008 Ga0495670_0155465
1009 Ga0495671_0048528
1010 Ga0495649_0420650
1011 Ga0495600_0070961
1012 Ga0495660_0080049
1013 Ga0495660_0168774
1014 Ga0495683_0017363
1015 Ga0495683_0026257
1016 Ga0495687_000109
1017 Ga0495687_000745
1018 Ga0495677_0002458
1019 Ga0495677_0039944
1020 Ga0495681_0059972
1021 Ga0495681_0158364
1022 Ga0495686_0019868
1023 Ga0495686_0024023
1024 Ga0495686_0172631
1025 Ga0495686_0382762
1026 Ga0495615_0004873
1027 Ga0496101_0086577
1028 Ga0496102_0000329
1029 Ga0496102_0149084
1030 Ga0496102_1182908
1031 Ga0496103_0000164
1032 Ga0496103_0273311
1033 Ga0496104_0009543
1034 Ga0496104_0030262
1035 Ga0496105_0002044
1036 Ga0496105_0003939
1037 Ga0496106_1144792
1038 Ga0496110_0007556
1039 Ga0496111_0004277
1040 Ga0496113_0079972
1041 Ga0496114_0004070
1042 Ga0496114_0026588
1043 Ga0496115_0000174
1044 Ga0496115_0551857
1045 Ga0496115_1400741
1046 Ga0496116_0002115
1047 Ga0496117_0000432
1048 Ga0496117_0146496
1049 Ga0496118_0000127
1050 Ga0496119_0010430
1051 Ga0496120_0031188
1052 Ga0496121_0000335
1053 Ga0496121_0001019
1054 Ga0496121_0012335
1055 Ga0496122_0025958
1056 Ga0496122_0356953
1057 Ga0496123_0015873
1058 Ga0496124_0000011
1059 Ga0496124_0142966
1060 Ga0496125_0000426
1061 Ga0496126_0002487
1062 Ga0496126_0093942
1063 Ga0496126_0241961
1064 Ga0496126_0423409
1065 Ga0495682_0043922
1066 Ga0501032_0005481
1067 Ga0501033_0009713
1068 Ga0501033_0029819
1069 Ga0501034_0054377
1070 Ga0501034_0273875
1071 Ga0501036_0200449
1072 Ga0501037_0014768
1073 Ga0501037_0645597
1074 Ga0501038_0008635
1075 Ga0501038_0862213
1076 Ga0501039_0098042
1077 Ga0501043_0119222
1078 Ga0501046_0243036
1079 Ga0501047_0377297
1080 Ga0501073_0723247
1081 Ga0501080_0233944
1082 Ga0501241_024725
1083 Ga0501035_0011784
1084 Ga0501035_0136736
1085 Ga0501035_0274299
1086 Ga0501044_0023014
1087 nmdc:mga03683_113102_c1
1088 nmdc:mga03683_51105_c1
1089 nmdc:mga00v17_246391_c1
1090 nmdc:mga0k408_250037_c1
1091 nmdc:mga0k408_411602_c1
1092 nmdc:mga0sz30_254334_c1
1093 Ga0495612_0308906
1094 Ga0500610_0000456
1095 Ga0500643_001747
1096 Ga0500643_005361
1097 Ga0500643_017248
1098 Ga0500643_022690
1099 Ga0500643_030141
1100 Ga0500647_0048958
1101 Ga0500651_0175706
1102 Ga0500556_0000025
1103 Ga0500557_032917
1104 Ga0500562_028609
1105 Ga0500592_006915
1106 Ga0500594_0043626
1107 Ga0500595_002662
1108 Ga0500595_042042
1109 Ga0500642_0000001
1110 Ga0500642_0005597
1111 Ga0500652_069529
1112 Ga0500658_0073794
1113 Ga0500559_0020051
1114 Ga0500559_0049535
1115 Ga0500559_0081786
1116 Ga0500568_0002101
1117 Ga0500568_0228566
1118 Ga0500588_0365806
1119 Ga0500590_000464
1120 Ga0500604_0042659
1121 Ga0500604_0290542
1122 Ga0500616_0119233
1123 Ga0500627_0000003
1124 Ga0500627_0141156
1125 Ga0500636_0001503
1126 Ga0500645_000001
1127 Ga0500645_000238
1128 Ga0500596_001544
1129 2643819682
1130 2643834061
1131 2643951888
1132 2644054987
1133 2644128062
1134 2830078546
1135 2852654495
1136 2852683986
1137 2895884364
1138 2928031021
1139 2984556735
1140 2984565095
1141 2990267145
1142 2993356168
1143 2993694098
1144 8057101408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

56

142

0.98

PF13279

4HBT_2

Thioesterase-like superfamily

48

168

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9635 14 141
3ck1-assembly1.cif.gz_A crystal structure of a putative thioesterase (reut_a2179) from ralstonia eutropha jmp134 at 1.74 a resolution 0.9384 14 146
5wh9-assembly2.cif.gz_C-3 structure of bh1999 gentisyl-coenzyme a thioesterase 0.9377 16 135
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9375 16 141
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9354 14 141
ID Description Score Start End Superfamily
5eo2C01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9318 16 140 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9317 14 139 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9312 16 140 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9309 13 140 3.10.129.10
af_Q2FYS8_3_144_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9278 16 143 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A418W7U9-F1-model_v4 YbgC/FadM family acyl-CoA thioesterase (EC 3.1.2.-) 0.9919 8 143 GO:0047617
AF-A0A543LR33-F1-model_v4 deleted 0.9894 8 148
AF-A0A0J8AK81-F1-model_v4 Thioesterase 0.9851 8 143 GO:0047617
AF-A0A2D8D9B0-F1-model_v4 Thioesterase 0.9848 8 143 GO:0047617
AF-A0A653JMF1-F1-model_v4 Thioesterase 0.9847 8 143 GO:0047617

Map