F465085

General Info

Members Datasets Scaffolds Average Seq Length
572 471 1144 445

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10027749|Ga0307405_100277492
Length 509
Sequence MVKASGVAAYYALIRIASLADWEEDARGRTNRDAIPDRPTAMVHSGEPIFGRDFMTTSQNGKSLGLAACTAIVVGNMVGSGFYLSPAAVAPYGNLAILVWMIMGAGAICLGLTFARLAGMVPAVGGPYAYTRLAYGDFAGFLIAWGYWISIWSSLPVIAIAFTGVMIDLFPALGNRLTATVLTLGVIWTIVLVNLRGVHAAGLFAQVTTYAKLIPFGAVAIIGLLYIDTSHFAEFNPSGQSLLQSFAALAPLTMFAYLGLESATVPAGDVRDARRTIPRSTVLGISIAAALYVLGTVVVMGVVPRPQLIHSVAPFSEAAGLMWGRGGELAISIAVVISSIGALNGWTLLMGQVPMAAARDGLFPPLFARLSSRGVPAIGMVVSATFATLLVLVQAVGSDSFAAVYRLMVGLSTMTAVVPYAFCALAGTLVASRLSNGQKTPRVTVIELIAFLFAMFTLYGSGAEPVLYGMVLLMLGIPVYVWQRRNGEVARAQSVETQNGAPIRPAASL

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
72 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
85 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
137 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
200 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
209 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
210 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
211 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
212 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
213 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
214 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
215 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
216 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
217 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
218 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
219 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
220 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
221 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
222 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
223 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
224 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
225 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
226 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
227 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
228 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
229 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
230 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
231 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
232 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
233 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
234 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
235 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
236 2643221599 Rhizobium sp. Root708 Isolate Unclassified
237 2718217927 Rhizobium sp. N324 Isolate Nodule
238 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
239 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
240 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
241 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
242 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
243 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
244 2718218423 Rhizobium sp. N941 Isolate Nodule
245 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
246 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
247 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
248 2721755809 Rhizobium sp. N541 Isolate Nodule
249 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
250 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
251 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
252 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
253 2738541293 Rhizobium sp. GV031 Isolate Unclassified
254 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
255 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
256 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
257 2791355260 Rhizobium sp. L9 Isolate Nodule
258 2791355261 Rhizobium sp. J15 Isolate Nodule
259 2791355263 Rhizobium chutanense C5 Isolate Nodule
260 2791355267 Rhizobium sp. L18 Isolate Nodule
261 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
262 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
263 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
264 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
265 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
266 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
267 2802429633 Rhizobium anhuiense J3 Isolate Nodule
268 2802429634 Rhizobium anhuiense S10 Isolate Nodule
269 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
270 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
271 2802429637 Rhizobium anhuiense C15 Isolate Nodule
272 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
273 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
274 2838048938 Rhizobium pisi 27/80 Isolate Nodule
275 2838061910 Rhizobium phaseoli L15 Isolate Nodule
276 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
277 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
278 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
279 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
280 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
281 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
282 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
283 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
284 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
285 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
286 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
287 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
288 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
289 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
290 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
291 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
292 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
293 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
294 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
295 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
296 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
297 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
298 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
299 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
300 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
301 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
302 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
303 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
304 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
305 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
306 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
307 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
308 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
309 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
310 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
311 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
312 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
313 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
314 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
315 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
316 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
317 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
318 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
319 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
320 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
321 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
322 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
323 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
324 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
325 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
326 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
327 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
328 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
329 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
330 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
331 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
332 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
333 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
334 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
335 2933599457 Rhizobium phaseoli M3 Isolate Nodule
336 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
337 2936381700 Rhizobium chutanense C16 Isolate Unclassified
338 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
339 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
340 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
341 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
342 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
343 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
344 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
345 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
346 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
347 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
348 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
349 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
350 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
351 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
352 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
353 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
354 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
355 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
356 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
357 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
358 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
359 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
360 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
361 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
362 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
363 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
364 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
365 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
366 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
367 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
368 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
369 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
370 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
371 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
372 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
373 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
374 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
375 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
376 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
377 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
378 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
379 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
380 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
381 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
382 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
383 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
384 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
385 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
386 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
387 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
388 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
389 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
390 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
391 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
392 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
393 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
394 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
395 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
396 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
397 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
398 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
399 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
400 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
401 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
402 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
403 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
404 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
405 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
406 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
407 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
408 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
409 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
410 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
411 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
412 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
413 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
414 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
415 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
416 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
417 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
418 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
419 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
420 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
421 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
422 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
423 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
424 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
425 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
426 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
427 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
428 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
429 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
430 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
431 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
432 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
433 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
434 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
435 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
436 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
437 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
438 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
439 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
440 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
441 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
442 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
443 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
444 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
445 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
446 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
447 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
448 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
449 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
450 2996893221 Rhizobium sp. R635 Isolate Nodule
451 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
452 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
453 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
454 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
455 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
456 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
457 8005275841 Rhizobium sp. N4311 Isolate Nodule
458 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
459 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
460 8005382845 Rhizobium sp. R634 Isolate Nodule
461 8005395548 Rhizobium sp. R339 Isolate Nodule
462 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
463 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
464 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
465 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
466 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
467 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
468 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
469 8018176218 Rhizobium sp. N122 Isolate Nodule
470 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
471 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.67
Metatranscriptomes 0
Isolates 46.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.56
Nodule 44.58
Rhizoplane 1.05
Rhizosphere 31.64
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10027749 3300031731 Bacteria 3288
2 JGI24744J21845_10002512 3300002077 Bacteria 3742
3 JGI25158J39367_1001294 3300002739 Bacteria 4466
4 JGI25152J39213_1005620 3300002773 Bacteria 3602
5 JGI25150J39212_1000334 3300002774 Bacteria 23216
6 JGI25151J46595_10000027 3300003187 Bacteria 208739
7 JGI25151J46595_10000282 3300003187 Bacteria 57997
8 JGI25153J46596_10000734 3300003215 Bacteria 20111
9 JGI25153J46596_10004033 3300003215 Bacteria 8008
10 JGI25153J46596_10011982 3300003215 Bacteria 3790
11 rootH2_10004419 3300003320 Bacteria 46013
12 rootH2_10116546 3300003320 Bacteria 6128
13 rootH1_10024310 3300003323 Bacteria 54858
14 rootH1_10349092 3300003323 Bacteria 1831
15 JGI25160J50197_1003201 3300003354 Bacteria 7413
16 JGI25160J50197_1006027 3300003354 Bacteria 4958
17 JGI25161J50226_1000010 3300003374 Bacteria 214823
18 Ga0055526_1002049 3300003771 Bacteria 13853
19 Ga0055524_1008111 3300003775 Bacteria 4390
20 Ga0055524_1021078 3300003775 Bacteria 2172
21 Ga0055528_1000214 3300003790 Bacteria 49244
22 Ga0055528_1003057 3300003790 Bacteria 8608
23 Ga0055528_1004954 3300003790 Bacteria 6288
24 Ga0055528_1011827 3300003790 Bacteria 3432
25 Ga0055540_1000198 3300003792 Bacteria 58380
26 Ga0055540_1005930 3300003792 Bacteria 4978
27 Ga0055531_10000061 3300003794 Bacteria 120535
28 Ga0055543_1000064 3300004625 Bacteria 97355
29 Ga0055543_1000843 3300004625 Bacteria 14832
30 Ga0065165_1011377 3300005262 Bacteria 3722
31 Ga0068868_100010304 3300005338 Bacteria 6761
32 Ga0068868_100052719 3300005338 Bacteria 3202
33 Ga0068868_100186924 3300005338 Bacteria 1722
34 Ga0070660_100025389 3300005339 Bacteria 4404
35 Ga0070689_100197320 3300005340 Unclassified 1641
36 Ga0070671_100008343 3300005355 Bacteria 8298
37 Ga0070671_100077206 3300005355 Bacteria 2783
38 Ga0070673_100004463 3300005364 Bacteria 8848
39 Ga0070673_100008068 3300005364 Bacteria 6978
40 Ga0070688_100138905 3300005365 Bacteria 1648
41 Ga0070659_100087862 3300005366 Bacteria 2489
42 Ga0070659_100159138 3300005366 Bacteria 1846
43 Ga0070705_100014803 3300005440 Bacteria 4022
44 Ga0070678_100113083 3300005456 Bacteria 2127
45 Ga0070662_100000043 3300005457 Bacteria 70660
46 Ga0068867_100002700 3300005459 Bacteria 12519
47 Ga0070706_100031979 3300005467 Bacteria 4852
48 Ga0070707_100119239 3300005468 Unclassified 2561
49 Ga0070699_100040328 3300005518 Unclassified 4043
50 Ga0068853_100002294 3300005539 Bacteria 14298
51 Ga0070672_100123467 3300005543 Unclassified 2122
52 Ga0070695_100094402 3300005545 Bacteria 2003
53 Ga0070696_100010446 3300005546 Bacteria 6222
54 Ga0070665_100000017 3300005548 Bacteria 448013
55 Ga0068855_100000387 3300005563 Bacteria 54152
56 Ga0068855_100087892 3300005563 Bacteria 3591
57 Ga0068856_100000650 3300005614 Bacteria 37676
58 Ga0068852_100000477 3300005616 Bacteria 26260
59 Ga0068866_10033673 3300005718 Bacteria 2488
60 Ga0068861_100046813 3300005719 Bacteria 3263
61 Ga0068862_100019774 3300005844 Bacteria 5624
62 Ga0075365_10005504 3300006038 Bacteria 6838
63 Ga0075365_10013904 3300006038 Bacteria 4829
64 Ga0075363_100007133 3300006048 Bacteria 5116
65 Ga0070716_100016381 3300006173 Bacteria 3824
66 Ga0070712_100006290 3300006175 Bacteria 7357
67 Ga0075362_10000772 3300006177 Bacteria 9523
68 Ga0075367_10000263 3300006178 Bacteria 18016
69 Ga0075369_10004968 3300006186 Bacteria 4948
70 Ga0075366_10000964 3300006195 Bacteria 14035
71 Ga0097621_100000354 3300006237 Bacteria 31698
72 Ga0097621_100001356 3300006237 Bacteria 16859
73 Ga0097621_100017926 3300006237 Bacteria 5392
74 Ga0075370_10005498 3300006353 Bacteria 6308
75 Ga0068871_100008689 3300006358 Bacteria 7307
76 Ga0068871_100018423 3300006358 Bacteria 5306
77 Ga0068871_100036582 3300006358 Bacteria 3910
78 Ga0075428_100040373 3300006844 Bacteria 5134
79 Ga0075430_100017957 3300006846 Bacteria 6020
80 Ga0075433_10136526 3300006852 Bacteria 2180
81 Ga0075434_100031136 3300006871 Bacteria 5258
82 Ga0075429_100018297 3300006880 Bacteria 6066
83 Ga0075429_100022667 3300006880 Bacteria 5444
84 Ga0068865_100137750 3300006881 Bacteria 1836
85 Ga0079104_1012272 3300006946 Bacteria 2706
86 Ga0075435_100062449 3300007076 Unclassified 3023
87 Ga0105240_10050876 3300009093 Bacteria 5219
88 Ga0105240_10066818 3300009093 Bacteria 4459
89 Ga0111539_10012770 3300009094 Bacteria 10511
90 Ga0111539_10026707 3300009094 Bacteria 7056
91 Ga0111539_10290209 3300009094 Unclassified 1903
92 Ga0105245_10000555 3300009098 Bacteria 33866
93 Ga0105245_10108840 3300009098 Bacteria 2574
94 Ga0105245_10119310 3300009098 Bacteria 2462
95 Ga0114129_10000600 3300009147 Bacteria 44447
96 Ga0105243_10047511 3300009148 Unclassified 3379
97 Ga0105242_10017865 3300009176 Bacteria 5536
98 Ga0105242_10078072 3300009176 Unclassified 2763
99 Ga0105248_10085107 3300009177 Bacteria 3558
100 Ga0105237_10001687 3300009545 Bacteria 28587
101 Ga0105237_10001937 3300009545 Bacteria 26385
102 Ga0123341_1000011 3300009765 Bacteria 108023
103 Ga0123342_1019934 3300009766 Bacteria 5003
104 Ga0105239_10080658 3300010375 Bacteria 3580
105 Ga0105239_10208908 3300010375 Unclassified 2188
106 Ga0105246_10034323 3300011119 Bacteria 3379
107 Ga0105246_10138012 3300011119 Bacteria 1830
108 Ga0157371_10016277 3300013102 Bacteria 5555
109 Ga0157374_10000907 3300013296 Bacteria 25765
110 Ga0157374_10019122 3300013296 Bacteria 6061
111 Ga0157378_10000697 3300013297 Bacteria 31510
112 Ga0157378_10018521 3300013297 Bacteria 6119
113 Ga0163162_10000051 3300013306 Bacteria 117695
114 Ga0157372_10019492 3300013307 Bacteria 7314
115 Ga0157375_10094883 3300013308 Bacteria 3053
116 Ga0157376_10029372 3300014969 Bacteria 4378
117 Ga0163161_10029608 3300017792 Bacteria 3893
118 Ga0213872_10041411 3300021361 Bacteria 2102
119 Ga0228711_1001405 3300022739 Bacteria 35255
120 Ga0228711_1011881 3300022739 Bacteria 10879
121 Ga0228710_1027306 3300022740 Bacteria 3365
122 Ga0209436_100037 3300025208 Bacteria 76864
123 Ga0207425_1000043 3300025245 Bacteria 208791
124 Ga0207425_1005273 3300025245 Bacteria 3713
125 Ga0207425_1020127 3300025245 Bacteria 1430
126 Ga0209129_1000072 3300025258 Bacteria 208805
127 Ga0209129_1000167 3300025258 Bacteria 97701
128 Ga0209129_1004525 3300025258 Bacteria 5379
129 Ga0209673_1000020 3300025273 Bacteria 430653
130 Ga0209673_1000182 3300025273 Bacteria 127522
131 Ga0209673_1000325 3300025273 Bacteria 87535
132 Ga0209673_1001367 3300025273 Bacteria 24030
133 Ga0209673_1001800 3300025273 Bacteria 17675
134 Ga0209673_1021122 3300025273 Bacteria 2286
135 Ga0209673_1029834 3300025273 Bacteria 1729
136 Ga0209130_1000001 3300025284 Bacteria 831557
137 Ga0209676_1034936 3300025292 Bacteria 1480
138 Ga0209025_1000120 3300025294 Bacteria 208791
139 Ga0209025_1000483 3300025294 Bacteria 77146
140 Ga0209025_1003635 3300025294 Bacteria 14324
141 Ga0209564_1000560 3300025295 Bacteria 59426
142 Ga0209564_1000703 3300025295 Bacteria 48991
143 Ga0209564_1001374 3300025295 Bacteria 25466
144 Ga0209564_1013821 3300025295 Bacteria 3398
145 Ga0209564_1034918 3300025295 Bacteria 1465
146 Ga0209758_1000111 3300025297 Bacteria 208790
147 Ga0209758_1000544 3300025297 Bacteria 59862
148 Ga0209758_1011173 3300025297 Bacteria 5240
149 Ga0209758_1026183 3300025297 Bacteria 2533
150 Ga0209256_1000245 3300025299 Bacteria 96643
151 Ga0209256_1001446 3300025299 Bacteria 24515
152 Ga0209256_1001750 3300025299 Bacteria 20674
153 Ga0209256_1005073 3300025299 Bacteria 7832
154 Ga0209256_1023227 3300025299 Bacteria 1854
155 Ga0207426_1000039 3300025302 Bacteria 439937
156 Ga0207426_1000045 3300025302 Bacteria 422847
157 Ga0209051_1000195 3300025303 Bacteria 107201
158 Ga0209051_1006741 3300025303 Bacteria 6412
159 Ga0209051_1011998 3300025303 Bacteria 4228
160 Ga0209257_1000006 3300025304 Bacteria 1570111
161 Ga0209257_1006575 3300025304 Bacteria 7414
162 Ga0207642_10029505 3300025899 Bacteria 2272
163 Ga0207680_10016051 3300025903 Bacteria 3923
164 Ga0207647_10000036 3300025904 Bacteria 98204
165 Ga0207645_10000312 3300025907 Bacteria 40968
166 Ga0207684_10055566 3300025910 Bacteria 3358
167 Ga0207695_10018287 3300025913 Bacteria 8108
168 Ga0207695_10036841 3300025913 Bacteria 5282
169 Ga0207671_10000514 3300025914 Bacteria 52449
170 Ga0207693_10023040 3300025915 Bacteria 4946
171 Ga0207646_10038163 3300025922 Unclassified 4328
172 Ga0207644_10004416 3300025931 Bacteria 9125
173 Ga0207644_10050384 3300025931 Bacteria 2984
174 Ga0207690_10066690 3300025932 Bacteria 2466
175 Ga0207706_10000125 3300025933 Bacteria 83075
176 Ga0207686_10039383 3300025934 Bacteria 2868
177 Ga0207704_10000043 3300025938 Bacteria 88714
178 Ga0207665_10039917 3300025939 Bacteria 3130
179 Ga0207691_10143413 3300025940 Unclassified 2103
180 Ga0207711_10080306 3300025941 Bacteria 2848
181 Ga0207667_10071830 3300025949 Bacteria 3598
182 Ga0207651_10004451 3300025960 Bacteria 7065
183 Ga0207677_10005173 3300026023 Bacteria 7061
184 Ga0207677_10035317 3300026023 Bacteria 3246
185 Ga0207639_10005247 3300026041 Bacteria 8741
186 Ga0207702_10000689 3300026078 Bacteria 36498
187 Ga0207641_10020148 3300026088 Bacteria 5475
188 Ga0207648_10000961 3300026089 Bacteria 32589
189 Ga0207675_100020701 3300026118 Bacteria 6132
190 Ga0207683_10025462 3300026121 Bacteria 5105
191 Ga0207698_10004826 3300026142 Bacteria 8257
192 Ga0209281_1003171 3300027111 Bacteria 5675
193 Ga0209281_1004737 3300027111 Bacteria 3980
194 Ga0209282_1000049 3300027666 Bacteria 109875
195 Ga0207428_10023983 3300027907 Bacteria 5123
196 Ga0268266_10000037 3300028379 Bacteria 342368
197 Ga0268266_10032936 3300028379 Bacteria 4405
198 Ga0307408_100060660 3300031548 Bacteria 2758
199 Ga0307407_10006334 3300031903 Bacteria 5242
200 Ga0307412_10002666 3300031911 Bacteria 9903
201 Ga0315914_1000005 3300031967 Bacteria 242195
202 Ga0316583_10013144 3300032133 Bacteria 2987
203 Ga0307510_10000149 3300033180 Bacteria 58176
204 Ga0307510_10001456 3300033180 Bacteria 26103
205 Ga0315913_1012649 3300033430 Bacteria 9345
206 Ga0315915_1000004 3300033464 Bacteria 403083
207 Ga0373955_0029174 3300035172 Bacteria 2867
208 Ga0373925_0101004 3300037068 Bacteria 2218
209 Ga0395899_0000999 3300037312 Bacteria 25966
210 Ga0395905_0002075 3300037471 Bacteria 22818
211 Ga0395905_0003901 3300037471 Bacteria 15732
212 Ga0395901_0012223 3300038443 Bacteria 8712
213 Ga0436361_0994938 3300039447 Bacteria 8280
214 Ga0439465_0009791 3300041413 Bacteria 3019
215 Ga0439465_0013216 3300041413 Bacteria 2578
216 Ga0451851_0288635 3300041507 Bacteria 11914
217 Ga0451853_1525072 3300041512 Bacteria 6920
218 Ga0451577_0016002 3300042876 Bacteria 6959
219 Ga0466972_0002022 3300044658 Bacteria 9933
220 Ga0453684_0038138 3300044712 Bacteria 6577
221 Ga0451576_0013028 3300045051 Bacteria 9316
222 Ga0451576_0029640 3300045051 Bacteria 5854
223 Ga0495629_0047356 3300046459 Bacteria 3016
224 Ga0495638_0000210 3300046460 Bacteria 82776
225 Ga0495638_0024736 3300046460 Bacteria 3910
226 Ga0495638_0044200 3300046460 Bacteria 2807
227 Ga0495638_0056425 3300046460 Bacteria 2437
228 Ga0495651_0061428 3300046462 Unclassified 2876
229 Ga0495605_0033666 3300046474 Bacteria 2599
230 Ga0495610_0030131 3300046512 Bacteria 2847
231 Ga0495631_0002991 3300046518 Bacteria 9350
232 Ga0495631_0003351 3300046518 Bacteria 8788
233 Ga0495631_0057870 3300046518 Bacteria 1686
234 Ga0495632_0008797 3300046519 Bacteria 6152
235 Ga0495632_0028484 3300046519 Bacteria 2915
236 Ga0495643_0002993 3300046522 Bacteria 12758
237 Ga0495643_0012541 3300046522 Bacteria 5109
238 Ga0495597_0006661 3300046542 Bacteria 5951
239 Ga0495625_0045523 3300046660 Bacteria 3171
240 Ga0495670_0014985 3300046691 Bacteria 3815
241 Ga0495649_0004550 3300046694 Bacteria 9046
242 Ga0495660_0004225 3300046810 Bacteria 8723
243 Ga0495672_0058802 3300047320 Bacteria 2227
244 Ga0495687_048135 3300047443 Bacteria 1831
245 Ga0495675_0117706 3300047444 Unclassified 1656
246 Ga0495685_022803 3300047447 Bacteria 2154
247 Ga0495686_0099217 3300047472 Bacteria 1758
248 Ga0496101_0043144 3300048904 Bacteria 3222
249 Ga0496106_0000265 3300048909 Bacteria 36882
250 Ga0496106_0140442 3300048909 Bacteria 1900
251 Ga0496107_0152596 3300048910 Unclassified 1709
252 Ga0496109_0232909 3300048912 Bacteria 1733
253 Ga0496112_0003215 3300048915 Bacteria 13451
254 Ga0496116_0000760 3300048919 Bacteria 40895
255 Ga0496116_0005937 3300048919 Bacteria 11197
256 Ga0496116_0047332 3300048919 Bacteria 2895
257 Ga0496117_0010370 3300048920 Bacteria 8505
258 Ga0496117_0022083 3300048920 Bacteria 5114
259 Ga0496117_0054186 3300048920 Bacteria 2811
260 Ga0496118_0012557 3300048921 Bacteria 8113
261 Ga0496118_0063494 3300048921 Bacteria 2717
262 Ga0496121_0003686 3300048924 Bacteria 21497
263 Ga0496121_0030814 3300048924 Bacteria 4918
264 Ga0496121_0041890 3300048924 Bacteria 3993
265 Ga0496121_0071833 3300048924 Bacteria 2781
266 Ga0496122_0002982 3300048925 Bacteria 23041
267 Ga0496122_0005657 3300048925 Bacteria 14754
268 Ga0496122_0028391 3300048925 Bacteria 4748
269 Ga0496123_0009916 3300048926 Bacteria 8498
270 Ga0496123_0010214 3300048926 Bacteria 8328
271 Ga0496124_0000552 3300048927 Bacteria 63342
272 Ga0496124_0002958 3300048927 Bacteria 21331
273 Ga0496124_0040098 3300048927 Bacteria 4053
274 Ga0496125_0002002 3300048928 Bacteria 27621
275 Ga0496125_0052875 3300048928 Bacteria 3336
276 Ga0495678_023118 3300049459 Bacteria 2709
277 Ga0501076_0102834 3300049592 Bacteria 2304
278 nmdc:mga03683_5756_c1 3300050489 Bacteria 4207
279 nmdc:mga03n38_57886_c1 3300050490 Bacteria 1754
280 nmdc:mga0yw44_6775_c1 3300050492 Bacteria 5567
281 nmdc:mga0k408_2744_c1 3300050493 Bacteria 9361
282 nmdc:mga0k408_38516_c1 3300050493 Bacteria 2743
283 nmdc:mga06z11_3125_c2 3300050494 Bacteria 5780
284 nmdc:mga07m45_85143_c1 3300050496 Bacteria 1808
285 nmdc:mga05p37_11_c1 3300050507 Bacteria 149577
286 nmdc:mga05p37_939_c1 3300050507 Bacteria 32816
287 nmdc:mga09592_104771_c1 3300050508 Bacteria 2424
288 nmdc:mga06r32_51734_c1 3300050510 Bacteria 3932
289 nmdc:mga08y16_10870_c1 3300050511 Bacteria 9560
290 nmdc:mga08y16_6417_c1 3300050511 Bacteria 12328
291 nmdc:mga0n895_29178_c1 3300050512 Bacteria 5258
292 nmdc:mga0rr50_49768_c1 3300050513 Bacteria 3103
293 nmdc:mga0a205_109010_c1 3300050515 Bacteria 2667
294 nmdc:mga0a205_99222_c1 3300050515 Bacteria 2810
295 nmdc:mga0sz30_4803_c1 3300050516 Bacteria 4918
296 nmdc:mga0sz30_7421_c1 3300050516 Bacteria 4111
297 Ga0495601_0018332 3300053077 Bacteria 4258
298 Ga0495601_0033596 3300053077 Bacteria 3196
299 Ga0500610_0006335 3300053079 Bacteria 4954
300 Ga0500557_000241 3300053105 Bacteria 8018
301 Ga0500658_0000416 3300053134 Bacteria 18445
302 Ga0500568_0000673 3300053139 Bacteria 24685
303 Ga0500588_0032218 3300053146 Bacteria 1519
304 Ga0500604_0005991 3300053151 Bacteria 3209
305 Ga0500616_0039730 3300053153 Bacteria 2534
306 Ga0500622_0000450 3300053156 Bacteria 39151
307 Ga0501082_0226447 3300060353 Bacteria 1627
308 2509447677 2509276033 Bacteria 7180565
309 2510305617 2510065057 Bacteria 6649661
310 2511193965 2510917030 Bacteria 7460662
311 2512974919 2512875026 Bacteria 6861065
312 2513579801 2513237085 Bacteria 7695351
313 2513586458 2513237086 Bacteria 7265287
314 2513603746 2513237089 Bacteria 6553624
315 2513620133 2513237091 Bacteria 6900273
316 2513986456 2513237156 Bacteria 6402557
317 2514004297 2513237160 Bacteria 6650282
318 2515738256 2515154134 Bacteria 7220242
319 2516896992 2516653046 Bacteria 6989037
320 2517080299 2516653085 Bacteria 7346596
321 2517567566 2517487022 Bacteria 7227575
322 2551676040 2551306084 Bacteria 8942552
323 2551678192 2551306084 Bacteria 8942552
324 2551688952 2551306085 Bacteria 7347181
325 2551700382 2551306087 Bacteria 7351905
326 2551708465 2551306089 Bacteria 7162724
327 2551718050 2551306090 Bacteria 7953713
328 2551724731 2551306091 Bacteria 7086830
329 2551742280 2551306093 Bacteria 7064773
330 2585226941 2582581298 Bacteria 7315509
331 2585254620 2582581304 Bacteria 5831370
332 2585526627 2585427526 Bacteria 7258840
333 2585537760 2585427528 Bacteria 6842387
334 2585550356 2585427529 Bacteria 7395659
335 2585835710 2585427593 Bacteria 7141551
336 2585847575 2585427594 Bacteria 6180594
337 2644007615 2643221599 Bacteria 6292121
338 2719387985 2718217927 Bacteria 6972593
339 2719667604 2718217997 Bacteria 6740740
340 2720494024 2718218199 Bacteria 6740745
341 2720615487 2718218232 Bacteria 6720332
342 2720622270 2718218233 Bacteria 6662049
343 2720633624 2718218235 Bacteria 6630699
344 2720777324 2718218269 Bacteria 6906114
345 2721401618 2718218423 Bacteria 6438183
346 2723028922 2721755556 Bacteria 6745503
347 2723562538 2721755684 Bacteria 6859907
348 2723569231 2721755685 Bacteria 6704835
349 2724040432 2721755809 Bacteria 6438790
350 2724091931 2721755819 Bacteria 6906405
351 2724106496 2721755822 Bacteria 6726041
352 2724112303 2721755823 Bacteria 6752556
353 2730109858 2728369352 Bacteria 6745171
354 2738803219 2738541293 Bacteria 7065685
355 2739032417 2738541333 Bacteria 7106503
356 2792746285 2791355123 Bacteria 8049106
357 2793314448 2791355259 Bacteria 7254731
358 2793319494 2791355260 Bacteria 6598818
359 2793328104 2791355261 Bacteria 6661293
360 2793344377 2791355263 Bacteria 6872478
361 2793369095 2791355267 Bacteria 7222458
362 2802718240 2802428858 Bacteria 6636079
363 2802725966 2802428859 Bacteria 6667919
364 2802731323 2802428860 Bacteria 6525526
365 2802736484 2802428861 Bacteria 6534206
366 2802744458 2802428862 Bacteria 6633353
367 2802749953 2802428863 Bacteria 6410669
368 2806043392 2802429633 Bacteria 7341974
369 2806050674 2802429634 Bacteria 7083200
370 2806057491 2802429635 Bacteria 7650140
371 2806064873 2802429636 Bacteria 7597525
372 2806072139 2802429637 Bacteria 7067217
373 2838020832 2838016132 Bacteria 6577831
374 2838048528 2838042994 Bacteria 6046894
375 2838053024 2838048938 Bacteria 6044578
376 2838064817 2838061910 Bacteria 6794874
377 2838070408 2838068647 Bacteria 6208656
378 2838690687 2838686498 Bacteria 7807632
379 2838735868 2838729681 Bacteria 7400765
380 2838748772 2838742623 Bacteria 7396178
381 2841855608 2841851746 Bacteria 7532261
382 2842160688 2842156927 Bacteria 6894975
383 2842164205 2842163707 Bacteria 6916235
384 2842184304 2842180545 Bacteria 6888678
385 2842231886 2842229732 Bacteria 7475766
386 2842249574 2842243621 Bacteria 7421798
387 2842263682 2842257432 Bacteria 7401195
388 2842267037 2842264693 Bacteria 6472963
389 2842274999 2842271015 Bacteria 7807131
390 2842397954 2842395702 Bacteria 6780583
391 2842424022 2842422224 Bacteria 6239196
392 2842431267 2842428310 Bacteria 6767288
393 2842437602 2842434925 Bacteria 6502746
394 2842444417 2842441272 Bacteria 6769273
395 2842451157 2842447887 Bacteria 6754142
396 2842465410 2842462802 Bacteria 6588055
397 2842472121 2842469257 Bacteria 6752936
398 2844460342 2844454524 Bacteria 7952546
399 2855831081 2855825444 Bacteria 6785811
400 2915985428 2915980308 Bacteria 6624279
401 2915994123 2915993759 Bacteria 7016183
402 2916005290 2916000859 Bacteria 6865702
403 2916008102 2916007675 Bacteria 6898660
404 2916020011 2916014648 Bacteria 6946486
405 2916025822 2916021584 Bacteria 6854472
406 2916030810 2916028427 Bacteria 6748433
407 2916035778 2916035215 Bacteria 6755766
408 2916042604 2916041962 Bacteria 6820487
409 2916057909 2916055098 Bacteria 6758838
410 2916067872 2916061851 Bacteria 6737736
411 2916073807 2916068649 Bacteria 6943657
412 2916082457 2916076590 Bacteria 6596108
413 2919107517 2919100787 Bacteria 7710546
414 2921202659 2921201388 Bacteria 6926299
415 2921212642 2921208531 Bacteria 6745326
416 2921243999 2921237296 Bacteria 6876710
417 2921249106 2921244191 Bacteria 6568419
418 2921251450 2921250672 Bacteria 6677771
419 2921261679 2921257292 Bacteria 6808382
420 2921266680 2921263974 Bacteria 6864552
421 2921284169 2921282425 Bacteria 6826397
422 2921294347 2921289301 Bacteria 7316391
423 2924149059 2924144063 Bacteria 6883928
424 2924156234 2924150972 Bacteria 7169444
425 2924163113 2924158325 Bacteria 7188855
426 2924166137 2924165586 Bacteria 7260590
427 2924174867 2924172951 Bacteria 6749356
428 2924184673 2924179722 Bacteria 6843264
429 2924191052 2924186466 Bacteria 6876637
430 2924198322 2924193448 Bacteria 6955718
431 2924204860 2924200457 Bacteria 6757188
432 2924212421 2924207177 Bacteria 6917007
433 2924221066 2924214083 Bacteria 7080103
434 2924222088 2924221636 Bacteria 7113495
435 2924230152 2924228884 Bacteria 6633132
436 2933601212 2933599457 Bacteria 5858799
437 2935903306 2935901341 Bacteria 7341747
438 2936387742 2936381700 Bacteria 7006523
439 2937008024 2937002841 Bacteria 6934057
440 2937011867 2937009748 Bacteria 6746052
441 2937020982 2937016420 Bacteria 6782579
442 2937027618 2937023124 Bacteria 6815156
443 2937034403 2937029754 Bacteria 6424026
444 2937038966 2937036028 Bacteria 6846469
445 2937045078 2937042894 Bacteria 6741576
446 2937051412 2937049772 Bacteria 6757901
447 2937056971 2937056579 Bacteria 7107896
448 2937069475 2937063883 Bacteria 7199456
449 2937075274 2937071275 Bacteria 6984483
450 2937084893 2937078374 Bacteria 6610289
451 2937090654 2937084907 Bacteria 6618516
452 2937092142 2937091812 Bacteria 6979387
453 2937104364 2937098957 Bacteria 7249374
454 2937113364 2937106411 Bacteria 6947143
455 2937122195 2937119839 Bacteria 6597547
456 2937128055 2937126314 Bacteria 6771275
457 2957376146 2957375807 Bacteria 6425588
458 2957388058 2957382221 Bacteria 6737050
459 2957392844 2957388812 Bacteria 6778072
460 2957399898 2957395598 Bacteria 6822399
461 2957408087 2957402308 Bacteria 6741770
462 2957413086 2957408893 Bacteria 6558585
463 2957421438 2957415311 Bacteria 6991633
464 2957425532 2957422303 Bacteria 7172205
465 2957435100 2957430029 Bacteria 7022557
466 2957442205 2957437181 Bacteria 6568994
467 2957455674 2957450854 Bacteria 6765715
468 2957469970 2957464669 Bacteria 6568877
469 2957475578 2957471148 Bacteria 6797643
470 2957480420 2957478035 Bacteria 6756658
471 2957489298 2957484790 Bacteria 6703082
472 2957503614 2957498199 Bacteria 7126688
473 2957510406 2957505466 Bacteria 7253085
474 2960590964 2960584000 Bacteria 6864594
475 2960596064 2960591022 Bacteria 6622873
476 2960610771 2960603979 Bacteria 6898737
477 2960614024 2960610863 Bacteria 6691244
478 2960630717 2960624210 Bacteria 6875384
479 2960635998 2960631154 Bacteria 6732508
480 2960638447 2960637947 Bacteria 7296468
481 2960650471 2960645483 Bacteria 7211087
482 2960657681 2960652885 Bacteria 7083688
483 2960670303 2960667422 Bacteria 6763020
484 2960685971 2960680706 Bacteria 6624464
485 2960692846 2960687367 Bacteria 6535474
486 2960693954 2960693952 Bacteria 6749742
487 2964608317 2964607997 Bacteria 7101408
488 2964621025 2964615318 Bacteria 6809089
489 2964626922 2964621998 Bacteria 6834995
490 2964629361 2964628898 Bacteria 7083044
491 2964643154 2964636051 Bacteria 7091832
492 2964650458 2964649959 Bacteria 6675118
493 2964661291 2964656573 Bacteria 7100150
494 2964668897 2964663802 Bacteria 7019362
495 2964674886 2964670856 Bacteria 6851364
496 2964682980 2964678106 Bacteria 6792020
497 2964690062 2964685014 Bacteria 6839111
498 2964696115 2964691889 Bacteria 6802758
499 2964708385 2964705432 Bacteria 7114648
500 2964724580 2964719344 Bacteria 7286602
501 2967668034 2967664464 Bacteria 6948836
502 2967677181 2967671571 Bacteria 7021409
503 2967685192 2967678726 Bacteria 7264382
504 2967689870 2967686174 Bacteria 6678622
505 2967696749 2967693043 Bacteria 6804451
506 2967706540 2967699805 Bacteria 6854538
507 2967707274 2967706974 Bacteria 7186053
508 2967716124 2967714385 Bacteria 7000047
509 2967726599 2967721400 Bacteria 7073753
510 2967733278 2967728569 Bacteria 6641507
511 2967745914 2967742019 Bacteria 6794534
512 2967753680 2967748971 Bacteria 6733771
513 2967761572 2967755722 Bacteria 6814706
514 2967767136 2967762386 Bacteria 6923502
515 2967774823 2967769361 Bacteria 6587838
516 2967777346 2967775926 Bacteria 6738189
517 2970024856 2970019648 Bacteria 7072033
518 2970033205 2970026789 Bacteria 6785236
519 2970040104 2970033650 Bacteria 7118744
520 2970042758 2970040964 Bacteria 6731123
521 2970053062 2970047711 Bacteria 7088379
522 2970059503 2970054988 Bacteria 6611507
523 2970068580 2970061556 Bacteria 7099761
524 2970071526 2970068827 Bacteria 7123112
525 2970089135 2970088815 Bacteria 6933825
526 2970102627 2970095765 Bacteria 6936963
527 2970108231 2970102677 Bacteria 6812532
528 2970114407 2970109326 Bacteria 6863976
529 2970118287 2970116247 Bacteria 6501857
530 2970127895 2970122695 Bacteria 6625855
531 2970132951 2970129317 Bacteria 6806560
532 2970141431 2970136068 Bacteria 7207982
533 2970145666 2970143518 Bacteria 6446480
534 2970154726 2970149975 Bacteria 6779706
535 2970161546 2970156795 Bacteria 7168044
536 2970169180 2970164137 Bacteria 6861252
537 2970176947 2970170962 Bacteria 6876229
538 2970184254 2970177841 Bacteria 6768001
539 2970190262 2970184632 Bacteria 7054431
540 2970196698 2970191845 Bacteria 7032787
541 2977519253 2977516862 Bacteria 6940108
542 2977524471 2977523885 Bacteria 6960446
543 2977536667 2977530762 Bacteria 6951399
544 2977543962 2977537788 Bacteria 6929320
545 2977550508 2977544691 Bacteria 6875412
546 2977556988 2977551784 Bacteria 7125765
547 2977559325 2977558990 Bacteria 6863948
548 2977569304 2977565890 Bacteria 6901543
549 2977577892 2977572785 Bacteria 6763888
550 2977582484 2977579622 Bacteria 6772100
551 2996893318 2996893221 Bacteria 5823108
552 2998346117 2998344455 Bacteria 4222996
553 3005409242 3005409236 Bacteria 7188837
554 3005453125 3005452660 Bacteria 5889319
555 648740613 648276728 Bacteria 6968865
556 8003997866 8003992118 Bacteria 7266902
557 8004005107 8003999396 Bacteria 7063185
558 8005278185 8005275841 Bacteria 6929066
559 8005282786 8005282627 Bacteria 6675747
560 8005308075 8005307578 Bacteria 7395396
561 8005385678 8005382845 Bacteria 6732062
562 8005401347 8005395548 Bacteria 6806915
563 8005432365 8005430974 Bacteria 6689030
564 8005497996 8005497431 Bacteria 6477605
565 8005574473 8005570704 Bacteria 6957481
566 8005619211 8005619151 Bacteria 7030230
567 8005627773 8005626139 Bacteria 6534237
568 8005669403 8005668836 Bacteria 6953162
569 8005701581 8005695170 Bacteria 6912330
570 8018176725 8018176218 Bacteria 6896178
571 8023681768 8023680758 Bacteria 7729763
572 8056381299 8056375014 Bacteria 7006639
573 Ga0307405_10027749
574 JGI24744J21845_10002512
575 JGI25158J39367_1001294
576 JGI25152J39213_1005620
577 JGI25150J39212_1000334
578 JGI25151J46595_10000027
579 JGI25151J46595_10000282
580 JGI25153J46596_10000734
581 JGI25153J46596_10004033
582 JGI25153J46596_10011982
583 rootH2_10004419
584 rootH2_10116546
585 rootH1_10024310
586 rootH1_10349092
587 JGI25160J50197_1003201
588 JGI25160J50197_1006027
589 JGI25161J50226_1000010
590 Ga0055526_1002049
591 Ga0055524_1008111
592 Ga0055524_1021078
593 Ga0055528_1000214
594 Ga0055528_1003057
595 Ga0055528_1004954
596 Ga0055528_1011827
597 Ga0055540_1000198
598 Ga0055540_1005930
599 Ga0055531_10000061
600 Ga0055543_1000064
601 Ga0055543_1000843
602 Ga0065165_1011377
603 Ga0068868_100010304
604 Ga0068868_100052719
605 Ga0068868_100186924
606 Ga0070660_100025389
607 Ga0070689_100197320
608 Ga0070671_100008343
609 Ga0070671_100077206
610 Ga0070673_100004463
611 Ga0070673_100008068
612 Ga0070688_100138905
613 Ga0070659_100087862
614 Ga0070659_100159138
615 Ga0070705_100014803
616 Ga0070678_100113083
617 Ga0070662_100000043
618 Ga0068867_100002700
619 Ga0070706_100031979
620 Ga0070707_100119239
621 Ga0070699_100040328
622 Ga0068853_100002294
623 Ga0070672_100123467
624 Ga0070695_100094402
625 Ga0070696_100010446
626 Ga0070665_100000017
627 Ga0068855_100000387
628 Ga0068855_100087892
629 Ga0068856_100000650
630 Ga0068852_100000477
631 Ga0068866_10033673
632 Ga0068861_100046813
633 Ga0068862_100019774
634 Ga0075365_10005504
635 Ga0075365_10013904
636 Ga0075363_100007133
637 Ga0070716_100016381
638 Ga0070712_100006290
639 Ga0075362_10000772
640 Ga0075367_10000263
641 Ga0075369_10004968
642 Ga0075366_10000964
643 Ga0097621_100000354
644 Ga0097621_100001356
645 Ga0097621_100017926
646 Ga0075370_10005498
647 Ga0068871_100008689
648 Ga0068871_100018423
649 Ga0068871_100036582
650 Ga0075428_100040373
651 Ga0075430_100017957
652 Ga0075433_10136526
653 Ga0075434_100031136
654 Ga0075429_100018297
655 Ga0075429_100022667
656 Ga0068865_100137750
657 Ga0079104_1012272
658 Ga0075435_100062449
659 Ga0105240_10050876
660 Ga0105240_10066818
661 Ga0111539_10012770
662 Ga0111539_10026707
663 Ga0111539_10290209
664 Ga0105245_10000555
665 Ga0105245_10108840
666 Ga0105245_10119310
667 Ga0114129_10000600
668 Ga0105243_10047511
669 Ga0105242_10017865
670 Ga0105242_10078072
671 Ga0105248_10085107
672 Ga0105237_10001687
673 Ga0105237_10001937
674 Ga0123341_1000011
675 Ga0123342_1019934
676 Ga0105239_10080658
677 Ga0105239_10208908
678 Ga0105246_10034323
679 Ga0105246_10138012
680 Ga0157371_10016277
681 Ga0157374_10000907
682 Ga0157374_10019122
683 Ga0157378_10000697
684 Ga0157378_10018521
685 Ga0163162_10000051
686 Ga0157372_10019492
687 Ga0157375_10094883
688 Ga0157376_10029372
689 Ga0163161_10029608
690 Ga0213872_10041411
691 Ga0228711_1001405
692 Ga0228711_1011881
693 Ga0228710_1027306
694 Ga0209436_100037
695 Ga0207425_1000043
696 Ga0207425_1005273
697 Ga0207425_1020127
698 Ga0209129_1000072
699 Ga0209129_1000167
700 Ga0209129_1004525
701 Ga0209673_1000020
702 Ga0209673_1000182
703 Ga0209673_1000325
704 Ga0209673_1001367
705 Ga0209673_1001800
706 Ga0209673_1021122
707 Ga0209673_1029834
708 Ga0209130_1000001
709 Ga0209676_1034936
710 Ga0209025_1000120
711 Ga0209025_1000483
712 Ga0209025_1003635
713 Ga0209564_1000560
714 Ga0209564_1000703
715 Ga0209564_1001374
716 Ga0209564_1013821
717 Ga0209564_1034918
718 Ga0209758_1000111
719 Ga0209758_1000544
720 Ga0209758_1011173
721 Ga0209758_1026183
722 Ga0209256_1000245
723 Ga0209256_1001446
724 Ga0209256_1001750
725 Ga0209256_1005073
726 Ga0209256_1023227
727 Ga0207426_1000039
728 Ga0207426_1000045
729 Ga0209051_1000195
730 Ga0209051_1006741
731 Ga0209051_1011998
732 Ga0209257_1000006
733 Ga0209257_1006575
734 Ga0207642_10029505
735 Ga0207680_10016051
736 Ga0207647_10000036
737 Ga0207645_10000312
738 Ga0207684_10055566
739 Ga0207695_10018287
740 Ga0207695_10036841
741 Ga0207671_10000514
742 Ga0207693_10023040
743 Ga0207646_10038163
744 Ga0207644_10004416
745 Ga0207644_10050384
746 Ga0207690_10066690
747 Ga0207706_10000125
748 Ga0207686_10039383
749 Ga0207704_10000043
750 Ga0207665_10039917
751 Ga0207691_10143413
752 Ga0207711_10080306
753 Ga0207667_10071830
754 Ga0207651_10004451
755 Ga0207677_10005173
756 Ga0207677_10035317
757 Ga0207639_10005247
758 Ga0207702_10000689
759 Ga0207641_10020148
760 Ga0207648_10000961
761 Ga0207675_100020701
762 Ga0207683_10025462
763 Ga0207698_10004826
764 Ga0209281_1003171
765 Ga0209281_1004737
766 Ga0209282_1000049
767 Ga0207428_10023983
768 Ga0268266_10000037
769 Ga0268266_10032936
770 Ga0307408_100060660
771 Ga0307407_10006334
772 Ga0307412_10002666
773 Ga0315914_1000005
774 Ga0316583_10013144
775 Ga0307510_10000149
776 Ga0307510_10001456
777 Ga0315913_1012649
778 Ga0315915_1000004
779 Ga0373955_0029174
780 Ga0373925_0101004
781 Ga0395899_0000999
782 Ga0395905_0002075
783 Ga0395905_0003901
784 Ga0395901_0012223
785 Ga0436361_0994938
786 Ga0439465_0009791
787 Ga0439465_0013216
788 Ga0451851_0288635
789 Ga0451853_1525072
790 Ga0451577_0016002
791 Ga0466972_0002022
792 Ga0453684_0038138
793 Ga0451576_0013028
794 Ga0451576_0029640
795 Ga0495629_0047356
796 Ga0495638_0000210
797 Ga0495638_0024736
798 Ga0495638_0044200
799 Ga0495638_0056425
800 Ga0495651_0061428
801 Ga0495605_0033666
802 Ga0495610_0030131
803 Ga0495631_0002991
804 Ga0495631_0003351
805 Ga0495631_0057870
806 Ga0495632_0008797
807 Ga0495632_0028484
808 Ga0495643_0002993
809 Ga0495643_0012541
810 Ga0495597_0006661
811 Ga0495625_0045523
812 Ga0495670_0014985
813 Ga0495649_0004550
814 Ga0495660_0004225
815 Ga0495672_0058802
816 Ga0495687_048135
817 Ga0495675_0117706
818 Ga0495685_022803
819 Ga0495686_0099217
820 Ga0496101_0043144
821 Ga0496106_0000265
822 Ga0496106_0140442
823 Ga0496107_0152596
824 Ga0496109_0232909
825 Ga0496112_0003215
826 Ga0496116_0000760
827 Ga0496116_0005937
828 Ga0496116_0047332
829 Ga0496117_0010370
830 Ga0496117_0022083
831 Ga0496117_0054186
832 Ga0496118_0012557
833 Ga0496118_0063494
834 Ga0496121_0003686
835 Ga0496121_0030814
836 Ga0496121_0041890
837 Ga0496121_0071833
838 Ga0496122_0002982
839 Ga0496122_0005657
840 Ga0496122_0028391
841 Ga0496123_0009916
842 Ga0496123_0010214
843 Ga0496124_0000552
844 Ga0496124_0002958
845 Ga0496124_0040098
846 Ga0496125_0002002
847 Ga0496125_0052875
848 Ga0495678_023118
849 Ga0501076_0102834
850 nmdc:mga03683_5756_c1
851 nmdc:mga03n38_57886_c1
852 nmdc:mga0yw44_6775_c1
853 nmdc:mga0k408_2744_c1
854 nmdc:mga0k408_38516_c1
855 nmdc:mga06z11_3125_c2
856 nmdc:mga07m45_85143_c1
857 nmdc:mga05p37_11_c1
858 nmdc:mga05p37_939_c1
859 nmdc:mga09592_104771_c1
860 nmdc:mga06r32_51734_c1
861 nmdc:mga08y16_10870_c1
862 nmdc:mga08y16_6417_c1
863 nmdc:mga0n895_29178_c1
864 nmdc:mga0rr50_49768_c1
865 nmdc:mga0a205_109010_c1
866 nmdc:mga0a205_99222_c1
867 nmdc:mga0sz30_4803_c1
868 nmdc:mga0sz30_7421_c1
869 Ga0495601_0018332
870 Ga0495601_0033596
871 Ga0500610_0006335
872 Ga0500557_000241
873 Ga0500658_0000416
874 Ga0500568_0000673
875 Ga0500588_0032218
876 Ga0500604_0005991
877 Ga0500616_0039730
878 Ga0500622_0000450
879 Ga0501082_0226447
880 2509447677
881 2510305617
882 2511193965
883 2512974919
884 2513579801
885 2513586458
886 2513603746
887 2513620133
888 2513986456
889 2514004297
890 2515738256
891 2516896992
892 2517080299
893 2517567566
894 2551676040
895 2551678192
896 2551688952
897 2551700382
898 2551708465
899 2551718050
900 2551724731
901 2551742280
902 2585226941
903 2585254620
904 2585526627
905 2585537760
906 2585550356
907 2585835710
908 2585847575
909 2644007615
910 2719387985
911 2719667604
912 2720494024
913 2720615487
914 2720622270
915 2720633624
916 2720777324
917 2721401618
918 2723028922
919 2723562538
920 2723569231
921 2724040432
922 2724091931
923 2724106496
924 2724112303
925 2730109858
926 2738803219
927 2739032417
928 2792746285
929 2793314448
930 2793319494
931 2793328104
932 2793344377
933 2793369095
934 2802718240
935 2802725966
936 2802731323
937 2802736484
938 2802744458
939 2802749953
940 2806043392
941 2806050674
942 2806057491
943 2806064873
944 2806072139
945 2838020832
946 2838048528
947 2838053024
948 2838064817
949 2838070408
950 2838690687
951 2838735868
952 2838748772
953 2841855608
954 2842160688
955 2842164205
956 2842184304
957 2842231886
958 2842249574
959 2842263682
960 2842267037
961 2842274999
962 2842397954
963 2842424022
964 2842431267
965 2842437602
966 2842444417
967 2842451157
968 2842465410
969 2842472121
970 2844460342
971 2855831081
972 2915985428
973 2915994123
974 2916005290
975 2916008102
976 2916020011
977 2916025822
978 2916030810
979 2916035778
980 2916042604
981 2916057909
982 2916067872
983 2916073807
984 2916082457
985 2919107517
986 2921202659
987 2921212642
988 2921243999
989 2921249106
990 2921251450
991 2921261679
992 2921266680
993 2921284169
994 2921294347
995 2924149059
996 2924156234
997 2924163113
998 2924166137
999 2924174867
1000 2924184673
1001 2924191052
1002 2924198322
1003 2924204860
1004 2924212421
1005 2924221066
1006 2924222088
1007 2924230152
1008 2933601212
1009 2935903306
1010 2936387742
1011 2937008024
1012 2937011867
1013 2937020982
1014 2937027618
1015 2937034403
1016 2937038966
1017 2937045078
1018 2937051412
1019 2937056971
1020 2937069475
1021 2937075274
1022 2937084893
1023 2937090654
1024 2937092142
1025 2937104364
1026 2937113364
1027 2937122195
1028 2937128055
1029 2957376146
1030 2957388058
1031 2957392844
1032 2957399898
1033 2957408087
1034 2957413086
1035 2957421438
1036 2957425532
1037 2957435100
1038 2957442205
1039 2957455674
1040 2957469970
1041 2957475578
1042 2957480420
1043 2957489298
1044 2957503614
1045 2957510406
1046 2960590964
1047 2960596064
1048 2960610771
1049 2960614024
1050 2960630717
1051 2960635998
1052 2960638447
1053 2960650471
1054 2960657681
1055 2960670303
1056 2960685971
1057 2960692846
1058 2960693954
1059 2964608317
1060 2964621025
1061 2964626922
1062 2964629361
1063 2964643154
1064 2964650458
1065 2964661291
1066 2964668897
1067 2964674886
1068 2964682980
1069 2964690062
1070 2964696115
1071 2964708385
1072 2964724580
1073 2967668034
1074 2967677181
1075 2967685192
1076 2967689870
1077 2967696749
1078 2967706540
1079 2967707274
1080 2967716124
1081 2967726599
1082 2967733278
1083 2967745914
1084 2967753680
1085 2967761572
1086 2967767136
1087 2967774823
1088 2967777346
1089 2970024856
1090 2970033205
1091 2970040104
1092 2970042758
1093 2970053062
1094 2970059503
1095 2970068580
1096 2970071526
1097 2970089135
1098 2970102627
1099 2970108231
1100 2970114407
1101 2970118287
1102 2970127895
1103 2970132951
1104 2970141431
1105 2970145666
1106 2970154726
1107 2970161546
1108 2970169180
1109 2970176947
1110 2970184254
1111 2970190262
1112 2970196698
1113 2977519253
1114 2977524471
1115 2977536667
1116 2977543962
1117 2977550508
1118 2977556988
1119 2977559325
1120 2977569304
1121 2977577892
1122 2977582484
1123 2996893318
1124 2998346117
1125 3005409242
1126 3005453125
1127 648740613
1128 8003997866
1129 8004005107
1130 8005278185
1131 8005282786
1132 8005308075
1133 8005385678
1134 8005401347
1135 8005432365
1136 8005497996
1137 8005574473
1138 8005619211
1139 8005627773
1140 8005669403
1141 8005701581
1142 8018176725
1143 8023681768
1144 8056381299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

64

478

0.89

PF00324

AA_permease

Amino acid permease

69

483

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.9471 8 429
3ob6-assembly1.cif.gz_B structure of adic(n101a) in the open-to-out arg+ bound conformation 0.9397 6 435
3ob6-assembly1.cif.gz_A structure of adic(n101a) in the open-to-out arg+ bound conformation 0.9343 6 435
3ncy-assembly1.cif.gz_A x-ray crystal structure of an arginine agmatine antiporter (adic) in complex with a fab fragment 0.9195 10 428
3ncy-assembly1.cif.gz_B x-ray crystal structure of an arginine agmatine antiporter (adic) in complex with a fab fragment 0.9182 10 428
ID Description Score Start End Superfamily
af_P60061_6_436_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9563 8 428 1.20.1740.10
af_P0AAF1_3_436_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9459 4 432 1.20.1740.10
af_P0AAE8_2_443_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9291 5 439 1.20.1740.10
af_P0AAF1_3_436_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9291 4 432 1.20.1740.10
af_P60061_6_436_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9241 8 428 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7Y2K8H6-F1-model_v4 Amino acid permease 0.9751 64 440 GO:0005886
GO:0022857
AF-A0A7Y0L1M1-F1-model_v4 deleted 0.9745 5 438
AF-C1DBM6-F1-model_v4 Arginine/agmatine antiporter 0.974 3 343 GO:0005886
GO:0022857
AF-A0A7Y2K8H6-F1-model_v4 Amino acid permease 0.97 64 440 GO:0005886
GO:0022857
AF-A0A2P8GQ46-F1-model_v4 Amino acid/polyamine/organocation transporter (APC superfamily) 0.9696 1 438 GO:0005886
GO:0022857

Map