F465098

General Info

Members Datasets Scaffolds Average Seq Length
572 300 572 232

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0263983|Ga0436363_0263983_451_1281
Length 276
Sequence LPGSPRVSFIIPVYNEERTVGAVIERVRALPFDKQLVVVDDGSSDGTPAALAALAGDDLVALRQVNRGKGAAIRAAIPHLDGDVTVIQDADLEYDPAEVPSLIQPIVDGVADVVYGSRLIGGKPQRAYLFWHRVGNRLLSLVAGVLYNTTLTDMETGYKAFRADVLKSLDLRENGFSIEPEITAKVCKRHLRIYELPISYYGRTYAEGKKITWRDGFSALRVLFKIRLTPAARVSGVAQERPAGSVAGSDGATVALLPPRTKAIRREAKRQAAGGR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 11.89
Rhizosphere 87.24
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10395646 3300005327 Bacteria 1186
2 Ga0070676_10158162 3300005328 Bacteria 1456
3 Ga0070683_100000102 3300005329 Bacteria 55400
4 Ga0070683_100056637 3300005329 Bacteria 3640
5 Ga0070683_100166084 3300005329 Bacteria 2094
6 Ga0068869_100229252 3300005334 Bacteria 1475
7 Ga0070680_100079101 3300005336 Bacteria 2710
8 Ga0070682_100028092 3300005337 Bacteria 3381
9 Ga0070682_100456355 3300005337 Unclassified 980
10 Ga0068868_100045859 3300005338 Bacteria 3420
11 Ga0070660_100022699 3300005339 Bacteria 4645
12 Ga0070660_100025946 3300005339 Bacteria 4360
13 Ga0070689_100041320 3300005340 Bacteria 3540
14 Ga0070689_100183867 3300005340 Bacteria 1699
15 Ga0070691_10010478 3300005341 Bacteria 4231
16 Ga0070691_10036355 3300005341 Bacteria 2321
17 Ga0070687_100068130 3300005343 Bacteria 1902
18 Ga0070661_100219155 3300005344 Bacteria 1459
19 Ga0070692_10070294 3300005345 Bacteria 1863
20 Ga0070668_100017596 3300005347 Bacteria 5359
21 Ga0070668_100241972 3300005347 Bacteria 1495
22 Ga0070669_100494403 3300005353 Bacteria 1014
23 Ga0070671_100031777 3300005355 Bacteria 4364
24 Ga0070674_100032437 3300005356 Bacteria 3468
25 Ga0070673_100138724 3300005364 Bacteria 2049
26 Ga0070688_100002134 3300005365 Bacteria 9970
27 Ga0070659_100033906 3300005366 Bacteria 3969
28 Ga0070709_10009902 3300005434 Bacteria 5268
29 Ga0070709_10352334 3300005434 Bacteria 1088
30 Ga0070714_100004896 3300005435 Bacteria 10167
31 Ga0070714_100121607 3300005435 Bacteria 2323
32 Ga0070714_100163225 3300005435 Bacteria 2017
33 Ga0070713_100000372 3300005436 Bacteria 28704
34 Ga0070713_100106361 3300005436 Bacteria 2439
35 Ga0070713_100298997 3300005436 Bacteria 1481
36 Ga0070713_100314459 3300005436 Bacteria 1445
37 Ga0070713_100431606 3300005436 Bacteria 1235
38 Ga0070710_10018665 3300005437 Bacteria 3572
39 Ga0070701_10002635 3300005438 Bacteria 6955
40 Ga0070711_100020315 3300005439 Bacteria 4278
41 Ga0070711_100192704 3300005439 Bacteria 1568
42 Ga0070705_100007265 3300005440 Bacteria 5449
43 Ga0070700_100001464 3300005441 Bacteria 11741
44 Ga0070700_100024118 3300005441 Bacteria 3568
45 Ga0070700_100034190 3300005441 Bacteria 3068
46 Ga0070708_100050171 3300005445 Bacteria 3694
47 Ga0070708_100148724 3300005445 Bacteria 2177
48 Ga0070708_100517404 3300005445 Bacteria 1126
49 Ga0070663_100021691 3300005455 Bacteria 4277
50 Ga0070678_100003980 3300005456 Bacteria 8309
51 Ga0070662_100082204 3300005457 Bacteria 2402
52 Ga0070662_100154635 3300005457 Bacteria 1789
53 Ga0070681_10106059 3300005458 Bacteria 2752
54 Ga0070681_10262226 3300005458 Bacteria 1640
55 Ga0068867_100004544 3300005459 Bacteria 9755
56 Ga0070685_10017675 3300005466 Bacteria 3821
57 Ga0070706_100024233 3300005467 Bacteria 5585
58 Ga0070707_100002173 3300005468 Bacteria 18762
59 Ga0070707_100628145 3300005468 Bacteria 1037
60 Ga0070698_100078488 3300005471 Bacteria 3300
61 Ga0070679_100136309 3300005530 Bacteria 2435
62 Ga0070679_100171567 3300005530 Bacteria 2142
63 Ga0070679_100250837 3300005530 Bacteria 1726
64 Ga0070684_100000343 3300005535 Bacteria 32061
65 Ga0070684_100003310 3300005535 Bacteria 12072
66 Ga0070684_100117256 3300005535 Bacteria 2392
67 Ga0070684_100567177 3300005535 Bacteria 1054
68 Ga0068853_100018457 3300005539 Bacteria 5774
69 Ga0070672_100002647 3300005543 Bacteria 11435
70 Ga0070686_100004104 3300005544 Bacteria 8016
71 Ga0070695_100003524 3300005545 Bacteria 9137
72 Ga0070696_100104388 3300005546 Bacteria 2035
73 Ga0070665_100039518 3300005548 Bacteria 4744
74 Ga0070704_100017189 3300005549 Bacteria 4592
75 Ga0070704_100139053 3300005549 Bacteria 1893
76 Ga0068855_100052105 3300005563 Bacteria 4818
77 Ga0068855_100332579 3300005563 Bacteria 1677
78 Ga0068855_100355476 3300005563 Bacteria 1613
79 Ga0070664_100020201 3300005564 Bacteria 5484
80 Ga0070664_100230582 3300005564 Unclassified 1660
81 Ga0068857_100000539 3300005577 Bacteria 27448
82 Ga0068854_100626521 3300005578 Bacteria 921
83 Ga0068856_100000481 3300005614 Bacteria 44194
84 Ga0068856_100000869 3300005614 Bacteria 32365
85 Ga0068856_100049621 3300005614 Bacteria 4137
86 Ga0068856_100217444 3300005614 Bacteria 1926
87 Ga0068856_100572477 3300005614 Bacteria 1151
88 Ga0070702_100004297 3300005615 Bacteria 6492
89 Ga0068859_100058218 3300005617 Bacteria 3892
90 Ga0068866_10002247 3300005718 Bacteria 8005
91 Ga0068866_10146251 3300005718 Bacteria 1363
92 Ga0068861_100030270 3300005719 Bacteria 3965
93 Ga0068870_10128950 3300005840 Bacteria 1467
94 Ga0068860_100219166 3300005843 Bacteria 1847
95 Ga0068862_100694592 3300005844 Bacteria 985
96 Ga0081455_10187681 3300005937 Bacteria 1560
97 Ga0081455_10484823 3300005937 Bacteria 835
98 Ga0081539_10012953 3300005985 Bacteria 6341
99 Ga0081539_10022801 3300005985 Bacteria 4125
100 Ga0081539_10039804 3300005985 Bacteria 2768
101 Ga0070716_100109878 3300006173 Bacteria 1706
102 Ga0070712_100024368 3300006175 Bacteria 4009
103 Ga0070712_100033478 3300006175 Bacteria 3478
104 Ga0070712_100367098 3300006175 Unclassified 1182
105 Ga0097621_100003227 3300006237 Bacteria 11209
106 Ga0068871_100009924 3300006358 Bacteria 6914
107 Ga0068871_100199159 3300006358 Bacteria 1728
108 Ga0075428_100088776 3300006844 Bacteria 3372
109 Ga0075428_100235246 3300006844 Bacteria 1977
110 Ga0075428_100384344 3300006844 Bacteria 1505
111 Ga0075428_100534136 3300006844 Bacteria 1254
112 Ga0075431_100249448 3300006847 Bacteria 1804
113 Ga0075433_10113124 3300006852 Unclassified 2408
114 Ga0075433_10431940 3300006852 Bacteria 1161
115 Ga0068865_100003596 3300006881 Bacteria 9315
116 Ga0075436_100247037 3300006914 Bacteria 1270
117 Ga0097620_100058219 3300006931 Bacteria 3892
118 Ga0105240_10108268 3300009093 Bacteria 3367
119 Ga0105240_10237181 3300009093 Bacteria 2116
120 Ga0105240_10884825 3300009093 Bacteria 962
121 Ga0111539_10294854 3300009094 Bacteria 1887
122 Ga0111539_10321969 3300009094 Bacteria 1799
123 Ga0105245_10002706 3300009098 Bacteria 15955
124 Ga0105245_10013004 3300009098 Bacteria 7255
125 Ga0105245_10110304 3300009098 Bacteria 2558
126 Ga0105245_10409471 3300009098 Bacteria 1357
127 Ga0105247_10027554 3300009101 Bacteria 3435
128 Ga0114129_10001640 3300009147 Bacteria 30409
129 Ga0114129_10118114 3300009147 Bacteria 3653
130 Ga0114129_10962047 3300009147 Bacteria 1078
131 Ga0105243_10026764 3300009148 Bacteria 4416
132 Ga0105243_10854127 3300009148 Bacteria 902
133 Ga0105243_10862300 3300009148 Bacteria 898
134 Ga0105241_10066855 3300009174 Bacteria 2781
135 Ga0105242_10034141 3300009176 Bacteria 4078
136 Ga0105242_10197568 3300009176 Bacteria 1784
137 Ga0105242_10367142 3300009176 Bacteria 1334
138 Ga0105242_11096819 3300009176 Bacteria 810
139 Ga0105248_10023479 3300009177 Bacteria 6850
140 Ga0105237_10118894 3300009545 Bacteria 2636
141 Ga0105237_10178968 3300009545 Bacteria 2121
142 Ga0105238_10060339 3300009551 Bacteria 3797
143 Ga0105238_10128090 3300009551 Bacteria 2517
144 Ga0105249_10032429 3300009553 Bacteria 4726
145 Ga0105249_10325888 3300009553 Bacteria 1548
146 Ga0105249_10530253 3300009553 Bacteria 1226
147 Ga0105239_10014340 3300010375 Bacteria 8793
148 Ga0105246_10019434 3300011119 Bacteria 4341
149 Ga0105246_10495510 3300011119 Bacteria 1036
150 Ga0157371_10153699 3300013102 Bacteria 1642
151 Ga0157370_10001997 3300013104 Bacteria 25058
152 Ga0157370_10085237 3300013104 Bacteria 2968
153 Ga0157369_10003031 3300013105 Bacteria 20050
154 Ga0157369_10024504 3300013105 Bacteria 6711
155 Ga0157369_10529054 3300013105 Bacteria 1219
156 Ga0157374_10081816 3300013296 Bacteria 3065
157 Ga0157374_10104084 3300013296 Bacteria 2725
158 Ga0157374_10211230 3300013296 Bacteria 1903
159 Ga0157374_10825616 3300013296 Bacteria 943
160 Ga0157378_10015506 3300013297 Bacteria 6676
161 Ga0157378_10508139 3300013297 Bacteria 1205
162 Ga0163162_10004499 3300013306 Bacteria 13428
163 Ga0163162_10943460 3300013306 Bacteria 974
164 Ga0157372_10032864 3300013307 Bacteria 5693
165 Ga0157372_10187749 3300013307 Bacteria 2393
166 Ga0157372_10190952 3300013307 Bacteria 2373
167 Ga0157372_10605377 3300013307 Bacteria 1277
168 Ga0157372_10855802 3300013307 Bacteria 1055
169 Ga0157375_10003905 3300013308 Bacteria 12927
170 Ga0157375_10009361 3300013308 Bacteria 8598
171 Ga0157375_10017420 3300013308 Bacteria 6482
172 Ga0157375_10636534 3300013308 Bacteria 1223
173 Ga0163163_10276674 3300014325 Bacteria 1730
174 Ga0163163_10283913 3300014325 Bacteria 1707
175 Ga0163163_10460252 3300014325 Bacteria 1332
176 Ga0157380_10008025 3300014326 Bacteria 7522
177 Ga0157380_10033809 3300014326 Bacteria 3940
178 Ga0157380_10431362 3300014326 Bacteria 1260
179 Ga0157377_10014331 3300014745 Bacteria 4032
180 Ga0157377_10021940 3300014745 Bacteria 3365
181 Ga0157379_10296648 3300014968 Bacteria 1473
182 Ga0157379_10412375 3300014968 Bacteria 1243
183 Ga0157376_10005990 3300014969 Bacteria 8544
184 Ga0157376_10059597 3300014969 Bacteria 3201
185 Ga0206353_10324991 3300020082 Bacteria 3862
186 Ga0213871_10061320 3300021441 Bacteria 1048
187 Ga0207692_10008725 3300025898 Bacteria 4209
188 Ga0207692_10293429 3300025898 Bacteria 987
189 Ga0207642_10002169 3300025899 Bacteria 6084
190 Ga0207642_10237361 3300025899 Bacteria 1027
191 Ga0207710_10018665 3300025900 Bacteria 2952
192 Ga0207680_10011715 3300025903 Bacteria 4441
193 Ga0207685_10040989 3300025905 Bacteria 1730
194 Ga0207645_10214609 3300025907 Bacteria 1268
195 Ga0207643_10029657 3300025908 Bacteria 3044
196 Ga0207684_10143280 3300025910 Bacteria 2055
197 Ga0207654_10102059 3300025911 Bacteria 1769
198 Ga0207707_10008757 3300025912 Bacteria 8781
199 Ga0207707_10202976 3300025912 Bacteria 1728
200 Ga0207695_10381430 3300025913 Bacteria 1295
201 Ga0207671_10043189 3300025914 Bacteria 3333
202 Ga0207671_10247611 3300025914 Bacteria 1401
203 Ga0207693_10000312 3300025915 Bacteria 45237
204 Ga0207693_10028891 3300025915 Bacteria 4382
205 Ga0207693_10622946 3300025915 Bacteria 839
206 Ga0207663_10030427 3300025916 Bacteria 3185
207 Ga0207663_10253026 3300025916 Bacteria 1297
208 Ga0207660_10026729 3300025917 Bacteria 3932
209 Ga0207660_10033590 3300025917 Bacteria 3550
210 Ga0207660_10045516 3300025917 Bacteria 3091
211 Ga0207660_10117830 3300025917 Bacteria 2008
212 Ga0207662_10054602 3300025918 Bacteria 2383
213 Ga0207657_10019237 3300025919 Bacteria 6489
214 Ga0207657_10027058 3300025919 Bacteria 5258
215 Ga0207657_10037462 3300025919 Bacteria 4329
216 Ga0207652_10003706 3300025921 Bacteria 12544
217 Ga0207652_10059605 3300025921 Bacteria 3291
218 Ga0207652_10066594 3300025921 Bacteria 3122
219 Ga0207652_10551862 3300025921 Unclassified 1035
220 Ga0207646_10013625 3300025922 Bacteria 7765
221 Ga0207646_10167520 3300025922 Bacteria 1984
222 Ga0207646_10544432 3300025922 Bacteria 1044
223 Ga0207681_10093240 3300025923 Bacteria 2155
224 Ga0207694_10300094 3300025924 Bacteria 1322
225 Ga0207659_10158407 3300025926 Bacteria 1775
226 Ga0207687_10021127 3300025927 Bacteria 4322
227 Ga0207687_10062483 3300025927 Bacteria 2634
228 Ga0207687_10199711 3300025927 Bacteria 1562
229 Ga0207687_10277116 3300025927 Bacteria 1343
230 Ga0207700_10008619 3300025928 Bacteria 6330
231 Ga0207700_10217673 3300025928 Bacteria 1617
232 Ga0207700_10376703 3300025928 Bacteria 1240
233 Ga0207664_10135341 3300025929 Bacteria 2079
234 Ga0207664_10166862 3300025929 Bacteria 1882
235 Ga0207644_10168953 3300025931 Bacteria 1706
236 Ga0207690_10034370 3300025932 Bacteria 3266
237 Ga0207690_10200565 3300025932 Bacteria 1515
238 Ga0207706_10166978 3300025933 Bacteria 1934
239 Ga0207706_10232086 3300025933 Bacteria 1614
240 Ga0207686_10011305 3300025934 Bacteria 4884
241 Ga0207686_10317611 3300025934 Bacteria 1162
242 Ga0207709_10005693 3300025935 Bacteria 7038
243 Ga0207670_10378840 3300025936 Bacteria 1126
244 Ga0207669_10006579 3300025937 Bacteria 5324
245 Ga0207704_10010965 3300025938 Bacteria 4444
246 Ga0207704_10525911 3300025938 Bacteria 957
247 Ga0207665_10027047 3300025939 Bacteria 3789
248 Ga0207691_10002913 3300025940 Bacteria 16701
249 Ga0207711_10083649 3300025941 Bacteria 2792
250 Ga0207689_10492884 3300025942 Bacteria 1026
251 Ga0207661_10000061 3300025944 Bacteria 77364
252 Ga0207661_10000505 3300025944 Bacteria 25193
253 Ga0207661_10004887 3300025944 Bacteria 9392
254 Ga0207679_10178870 3300025945 Bacteria 1753
255 Ga0207667_10103060 3300025949 Bacteria 2943
256 Ga0207667_10178030 3300025949 Bacteria 2184
257 Ga0207667_10190083 3300025949 Bacteria 2107
258 Ga0207651_10240042 3300025960 Bacteria 1476
259 Ga0207712_10021204 3300025961 Bacteria 4263
260 Ga0207712_10458499 3300025961 Bacteria 1082
261 Ga0207668_10050215 3300025972 Bacteria 2873
262 Ga0207677_10023963 3300026023 Bacteria 3781
263 Ga0207677_10104088 3300026023 Bacteria 2097
264 Ga0207703_10045607 3300026035 Bacteria 3527
265 Ga0207703_10531255 3300026035 Bacteria 1107
266 Ga0207639_10013938 3300026041 Bacteria 5640
267 Ga0207678_10015938 3300026067 Bacteria 6601
268 Ga0207678_10053171 3300026067 Bacteria 3491
269 Ga0207678_10191060 3300026067 Bacteria 1750
270 Ga0207708_10000811 3300026075 Bacteria 23480
271 Ga0207708_10027208 3300026075 Bacteria 4329
272 Ga0207708_10046186 3300026075 Bacteria 3317
273 Ga0207708_10500107 3300026075 Bacteria 1019
274 Ga0207708_11005945 3300026075 Bacteria 724
275 Ga0207702_10009855 3300026078 Bacteria 8008
276 Ga0207702_10009994 3300026078 Bacteria 7954
277 Ga0207702_10073971 3300026078 Bacteria 2939
278 Ga0207648_10000214 3300026089 Bacteria 62323
279 Ga0207674_10000149 3300026116 Bacteria 82289
280 Ga0207675_100018153 3300026118 Bacteria 6559
281 Ga0207675_100020426 3300026118 Bacteria 6173
282 Ga0207683_10003027 3300026121 Bacteria 14682
283 Ga0207683_10008122 3300026121 Bacteria 8975
284 Ga0207698_10083579 3300026142 Bacteria 2584
285 Ga0207698_10485358 3300026142 Bacteria 1199
286 Ga0268266_10117293 3300028379 Bacteria 2365
287 Ga0268265_10085160 3300028380 Bacteria 2508
288 Ga0268265_10636038 3300028380 Bacteria 1024
289 Ga0268264_10079376 3300028381 Bacteria 2799
290 Ga0265319_1001263 3300028563 Bacteria 15386
291 Ga0265319_1046554 3300028563 Unclassified 1446
292 Ga0265334_10006301 3300028573 Bacteria 5123
293 Ga0265322_10005172 3300028654 Bacteria 3862
294 Ga0265330_10000410 3300031235 Bacteria 29517
295 Ga0265332_10016383 3300031238 Bacteria 3270
296 Ga0265320_10006802 3300031240 Bacteria 7170
297 Ga0265329_10001722 3300031242 Bacteria 10461
298 Ga0265331_10035729 3300031250 Bacteria 2443
299 Ga0265327_10005924 3300031251 Bacteria 9979
300 Ga0265327_10110695 3300031251 Bacteria 1313
301 Ga0307408_100199122 3300031548 Bacteria 1620
302 Ga0307408_100451014 3300031548 Bacteria 1116
303 Ga0265313_10004185 3300031595 Bacteria 11196
304 Ga0265314_10013117 3300031711 Bacteria 6713
305 Ga0307405_10015818 3300031731 Bacteria 4096
306 Ga0307410_10338584 3300031852 Bacteria 1198
307 Ga0307410_10635663 3300031852 Bacteria 894
308 Ga0307406_10189504 3300031901 Bacteria 1504
309 Ga0307407_10070018 3300031903 Bacteria 2084
310 Ga0307412_10031336 3300031911 Bacteria 3358
311 Ga0307409_100616376 3300031995 Bacteria 1074
312 Ga0307409_100668944 3300031995 Bacteria 1034
313 Ga0307416_100016773 3300032002 Bacteria 5103
314 Ga0307411_10008423 3300032005 Bacteria 5342
315 Ga0307415_100196864 3300032126 Bacteria 1595
316 Ga0307415_100582809 3300032126 Bacteria 992
317 Ga0373926_0033457 3300035083 Bacteria 1817
318 Ga0373936_0030485 3300035113 Bacteria 2127
319 Ga0373945_0026895 3300035116 Bacteria 2006
320 Ga0373943_0000814 3300035170 Bacteria 13690
321 Ga0373943_0026075 3300035170 Bacteria 2736
322 Ga0373946_0027258 3300035171 Bacteria 2259
323 Ga0373935_0029502 3300035692 Bacteria 3395
324 Ga0373933_0420350 3300035724 Bacteria 873
325 Ga0373947_0181182 3300035725 Bacteria 1371
326 Ga0373937_0735575 3300036401 Unclassified 934
327 Ga0373925_0016594 3300037068 Bacteria 5335
328 Ga0373925_0087923 3300037068 Bacteria 2372
329 Ga0373925_0123935 3300037068 Bacteria 2009
330 Ga0395899_0031127 3300037312 Bacteria 4011
331 Ga0395899_0052220 3300037312 Bacteria 3031
332 Ga0395899_0057368 3300037312 Bacteria 2875
333 Ga0395899_0124948 3300037312 Bacteria 1840
334 Ga0395899_0132670 3300037312 Bacteria 1777
335 Ga0395900_0002110 3300037418 Bacteria 22278
336 Ga0395900_0002210 3300037418 Bacteria 21742
337 Ga0395900_0025706 3300037418 Bacteria 6028
338 Ga0395900_0044339 3300037418 Bacteria 4583
339 Ga0395900_0062824 3300037418 Bacteria 3817
340 Ga0395900_0078922 3300037418 Bacteria 3382
341 Ga0395900_0136393 3300037418 Bacteria 2514
342 Ga0395900_0353981 3300037418 Bacteria 1441
343 Ga0395900_0385668 3300037418 Bacteria 1368
344 Ga0395900_0674040 3300037418 Bacteria 969
345 Ga0395898_0002238 3300037466 Bacteria 23529
346 Ga0395898_0004044 3300037466 Bacteria 16131
347 Ga0395898_0014865 3300037466 Bacteria 7990
348 Ga0395898_0036788 3300037466 Bacteria 4859
349 Ga0395898_0056293 3300037466 Bacteria 3833
350 Ga0395898_0058188 3300037466 Bacteria 3764
351 Ga0395898_0071250 3300037466 Bacteria 3359
352 Ga0395898_0103314 3300037466 Bacteria 2734
353 Ga0395898_0106911 3300037466 Bacteria 2683
354 Ga0395898_0205487 3300037466 Bacteria 1879
355 Ga0395898_0232570 3300037466 Bacteria 1758
356 Ga0395898_0241455 3300037466 Bacteria 1723
357 Ga0395898_0515439 3300037466 Bacteria 1137
358 Ga0395905_0005593 3300037471 Bacteria 12803
359 Ga0395905_0012371 3300037471 Bacteria 8215
360 Ga0395905_0012571 3300037471 Bacteria 8142
361 Ga0395905_0020067 3300037471 Bacteria 6333
362 Ga0395905_0070059 3300037471 Bacteria 3285
363 Ga0395905_0149660 3300037471 Bacteria 2196
364 Ga0395905_0155349 3300037471 Bacteria 2152
365 Ga0395905_0191422 3300037471 Bacteria 1919
366 Ga0395905_0381653 3300037471 Bacteria 1303
367 Ga0395905_0560122 3300037471 Bacteria 1044
368 Ga0436364_0616029 3300037853 Bacteria 1741
369 Ga0395901_0005034 3300038443 Bacteria 13340
370 Ga0395901_0007541 3300038443 Bacteria 10989
371 Ga0395901_0023726 3300038443 Bacteria 6290
372 Ga0395901_0025538 3300038443 Bacteria 6066
373 Ga0395901_0046606 3300038443 Bacteria 4503
374 Ga0395901_0065219 3300038443 Bacteria 3791
375 Ga0395901_0081986 3300038443 Bacteria 3369
376 Ga0395901_0213835 3300038443 Bacteria 2017
377 Ga0395901_0457497 3300038443 Bacteria 1304
378 Ga0395901_0835912 3300038443 Bacteria 907
379 Ga0436365_0131966 3300039437 Bacteria 1906
380 Ga0436365_0243590 3300039437 Bacteria 928
381 Ga0436360_1329465 3300039438 Bacteria 1284
382 Ga0436363_0263983 3300039450 Bacteria 2250
383 Ga0439466_0049302 3300041411 Bacteria 1383
384 Ga0439446_0028139 3300042156 Bacteria 1617
385 Ga0439434_0101020 3300042435 Bacteria 929
386 Ga0466972_0112699 3300044658 Unclassified 1285
387 Ga0466961_0014524 3300044693 Bacteria 5060
388 Ga0466963_0033573 3300044694 Bacteria 3333
389 Ga0466963_0048036 3300044694 Bacteria 2818
390 Ga0466963_0349567 3300044694 Bacteria 1041
391 Ga0466964_0000875 3300044706 Bacteria 9862
392 Ga0466964_0011091 3300044706 Bacteria 3404
393 Ga0466964_0111894 3300044706 Bacteria 1219
394 Ga0466964_0114443 3300044706 Bacteria 1207
395 Ga0466968_0001713 3300044735 Bacteria 7907
396 Ga0466957_0015334 3300044842 Bacteria 4478
397 Ga0466960_0012863 3300044901 Bacteria 3543
398 Ga0466959_0023648 3300045049 Bacteria 4548
399 Ga0466959_0207033 3300045049 Bacteria 1364
400 Ga0451576_0454306 3300045051 Bacteria 1345
401 Ga0466958_0055499 3300045836 Bacteria 2404
402 Ga0466967_0014199 3300045976 Bacteria 6193
403 Ga0466967_0025765 3300045976 Bacteria 4854
404 Ga0466967_0084067 3300045976 Bacteria 2879
405 Ga0466967_0169526 3300045976 Bacteria 2053
406 Ga0466967_0183577 3300045976 Bacteria 1974
407 Ga0466967_0594545 3300045976 Bacteria 1092
408 Ga0466967_1026905 3300045976 Bacteria 821
409 Ga0495603_0004117 3300046455 Bacteria 8663
410 Ga0495629_0442861 3300046459 Bacteria 880
411 Ga0495641_0014608 3300046461 Bacteria 4240
412 Ga0495641_0249803 3300046461 Bacteria 797
413 Ga0495651_0027567 3300046462 Bacteria 4425
414 Ga0495653_0206885 3300046463 Bacteria 1328
415 Ga0495582_0032696 3300046473 Bacteria 2859
416 Ga0495605_0104145 3300046474 Bacteria 1301
417 Ga0495639_0094856 3300046475 Bacteria 1403
418 Ga0495662_0058664 3300046476 Bacteria 1859
419 Ga0495596_0063826 3300046500 Bacteria 1433
420 Ga0495608_0006067 3300046511 Bacteria 8582
421 Ga0495608_0296138 3300046511 Bacteria 1002
422 Ga0495630_0061973 3300046517 Unclassified 2810
423 Ga0495630_0253347 3300046517 Bacteria 1345
424 Ga0495631_0077851 3300046518 Bacteria 1431
425 Ga0495644_0105816 3300046523 Bacteria 1066
426 Ga0495663_0007027 3300046525 Bacteria 3107
427 Ga0495665_0025053 3300046531 Bacteria 3206
428 Ga0495640_0036963 3300046533 Unclassified 3448
429 Ga0495586_0002968 3300046535 Bacteria 9142
430 Ga0495587_0308476 3300046536 Bacteria 884
431 Ga0495609_0055855 3300046538 Bacteria 1751
432 Ga0495622_0259060 3300046557 Bacteria 764
433 Ga0495667_0026672 3300046559 Bacteria 3893
434 Ga0495656_0058688 3300046615 Bacteria 1671
435 Ga0495659_0002949 3300046664 Bacteria 5464
436 Ga0495661_0191352 3300046665 Bacteria 1077
437 Ga0495588_0139492 3300046674 Unclassified 1280
438 Ga0495657_0030558 3300046675 Bacteria 3771
439 Ga0495658_0004265 3300046683 Bacteria 7036
440 Ga0495658_0011187 3300046683 Bacteria 4505
441 Ga0495658_0060531 3300046683 Bacteria 2172
442 Ga0495658_0378902 3300046683 Bacteria 901
443 Ga0495669_0144794 3300046684 Bacteria 1123
444 Ga0495613_0145237 3300046689 Bacteria 1693
445 Ga0495624_0145483 3300046690 Bacteria 1451
446 Ga0495670_0132658 3300046691 Bacteria 1299
447 Ga0495671_0087519 3300046692 Bacteria 1526
448 Ga0495589_0060047 3300046794 Bacteria 1868
449 Ga0495600_0030572 3300046809 Bacteria 3488
450 Ga0495600_0243752 3300046809 Bacteria 1145
451 Ga0495581_0009484 3300047315 Bacteria 5633
452 Ga0495581_0022991 3300047315 Bacteria 3611
453 Ga0495604_0055596 3300047317 Bacteria 3050
454 Ga0495636_0122315 3300047318 Bacteria 1152
455 Ga0495674_0068712 3300047319 Unclassified 3065
456 Ga0495674_0086551 3300047319 Bacteria 2683
457 Ga0495674_0244140 3300047319 Bacteria 1479
458 Ga0495674_0434654 3300047319 Bacteria 1056
459 Ga0495676_0021257 3300047321 Bacteria 5671
460 Ga0495680_0122013 3300047322 Bacteria 1923
461 Ga0495680_0282419 3300047322 Bacteria 1170
462 Ga0495675_0163811 3300047444 Bacteria 1368
463 Ga0495684_0614276 3300047471 Bacteria 732
464 Ga0495593_0149464 3300047673 Unclassified 1182
465 Ga0495602_0101939 3300048088 Bacteria 2353
466 Ga0496100_0065883 3300048903 Bacteria 2402
467 Ga0496100_0101946 3300048903 Bacteria 1979
468 Ga0496100_0102946 3300048903 Bacteria 1971
469 Ga0496100_0318920 3300048903 Bacteria 1167
470 Ga0496101_0032147 3300048904 Bacteria 3691
471 Ga0496101_0045916 3300048904 Bacteria 3131
472 Ga0496101_0067463 3300048904 Bacteria 2612
473 Ga0496101_0078937 3300048904 Bacteria 2429
474 Ga0496101_0251410 3300048904 Bacteria 1377
475 Ga0496102_0007349 3300048905 Bacteria 9410
476 Ga0496102_0011604 3300048905 Bacteria 7603
477 Ga0496102_0014734 3300048905 Bacteria 6797
478 Ga0496102_0067224 3300048905 Bacteria 3287
479 Ga0496102_0102019 3300048905 Bacteria 2667
480 Ga0496103_0008781 3300048906 Bacteria 5995
481 Ga0496103_0054418 3300048906 Bacteria 2480
482 Ga0496103_0107421 3300048906 Bacteria 1770
483 Ga0496103_0201480 3300048906 Bacteria 1280
484 Ga0496104_0020574 3300048907 Bacteria 6050
485 Ga0496104_0036555 3300048907 Bacteria 4592
486 Ga0496104_0042619 3300048907 Bacteria 4260
487 Ga0496104_0226077 3300048907 Bacteria 1783
488 Ga0496104_0247387 3300048907 Bacteria 1696
489 Ga0496104_0275142 3300048907 Bacteria 1596
490 Ga0496105_0268375 3300048908 Bacteria 1379
491 Ga0496106_0006374 3300048909 Bacteria 8735
492 Ga0496106_0632351 3300048909 Bacteria 856
493 Ga0496106_0662335 3300048909 Bacteria 834
494 Ga0496107_0040302 3300048910 Bacteria 3352
495 Ga0496107_0103211 3300048910 Bacteria 2092
496 Ga0496107_0121244 3300048910 Bacteria 1927
497 Ga0496108_0000999 3300048911 Bacteria 22085
498 Ga0496108_0002937 3300048911 Bacteria 13708
499 Ga0496108_0750189 3300048911 Bacteria 844
500 Ga0496109_0002225 3300048912 Bacteria 16101
501 Ga0496109_0003779 3300048912 Bacteria 12640
502 Ga0496109_0012663 3300048912 Bacteria 7286
503 Ga0496109_0162960 3300048912 Bacteria 2089
504 Ga0496109_0201979 3300048912 Bacteria 1869
505 Ga0496110_0010416 3300048913 Bacteria 7559
506 Ga0496110_0041585 3300048913 Bacteria 4011
507 Ga0496110_0099938 3300048913 Bacteria 2600
508 Ga0496110_0342674 3300048913 Bacteria 1361
509 Ga0496110_0346829 3300048913 Bacteria 1353
510 Ga0496111_0009333 3300048914 Bacteria 6541
511 Ga0496111_0022832 3300048914 Bacteria 4384
512 Ga0496111_0030725 3300048914 Bacteria 3821
513 Ga0496111_0067215 3300048914 Bacteria 2604
514 Ga0496111_0312689 3300048914 Bacteria 1164
515 Ga0496112_0005069 3300048915 Bacteria 11319
516 Ga0496112_0016674 3300048915 Bacteria 6888
517 Ga0496112_0032966 3300048915 Bacteria 5031
518 Ga0496112_0038875 3300048915 Bacteria 4648
519 Ga0496112_0089904 3300048915 Bacteria 3039
520 Ga0496112_0093485 3300048915 Bacteria 2977
521 Ga0496112_0130039 3300048915 Bacteria 2489
522 Ga0496112_0175296 3300048915 Bacteria 2109
523 Ga0496113_0087848 3300048916 Bacteria 2391
524 Ga0496113_0095693 3300048916 Bacteria 2295
525 Ga0496113_0121291 3300048916 Bacteria 2044
526 Ga0496114_0000264 3300048917 Bacteria 38127
527 Ga0496114_0005659 3300048917 Bacteria 9797
528 Ga0496114_0206432 3300048917 Bacteria 1722
529 Ga0496114_0245446 3300048917 Bacteria 1575
530 Ga0496115_0003038 3300048918 Bacteria 12054
531 Ga0496115_0007416 3300048918 Bacteria 8069
532 Ga0496115_0489616 3300048918 Bacteria 989
533 Ga0496115_0656011 3300048918 Bacteria 829
534 Ga0501036_0859240 3300049572 Bacteria 746
535 Ga0501042_0201784 3300049578 Bacteria 1434
536 Ga0501047_0161809 3300049581 Bacteria 2110
537 Ga0501067_0031012 3300049583 Bacteria 2966
538 Ga0501067_0275471 3300049583 Bacteria 937
539 Ga0501069_0012076 3300049585 Bacteria 4587
540 Ga0501070_0035888 3300049586 Bacteria 4140
541 Ga0501070_0238318 3300049586 Bacteria 1489
542 Ga0501070_0259660 3300049586 Bacteria 1420
543 Ga0501072_0476754 3300049588 Bacteria 987
544 Ga0501072_0750547 3300049588 Bacteria 766
545 Ga0501074_0131729 3300049590 Bacteria 1788
546 Ga0501199_008104 3300049650 Unclassified 1095
547 Ga0501079_0569649 3300049741 Bacteria 891
548 Ga0501080_0177577 3300049742 Bacteria 1961
549 Ga0501080_0225177 3300049742 Bacteria 1715
550 Ga0501080_0448994 3300049742 Bacteria 1156
551 Ga0501081_0566238 3300049743 Bacteria 849
552 Ga0501044_0104577 3300049823 Bacteria 2845
553 Ga0501045_0158991 3300049824 Bacteria 1682
554 nmdc:mga03683_173338_c1 3300050489 Bacteria 981
555 nmdc:mga05p37_218266_c1 3300050507 Bacteria 2302
556 nmdc:mga05p37_2465_c1 3300050507 Bacteria 21530
557 nmdc:mga05p37_33557_c1 3300050507 Bacteria 2292
558 nmdc:mga09592_302191_c1 3300050508 Bacteria 1387
559 nmdc:mga08y16_849082_c1 3300050511 Bacteria 902
560 nmdc:mga0n895_676522_c1 3300050512 Bacteria 1029
561 nmdc:mga0rr50_157181_c1 3300050513 Bacteria 1842
562 nmdc:mga0a205_142414_c1 3300050515 Bacteria 2297
563 Ga0495601_0025071 3300053077 Unclassified 3676
564 Ga0495601_0062192 3300053077 Bacteria 2371
565 Ga0495612_0077209 3300053078 Unclassified 1395
566 Ga0495595_0210647 3300053084 Bacteria 969
567 Ga0495619_0029705 3300053085 Bacteria 3533
568 Ga0495619_0046116 3300053085 Bacteria 2865
569 Ga0590075_017661 3300059424 Bacteria 1760
570 Ga0501082_0768230 3300060353 Bacteria 843
571 Ga0530510_0002898 3300061734 Bacteria 11760
572 Ga0530510_0247323 3300061734 Bacteria 1328

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049650 Ga0501199_008104 Ga0501199_008104_132_797 214
2 3300048909 Ga0496106_0632351 Ga0496106_0632351_68_736 217
3 3300048911 Ga0496108_0002937 Ga0496108_0002937_2759_3427 217
4 3300048912 Ga0496109_0002225 Ga0496109_0002225_8176_8844 217
5 3300048914 Ga0496111_0009333 Ga0496111_0009333_2373_3041 217
6 3300048917 Ga0496114_0245446 Ga0496114_0245446_773_1441 217
7 3300005458 Ga0070681_10262226 Ga0070681_102622262 218
8 3300009093 Ga0105240_10884825 Ga0105240_108848252 218
9 3300013307 Ga0157372_10855802 Ga0157372_108558022 218
10 3300020082 Ga0206353_10324991 Ga0206353_103249913 218
11 3300025917 Ga0207660_10033590 Ga0207660_100335902 218
12 3300025921 Ga0207652_10059605 Ga0207652_100596053 218
13 3300005329 Ga0070683_100000102 Ga0070683_10000010242 220
14 3300005329 Ga0070683_100166084 Ga0070683_1001660841 220
15 3300005336 Ga0070680_100079101 Ga0070680_1000791011 220
16 3300005337 Ga0070682_100456355 Ga0070682_1004563551 220
17 3300005341 Ga0070691_10036355 Ga0070691_100363552 220
18 3300005435 Ga0070714_100004896 Ga0070714_1000048966 220
19 3300005436 Ga0070713_100000372 Ga0070713_1000003726 220
20 3300005439 Ga0070711_100192704 Ga0070711_1001927041 220
21 3300005530 Ga0070679_100171567 Ga0070679_1001715672 220
22 3300005535 Ga0070684_100000343 Ga0070684_10000034312 220
23 3300005564 Ga0070664_100230582 Ga0070664_1002305822 220
24 3300005577 Ga0068857_100000539 Ga0068857_1000005398 220
25 3300005614 Ga0068856_100000481 Ga0068856_10000048134 220
26 3300009551 Ga0105238_10128090 Ga0105238_101280902 220
27 3300009553 Ga0105249_10325888 Ga0105249_103258882 220
28 3300013105 Ga0157369_10003031 Ga0157369_100030311 220
29 3300013307 Ga0157372_10190952 Ga0157372_101909523 220
30 3300013307 Ga0157372_10605377 Ga0157372_106053771 220
31 3300025912 Ga0207707_10202976 Ga0207707_102029761 220
32 3300025917 Ga0207660_10117830 Ga0207660_101178302 220
33 3300025928 Ga0207700_10008619 Ga0207700_100086196 220
34 3300025944 Ga0207661_10000061 Ga0207661_1000006112 220
35 3300025944 Ga0207661_10004887 Ga0207661_100048874 220
36 3300025945 Ga0207679_10178870 Ga0207679_101788702 220
37 3300026078 Ga0207702_10009994 Ga0207702_100099942 220
38 3300026116 Ga0207674_10000149 Ga0207674_1000014966 220
39 3300036401 Ga0373937_0735575 Ga0373937_0735575_17_754 220
40 3300047319 Ga0495674_0086551 Ga0495674_0086551_1355_2125 220
41 3300049588 Ga0501072_0476754 Ga0501072_0476754_195_908 220
42 3300053077 Ga0495601_0025071 Ga0495601_0025071_1392_2084 220
43 3300053078 Ga0495612_0077209 Ga0495612_0077209_641_1333 220
44 3300053085 Ga0495619_0046116 Ga0495619_0046116_773_1543 220
45 3300060353 Ga0501082_0768230 Ga0501082_0768230_23_736 220
46 3300061734 Ga0530510_0002898 Ga0530510_0002898_4921_5634 220
47 3300044693 Ga0466961_0014524 Ga0466961_0014524_3516_4235 221
48 3300044735 Ga0466968_0001713 Ga0466968_0001713_1628_2347 221
49 3300045049 Ga0466959_0023648 Ga0466959_0023648_995_1714 221
50 3300005339 Ga0070660_100025946 Ga0070660_1000259463 222
51 3300005435 Ga0070714_100121607 Ga0070714_1001216072 222
52 3300005530 Ga0070679_100136309 Ga0070679_1001363092 222
53 3300005530 Ga0070679_100250837 Ga0070679_1002508372 222
54 3300005535 Ga0070684_100567177 Ga0070684_1005671772 222
55 3300005563 Ga0068855_100052105 Ga0068855_1000521052 222
56 3300005937 Ga0081455_10187681 Ga0081455_101876812 222
57 3300006852 Ga0075433_10113124 Ga0075433_101131242 222
58 3300009093 Ga0105240_10108268 Ga0105240_101082682 222
59 3300009147 Ga0114129_10962047 Ga0114129_109620471 222
60 3300013104 Ga0157370_10085237 Ga0157370_100852372 222
61 3300013105 Ga0157369_10529054 Ga0157369_105290542 222
62 3300013296 Ga0157374_10825616 Ga0157374_108256162 222
63 3300013307 Ga0157372_10032864 Ga0157372_100328642 222
64 3300021441 Ga0213871_10061320 Ga0213871_100613202 222
65 3300025913 Ga0207695_10381430 Ga0207695_103814302 222
66 3300025915 Ga0207693_10622946 Ga0207693_106229462 222
67 3300025916 Ga0207663_10253026 Ga0207663_102530262 222
68 3300025919 Ga0207657_10037462 Ga0207657_100374622 222
69 3300025921 Ga0207652_10066594 Ga0207652_100665941 222
70 3300025929 Ga0207664_10135341 Ga0207664_101353412 222
71 3300025929 Ga0207664_10166862 Ga0207664_101668622 222
72 3300025932 Ga0207690_10200565 Ga0207690_102005652 222
73 3300025949 Ga0207667_10178030 Ga0207667_101780302 222
74 3300026075 Ga0207708_11005945 Ga0207708_110059451 222
75 3300028563 Ga0265319_1001263 Ga0265319_10012638 222
76 3300028563 Ga0265319_1046554 Ga0265319_10465542 222
77 3300028573 Ga0265334_10006301 Ga0265334_100063014 222
78 3300028654 Ga0265322_10005172 Ga0265322_100051722 222
79 3300031235 Ga0265330_10000410 Ga0265330_1000041011 222
80 3300031238 Ga0265332_10016383 Ga0265332_100163832 222
81 3300031240 Ga0265320_10006802 Ga0265320_100068024 222
82 3300031242 Ga0265329_10001722 Ga0265329_1000172210 222
83 3300031250 Ga0265331_10035729 Ga0265331_100357292 222
84 3300031251 Ga0265327_10005924 Ga0265327_100059246 222
85 3300031251 Ga0265327_10110695 Ga0265327_101106951 222
86 3300031595 Ga0265313_10004185 Ga0265313_100041854 222
87 3300031711 Ga0265314_10013117 Ga0265314_100131176 222
88 3300031995 Ga0307409_100668944 Ga0307409_1006689442 222
89 3300032002 Ga0307416_100016773 Ga0307416_1000167734 222
90 3300032126 Ga0307415_100196864 Ga0307415_1001968642 222
91 3300035083 Ga0373926_0033457 Ga0373926_0033457_315_986 222
92 3300035113 Ga0373936_0030485 Ga0373936_0030485_1043_1765 222
93 3300035116 Ga0373945_0026895 Ga0373945_0026895_1239_1961 222
94 3300035170 Ga0373943_0000814 Ga0373943_0000814_9119_9841 222
95 3300035170 Ga0373943_0026075 Ga0373943_0026075_345_1016 222
96 3300035171 Ga0373946_0027258 Ga0373946_0027258_621_1343 222
97 3300035692 Ga0373935_0029502 Ga0373935_0029502_964_1686 222
98 3300035725 Ga0373947_0181182 Ga0373947_0181182_531_1253 222
99 3300037068 Ga0373925_0016594 Ga0373925_0016594_1086_1757 222
100 3300037068 Ga0373925_0087923 Ga0373925_0087923_675_1397 222
101 3300037418 Ga0395900_0136393 Ga0395900_0136393_483_1154 222
102 3300037418 Ga0395900_0385668 Ga0395900_0385668_309_980 222
103 3300037418 Ga0395900_0674040 Ga0395900_0674040_74_754 222
104 3300037471 Ga0395905_0155349 Ga0395905_0155349_536_1207 222
105 3300037471 Ga0395905_0191422 Ga0395905_0191422_438_1109 222
106 3300037853 Ga0436364_0616029 Ga0436364_0616029_340_1029 222
107 3300038443 Ga0395901_0007541 Ga0395901_0007541_8691_9407 222
108 3300039438 Ga0436360_1329465 Ga0436360_1329465_595_1266 222
109 3300039450 Ga0436363_0263983 Ga0436363_0263983_451_1281 222
110 3300044694 Ga0466963_0033573 Ga0466963_0033573_1312_1983 222
111 3300044694 Ga0466963_0048036 Ga0466963_0048036_1894_2571 222
112 3300044694 Ga0466963_0349567 Ga0466963_0349567_352_1023 222
113 3300044706 Ga0466964_0000875 Ga0466964_0000875_4904_5644 222
114 3300044842 Ga0466957_0015334 Ga0466957_0015334_373_1050 222
115 3300045051 Ga0451576_0454306 Ga0451576_0454306_166_837 222
116 3300045836 Ga0466958_0055499 Ga0466958_0055499_420_1091 222
117 3300045976 Ga0466967_0014199 Ga0466967_0014199_4852_5523 222
118 3300045976 Ga0466967_0025765 Ga0466967_0025765_1110_1787 222
119 3300045976 Ga0466967_0084067 Ga0466967_0084067_1710_2450 222
120 3300045976 Ga0466967_0183577 Ga0466967_0183577_448_1119 222
121 3300045976 Ga0466967_1026905 Ga0466967_1026905_35_706 222
122 3300046459 Ga0495629_0442861 Ga0495629_0442861_164_835 222
123 3300046461 Ga0495641_0014608 Ga0495641_0014608_2394_3074 222
124 3300046461 Ga0495641_0249803 Ga0495641_0249803_14_685 222
125 3300046517 Ga0495630_0061973 Ga0495630_0061973_1977_2762 222
126 3300046517 Ga0495630_0253347 Ga0495630_0253347_198_869 222
127 3300046533 Ga0495640_0036963 Ga0495640_0036963_283_1068 222
128 3300046535 Ga0495586_0002968 Ga0495586_0002968_4784_5455 222
129 3300046557 Ga0495622_0259060 Ga0495622_0259060_70_741 222
130 3300046683 Ga0495658_0011187 Ga0495658_0011187_205_927 222
131 3300046683 Ga0495658_0060531 Ga0495658_0060531_350_1021 222
132 3300046689 Ga0495613_0145237 Ga0495613_0145237_651_1322 222
133 3300046809 Ga0495600_0243752 Ga0495600_0243752_436_1107 222
134 3300047319 Ga0495674_0068712 Ga0495674_0068712_191_976 222
135 3300047471 Ga0495684_0614276 Ga0495684_0614276_30_701 222
136 3300048907 Ga0496104_0247387 Ga0496104_0247387_215_886 222
137 3300048908 Ga0496105_0268375 Ga0496105_0268375_637_1308 222
138 3300048910 Ga0496107_0121244 Ga0496107_0121244_413_1102 222
139 3300048912 Ga0496109_0201979 Ga0496109_0201979_926_1597 222
140 3300048914 Ga0496111_0312689 Ga0496111_0312689_267_947 222
141 3300048915 Ga0496112_0038875 Ga0496112_0038875_589_1278 222
142 3300048915 Ga0496112_0130039 Ga0496112_0130039_706_1377 222
143 3300048918 Ga0496115_0489616 Ga0496115_0489616_148_819 222
144 3300048918 Ga0496115_0656011 Ga0496115_0656011_82_753 222
145 3300049572 Ga0501036_0859240 Ga0501036_0859240_32_703 222
146 3300049581 Ga0501047_0161809 Ga0501047_0161809_674_1345 222
147 3300049583 Ga0501067_0031012 Ga0501067_0031012_954_1694 222
148 3300049585 Ga0501069_0012076 Ga0501069_0012076_3074_3814 222
149 3300049586 Ga0501070_0035888 Ga0501070_0035888_3267_3938 222
150 3300049586 Ga0501070_0238318 Ga0501070_0238318_95_808 222
151 3300049586 Ga0501070_0259660 Ga0501070_0259660_298_1014 222
152 3300049588 Ga0501072_0750547 Ga0501072_0750547_50_721 222
153 3300049590 Ga0501074_0131729 Ga0501074_0131729_745_1461 222
154 3300049741 Ga0501079_0569649 Ga0501079_0569649_29_700 222
155 3300049742 Ga0501080_0177577 Ga0501080_0177577_652_1323 222
156 3300049742 Ga0501080_0225177 Ga0501080_0225177_174_890 222
157 3300049742 Ga0501080_0448994 Ga0501080_0448994_129_845 222
158 3300049743 Ga0501081_0566238 Ga0501081_0566238_38_778 222
159 3300049823 Ga0501044_0104577 Ga0501044_0104577_2079_2750 222
160 3300049824 Ga0501045_0158991 Ga0501045_0158991_370_1041 222
161 3300050515 nmdc:mga0a205_142414_c1 nmdc:mga0a205_142414_c1_188_859 222
162 3300061734 Ga0530510_0247323 Ga0530510_0247323_234_974 222
163 3300005327 Ga0070658_10395646 Ga0070658_103956462 223
164 3300005328 Ga0070676_10158162 Ga0070676_101581622 223
165 3300005329 Ga0070683_100056637 Ga0070683_1000566372 223
166 3300005334 Ga0068869_100229252 Ga0068869_1002292521 223
167 3300005337 Ga0070682_100028092 Ga0070682_1000280923 223
168 3300005338 Ga0068868_100045859 Ga0068868_1000458593 223
169 3300005339 Ga0070660_100022699 Ga0070660_1000226992 223
170 3300005340 Ga0070689_100041320 Ga0070689_1000413204 223
171 3300005340 Ga0070689_100183867 Ga0070689_1001838672 223
172 3300005341 Ga0070691_10010478 Ga0070691_100104783 223
173 3300005343 Ga0070687_100068130 Ga0070687_1000681303 223
174 3300005344 Ga0070661_100219155 Ga0070661_1002191551 223
175 3300005345 Ga0070692_10070294 Ga0070692_100702942 223
176 3300005347 Ga0070668_100017596 Ga0070668_1000175966 223
177 3300005347 Ga0070668_100241972 Ga0070668_1002419722 223
178 3300005353 Ga0070669_100494403 Ga0070669_1004944032 223
179 3300005355 Ga0070671_100031777 Ga0070671_1000317772 223
180 3300005356 Ga0070674_100032437 Ga0070674_1000324372 223
181 3300005364 Ga0070673_100138724 Ga0070673_1001387242 223
182 3300005365 Ga0070688_100002134 Ga0070688_1000021342 223
183 3300005366 Ga0070659_100033906 Ga0070659_1000339062 223
184 3300005434 Ga0070709_10009902 Ga0070709_100099023 223
185 3300005434 Ga0070709_10352334 Ga0070709_103523341 223
186 3300005435 Ga0070714_100163225 Ga0070714_1001632253 223
187 3300005436 Ga0070713_100106361 Ga0070713_1001063613 223
188 3300005436 Ga0070713_100298997 Ga0070713_1002989972 223
189 3300005436 Ga0070713_100314459 Ga0070713_1003144592 223
190 3300005436 Ga0070713_100431606 Ga0070713_1004316062 223
191 3300005437 Ga0070710_10018665 Ga0070710_100186652 223
192 3300005438 Ga0070701_10002635 Ga0070701_100026355 223
193 3300005439 Ga0070711_100020315 Ga0070711_1000203153 223
194 3300005440 Ga0070705_100007265 Ga0070705_1000072651 223
195 3300005441 Ga0070700_100001464 Ga0070700_1000014642 223
196 3300005441 Ga0070700_100024118 Ga0070700_1000241183 223
197 3300005441 Ga0070700_100034190 Ga0070700_1000341903 223
198 3300005445 Ga0070708_100050171 Ga0070708_1000501712 223
199 3300005445 Ga0070708_100148724 Ga0070708_1001487241 223
200 3300005445 Ga0070708_100517404 Ga0070708_1005174042 223
201 3300005455 Ga0070663_100021691 Ga0070663_1000216915 223
202 3300005456 Ga0070678_100003980 Ga0070678_1000039803 223
203 3300005457 Ga0070662_100082204 Ga0070662_1000822041 223
204 3300005457 Ga0070662_100154635 Ga0070662_1001546351 223
205 3300005458 Ga0070681_10106059 Ga0070681_101060592 223
206 3300005459 Ga0068867_100004544 Ga0068867_10000454412 223
207 3300005466 Ga0070685_10017675 Ga0070685_100176753 223
208 3300005467 Ga0070706_100024233 Ga0070706_1000242334 223
209 3300005468 Ga0070707_100002173 Ga0070707_10000217316 223
210 3300005468 Ga0070707_100628145 Ga0070707_1006281451 223
211 3300005471 Ga0070698_100078488 Ga0070698_1000784883 223
212 3300005535 Ga0070684_100003310 Ga0070684_1000033102 223
213 3300005535 Ga0070684_100117256 Ga0070684_1001172563 223
214 3300005539 Ga0068853_100018457 Ga0068853_1000184573 223
215 3300005543 Ga0070672_100002647 Ga0070672_10000264714 223
216 3300005544 Ga0070686_100004104 Ga0070686_1000041047 223
217 3300005545 Ga0070695_100003524 Ga0070695_1000035247 223
218 3300005546 Ga0070696_100104388 Ga0070696_1001043882 223
219 3300005548 Ga0070665_100039518 Ga0070665_1000395184 223
220 3300005549 Ga0070704_100017189 Ga0070704_1000171893 223
221 3300005549 Ga0070704_100139053 Ga0070704_1001390532 223
222 3300005563 Ga0068855_100332579 Ga0068855_1003325792 223
223 3300005563 Ga0068855_100355476 Ga0068855_1003554762 223
224 3300005564 Ga0070664_100020201 Ga0070664_1000202012 223
225 3300005578 Ga0068854_100626521 Ga0068854_1006265211 223
226 3300005614 Ga0068856_100000869 Ga0068856_10000086932 223
227 3300005614 Ga0068856_100049621 Ga0068856_1000496212 223
228 3300005614 Ga0068856_100217444 Ga0068856_1002174443 223
229 3300005614 Ga0068856_100572477 Ga0068856_1005724772 223
230 3300005615 Ga0070702_100004297 Ga0070702_1000042972 223
231 3300005617 Ga0068859_100058218 Ga0068859_1000582183 223
232 3300005718 Ga0068866_10002247 Ga0068866_100022477 223
233 3300005718 Ga0068866_10146251 Ga0068866_101462512 223
234 3300005719 Ga0068861_100030270 Ga0068861_1000302704 223
235 3300005840 Ga0068870_10128950 Ga0068870_101289502 223
236 3300005843 Ga0068860_100219166 Ga0068860_1002191663 223
237 3300005844 Ga0068862_100694592 Ga0068862_1006945922 223
238 3300005937 Ga0081455_10484823 Ga0081455_104848231 223
239 3300005985 Ga0081539_10012953 Ga0081539_100129534 223
240 3300005985 Ga0081539_10022801 Ga0081539_100228011 223
241 3300005985 Ga0081539_10039804 Ga0081539_100398043 223
242 3300006173 Ga0070716_100109878 Ga0070716_1001098782 223
243 3300006175 Ga0070712_100024368 Ga0070712_1000243682 223
244 3300006175 Ga0070712_100033478 Ga0070712_1000334783 223
245 3300006175 Ga0070712_100367098 Ga0070712_1003670982 223
246 3300006237 Ga0097621_100003227 Ga0097621_1000032275 223
247 3300006358 Ga0068871_100009924 Ga0068871_1000099246 223
248 3300006358 Ga0068871_100199159 Ga0068871_1001991592 223
249 3300006844 Ga0075428_100088776 Ga0075428_1000887761 223
250 3300006844 Ga0075428_100235246 Ga0075428_1002352463 223
251 3300006844 Ga0075428_100384344 Ga0075428_1003843442 223
252 3300006844 Ga0075428_100534136 Ga0075428_1005341362 223
253 3300006847 Ga0075431_100249448 Ga0075431_1002494482 223
254 3300006852 Ga0075433_10431940 Ga0075433_104319402 223
255 3300006881 Ga0068865_100003596 Ga0068865_1000035964 223
256 3300006914 Ga0075436_100247037 Ga0075436_1002470372 223
257 3300006931 Ga0097620_100058219 Ga0097620_1000582194 223
258 3300009093 Ga0105240_10237181 Ga0105240_102371812 223
259 3300009094 Ga0111539_10294854 Ga0111539_102948542 223
260 3300009094 Ga0111539_10321969 Ga0111539_103219692 223
261 3300009098 Ga0105245_10002706 Ga0105245_1000270614 223
262 3300009098 Ga0105245_10013004 Ga0105245_100130042 223
263 3300009098 Ga0105245_10110304 Ga0105245_101103042 223
264 3300009098 Ga0105245_10409471 Ga0105245_104094712 223
265 3300009101 Ga0105247_10027554 Ga0105247_100275543 223
266 3300009147 Ga0114129_10001640 Ga0114129_1000164021 223
267 3300009147 Ga0114129_10118114 Ga0114129_101181144 223
268 3300009148 Ga0105243_10026764 Ga0105243_100267642 223
269 3300009148 Ga0105243_10854127 Ga0105243_108541272 223
270 3300009148 Ga0105243_10862300 Ga0105243_108623002 223
271 3300009174 Ga0105241_10066855 Ga0105241_100668553 223
272 3300009176 Ga0105242_10034141 Ga0105242_100341414 223
273 3300009176 Ga0105242_10197568 Ga0105242_101975682 223
274 3300009176 Ga0105242_10367142 Ga0105242_103671421 223
275 3300009176 Ga0105242_11096819 Ga0105242_110968191 223
276 3300009177 Ga0105248_10023479 Ga0105248_100234794 223
277 3300009545 Ga0105237_10118894 Ga0105237_101188943 223
278 3300009545 Ga0105237_10178968 Ga0105237_101789683 223
279 3300009551 Ga0105238_10060339 Ga0105238_100603395 223
280 3300009553 Ga0105249_10032429 Ga0105249_100324292 223
281 3300009553 Ga0105249_10530253 Ga0105249_105302532 223
282 3300010375 Ga0105239_10014340 Ga0105239_100143405 223
283 3300011119 Ga0105246_10019434 Ga0105246_100194344 223
284 3300011119 Ga0105246_10495510 Ga0105246_104955102 223
285 3300013102 Ga0157371_10153699 Ga0157371_101536992 223
286 3300013104 Ga0157370_10001997 Ga0157370_100019976 223
287 3300013105 Ga0157369_10024504 Ga0157369_100245045 223
288 3300013296 Ga0157374_10081816 Ga0157374_100818162 223
289 3300013296 Ga0157374_10104084 Ga0157374_101040843 223
290 3300013296 Ga0157374_10211230 Ga0157374_102112302 223
291 3300013297 Ga0157378_10015506 Ga0157378_100155065 223
292 3300013297 Ga0157378_10508139 Ga0157378_105081392 223
293 3300013306 Ga0163162_10004499 Ga0163162_1000449912 223
294 3300013306 Ga0163162_10943460 Ga0163162_109434602 223
295 3300013307 Ga0157372_10187749 Ga0157372_101877491 223
296 3300013308 Ga0157375_10003905 Ga0157375_1000390511 223
297 3300013308 Ga0157375_10009361 Ga0157375_100093614 223
298 3300013308 Ga0157375_10017420 Ga0157375_100174202 223
299 3300013308 Ga0157375_10636534 Ga0157375_106365342 223
300 3300014325 Ga0163163_10276674 Ga0163163_102766741 223
301 3300014325 Ga0163163_10283913 Ga0163163_102839131 223
302 3300014325 Ga0163163_10460252 Ga0163163_104602522 223
303 3300014326 Ga0157380_10008025 Ga0157380_100080254 223
304 3300014326 Ga0157380_10033809 Ga0157380_100338092 223
305 3300014326 Ga0157380_10431362 Ga0157380_104313622 223
306 3300014745 Ga0157377_10014331 Ga0157377_100143312 223
307 3300014745 Ga0157377_10021940 Ga0157377_100219402 223
308 3300014968 Ga0157379_10296648 Ga0157379_102966483 223
309 3300014968 Ga0157379_10412375 Ga0157379_104123751 223
310 3300014969 Ga0157376_10005990 Ga0157376_1000599010 223
311 3300014969 Ga0157376_10059597 Ga0157376_100595973 223
312 3300025898 Ga0207692_10008725 Ga0207692_100087253 223
313 3300025898 Ga0207692_10293429 Ga0207692_102934292 223
314 3300025899 Ga0207642_10002169 Ga0207642_100021698 223
315 3300025899 Ga0207642_10237361 Ga0207642_102373611 223
316 3300025900 Ga0207710_10018665 Ga0207710_100186652 223
317 3300025903 Ga0207680_10011715 Ga0207680_100117153 223
318 3300025905 Ga0207685_10040989 Ga0207685_100409892 223
319 3300025907 Ga0207645_10214609 Ga0207645_102146091 223
320 3300025908 Ga0207643_10029657 Ga0207643_100296573 223
321 3300025910 Ga0207684_10143280 Ga0207684_101432804 223
322 3300025911 Ga0207654_10102059 Ga0207654_101020593 223
323 3300025912 Ga0207707_10008757 Ga0207707_100087573 223
324 3300025914 Ga0207671_10043189 Ga0207671_100431893 223
325 3300025914 Ga0207671_10247611 Ga0207671_102476112 223
326 3300025915 Ga0207693_10000312 Ga0207693_100003124 223
327 3300025915 Ga0207693_10028891 Ga0207693_100288913 223
328 3300025916 Ga0207663_10030427 Ga0207663_100304272 223
329 3300025917 Ga0207660_10026729 Ga0207660_100267293 223
330 3300025917 Ga0207660_10045516 Ga0207660_100455162 223
331 3300025918 Ga0207662_10054602 Ga0207662_100546023 223
332 3300025919 Ga0207657_10019237 Ga0207657_100192375 223
333 3300025919 Ga0207657_10027058 Ga0207657_100270584 223
334 3300025921 Ga0207652_10003706 Ga0207652_100037065 223
335 3300025921 Ga0207652_10551862 Ga0207652_105518622 223
336 3300025922 Ga0207646_10013625 Ga0207646_100136256 223
337 3300025922 Ga0207646_10167520 Ga0207646_101675202 223
338 3300025922 Ga0207646_10544432 Ga0207646_105444322 223
339 3300025923 Ga0207681_10093240 Ga0207681_100932402 223
340 3300025924 Ga0207694_10300094 Ga0207694_103000942 223
341 3300025926 Ga0207659_10158407 Ga0207659_101584072 223
342 3300025927 Ga0207687_10021127 Ga0207687_100211273 223
343 3300025927 Ga0207687_10062483 Ga0207687_100624833 223
344 3300025927 Ga0207687_10199711 Ga0207687_101997113 223
345 3300025927 Ga0207687_10277116 Ga0207687_102771162 223
346 3300025928 Ga0207700_10217673 Ga0207700_102176733 223
347 3300025928 Ga0207700_10376703 Ga0207700_103767032 223
348 3300025931 Ga0207644_10168953 Ga0207644_101689532 223
349 3300025932 Ga0207690_10034370 Ga0207690_100343704 223
350 3300025933 Ga0207706_10166978 Ga0207706_101669781 223
351 3300025933 Ga0207706_10232086 Ga0207706_102320862 223
352 3300025934 Ga0207686_10011305 Ga0207686_100113055 223
353 3300025934 Ga0207686_10317611 Ga0207686_103176112 223
354 3300025935 Ga0207709_10005693 Ga0207709_100056935 223
355 3300025936 Ga0207670_10378840 Ga0207670_103788401 223
356 3300025937 Ga0207669_10006579 Ga0207669_100065793 223
357 3300025938 Ga0207704_10010965 Ga0207704_100109652 223
358 3300025938 Ga0207704_10525911 Ga0207704_105259111 223
359 3300025939 Ga0207665_10027047 Ga0207665_100270472 223
360 3300025940 Ga0207691_10002913 Ga0207691_100029134 223
361 3300025941 Ga0207711_10083649 Ga0207711_100836492 223
362 3300025942 Ga0207689_10492884 Ga0207689_104928841 223
363 3300025944 Ga0207661_10000505 Ga0207661_100005055 223
364 3300025949 Ga0207667_10103060 Ga0207667_101030602 223
365 3300025949 Ga0207667_10190083 Ga0207667_101900833 223
366 3300025960 Ga0207651_10240042 Ga0207651_102400421 223
367 3300025961 Ga0207712_10021204 Ga0207712_100212044 223
368 3300025961 Ga0207712_10458499 Ga0207712_104584991 223
369 3300025972 Ga0207668_10050215 Ga0207668_100502154 223
370 3300026023 Ga0207677_10023963 Ga0207677_100239633 223
371 3300026023 Ga0207677_10104088 Ga0207677_101040883 223
372 3300026035 Ga0207703_10045607 Ga0207703_100456072 223
373 3300026035 Ga0207703_10531255 Ga0207703_105312552 223
374 3300026041 Ga0207639_10013938 Ga0207639_100139383 223
375 3300026067 Ga0207678_10015938 Ga0207678_100159384 223
376 3300026067 Ga0207678_10053171 Ga0207678_100531714 223
377 3300026067 Ga0207678_10191060 Ga0207678_101910601 223
378 3300026075 Ga0207708_10000811 Ga0207708_1000081113 223
379 3300026075 Ga0207708_10027208 Ga0207708_100272083 223
380 3300026075 Ga0207708_10046186 Ga0207708_100461863 223
381 3300026075 Ga0207708_10500107 Ga0207708_105001072 223
382 3300026078 Ga0207702_10009855 Ga0207702_100098555 223
383 3300026078 Ga0207702_10073971 Ga0207702_100739712 223
384 3300026089 Ga0207648_10000214 Ga0207648_1000021414 223
385 3300026118 Ga0207675_100018153 Ga0207675_1000181534 223
386 3300026118 Ga0207675_100020426 Ga0207675_1000204265 223
387 3300026121 Ga0207683_10003027 Ga0207683_100030278 223
388 3300026121 Ga0207683_10008122 Ga0207683_100081225 223
389 3300026142 Ga0207698_10083579 Ga0207698_100835793 223
390 3300026142 Ga0207698_10485358 Ga0207698_104853581 223
391 3300028379 Ga0268266_10117293 Ga0268266_101172932 223
392 3300028380 Ga0268265_10085160 Ga0268265_100851603 223
393 3300028380 Ga0268265_10636038 Ga0268265_106360382 223
394 3300028381 Ga0268264_10079376 Ga0268264_100793763 223
395 3300031548 Ga0307408_100199122 Ga0307408_1001991222 223
396 3300031548 Ga0307408_100451014 Ga0307408_1004510142 223
397 3300031731 Ga0307405_10015818 Ga0307405_100158182 223
398 3300031852 Ga0307410_10338584 Ga0307410_103385842 223
399 3300031852 Ga0307410_10635663 Ga0307410_106356631 223
400 3300031901 Ga0307406_10189504 Ga0307406_101895042 223
401 3300031903 Ga0307407_10070018 Ga0307407_100700182 223
402 3300031911 Ga0307412_10031336 Ga0307412_100313363 223
403 3300031995 Ga0307409_100616376 Ga0307409_1006163762 223
404 3300032005 Ga0307411_10008423 Ga0307411_100084234 223
405 3300032126 Ga0307415_100582809 Ga0307415_1005828092 223
406 3300035724 Ga0373933_0420350 Ga0373933_0420350_191_862 223
407 3300037068 Ga0373925_0123935 Ga0373925_0123935_1138_1824 223
408 3300037312 Ga0395899_0031127 Ga0395899_0031127_1412_2155 223
409 3300037312 Ga0395899_0052220 Ga0395899_0052220_1137_1823 223
410 3300037312 Ga0395899_0057368 Ga0395899_0057368_1944_2633 223
411 3300037312 Ga0395899_0124948 Ga0395899_0124948_908_1660 223
412 3300037312 Ga0395899_0132670 Ga0395899_0132670_809_1495 223
413 3300037418 Ga0395900_0002110 Ga0395900_0002110_9295_10047 223
414 3300037418 Ga0395900_0002210 Ga0395900_0002210_15359_16030 223
415 3300037418 Ga0395900_0025706 Ga0395900_0025706_333_1019 223
416 3300037418 Ga0395900_0044339 Ga0395900_0044339_741_1484 223
417 3300037418 Ga0395900_0062824 Ga0395900_0062824_1695_2381 223
418 3300037418 Ga0395900_0078922 Ga0395900_0078922_2066_2752 223
419 3300037418 Ga0395900_0353981 Ga0395900_0353981_156_845 223
420 3300037466 Ga0395898_0002238 Ga0395898_0002238_11254_11940 223
421 3300037466 Ga0395898_0004044 Ga0395898_0004044_6355_7107 223
422 3300037466 Ga0395898_0014865 Ga0395898_0014865_676_1347 223
423 3300037466 Ga0395898_0036788 Ga0395898_0036788_2969_3655 223
424 3300037466 Ga0395898_0056293 Ga0395898_0056293_113_784 223
425 3300037466 Ga0395898_0058188 Ga0395898_0058188_649_1338 223
426 3300037466 Ga0395898_0071250 Ga0395898_0071250_530_1216 223
427 3300037466 Ga0395898_0103314 Ga0395898_0103314_1832_2518 223
428 3300037466 Ga0395898_0106911 Ga0395898_0106911_660_1346 223
429 3300037466 Ga0395898_0205487 Ga0395898_0205487_999_1742 223
430 3300037466 Ga0395898_0232570 Ga0395898_0232570_490_1176 223
431 3300037466 Ga0395898_0241455 Ga0395898_0241455_246_923 223
432 3300037466 Ga0395898_0515439 Ga0395898_0515439_287_973 223
433 3300037471 Ga0395905_0005593 Ga0395905_0005593_11602_12273 223
434 3300037471 Ga0395905_0012371 Ga0395905_0012371_6786_7472 223
435 3300037471 Ga0395905_0012571 Ga0395905_0012571_232_984 223
436 3300037471 Ga0395905_0020067 Ga0395905_0020067_4715_5401 223
437 3300037471 Ga0395905_0070059 Ga0395905_0070059_1951_2640 223
438 3300037471 Ga0395905_0149660 Ga0395905_0149660_175_918 223
439 3300037471 Ga0395905_0381653 Ga0395905_0381653_536_1222 223
440 3300037471 Ga0395905_0560122 Ga0395905_0560122_319_1005 223
441 3300038443 Ga0395901_0005034 Ga0395901_0005034_210_962 223
442 3300038443 Ga0395901_0023726 Ga0395901_0023726_2626_3297 223
443 3300038443 Ga0395901_0025538 Ga0395901_0025538_2276_2962 223
444 3300038443 Ga0395901_0046606 Ga0395901_0046606_156_842 223
445 3300038443 Ga0395901_0065219 Ga0395901_0065219_1979_2665 223
446 3300038443 Ga0395901_0081986 Ga0395901_0081986_1523_2266 223
447 3300038443 Ga0395901_0213835 Ga0395901_0213835_585_1271 223
448 3300038443 Ga0395901_0457497 Ga0395901_0457497_587_1276 223
449 3300038443 Ga0395901_0835912 Ga0395901_0835912_147_833 223
450 3300039437 Ga0436365_0131966 Ga0436365_0131966_1036_1860 223
451 3300039437 Ga0436365_0243590 Ga0436365_0243590_149_820 223
452 3300041411 Ga0439466_0049302 Ga0439466_0049302_617_1303 223
453 3300042156 Ga0439446_0028139 Ga0439446_0028139_366_1052 223
454 3300042435 Ga0439434_0101020 Ga0439434_0101020_138_824 223
455 3300044658 Ga0466972_0112699 Ga0466972_0112699_190_882 223
456 3300044706 Ga0466964_0011091 Ga0466964_0011091_2479_3165 223
457 3300044706 Ga0466964_0111894 Ga0466964_0111894_213_896 223
458 3300044706 Ga0466964_0114443 Ga0466964_0114443_120_791 223
459 3300044901 Ga0466960_0012863 Ga0466960_0012863_595_1287 223
460 3300045049 Ga0466959_0207033 Ga0466959_0207033_626_1309 223
461 3300045976 Ga0466967_0169526 Ga0466967_0169526_1223_1909 223
462 3300045976 Ga0466967_0594545 Ga0466967_0594545_344_1039 223
463 3300046455 Ga0495603_0004117 Ga0495603_0004117_6032_6718 223
464 3300046462 Ga0495651_0027567 Ga0495651_0027567_1597_2268 223
465 3300046463 Ga0495653_0206885 Ga0495653_0206885_554_1225 223
466 3300046473 Ga0495582_0032696 Ga0495582_0032696_206_892 223
467 3300046474 Ga0495605_0104145 Ga0495605_0104145_470_1156 223
468 3300046475 Ga0495639_0094856 Ga0495639_0094856_471_1157 223
469 3300046476 Ga0495662_0058664 Ga0495662_0058664_510_1196 223
470 3300046500 Ga0495596_0063826 Ga0495596_0063826_378_1064 223
471 3300046511 Ga0495608_0006067 Ga0495608_0006067_2481_3152 223
472 3300046511 Ga0495608_0296138 Ga0495608_0296138_149_820 223
473 3300046518 Ga0495631_0077851 Ga0495631_0077851_315_1001 223
474 3300046523 Ga0495644_0105816 Ga0495644_0105816_111_797 223
475 3300046525 Ga0495663_0007027 Ga0495663_0007027_1503_2189 223
476 3300046531 Ga0495665_0025053 Ga0495665_0025053_2455_3141 223
477 3300046536 Ga0495587_0308476 Ga0495587_0308476_69_740 223
478 3300046538 Ga0495609_0055855 Ga0495609_0055855_795_1481 223
479 3300046559 Ga0495667_0026672 Ga0495667_0026672_1099_1770 223
480 3300046615 Ga0495656_0058688 Ga0495656_0058688_883_1569 223
481 3300046664 Ga0495659_0002949 Ga0495659_0002949_470_1156 223
482 3300046665 Ga0495661_0191352 Ga0495661_0191352_228_914 223
483 3300046674 Ga0495588_0139492 Ga0495588_0139492_402_1088 223
484 3300046675 Ga0495657_0030558 Ga0495657_0030558_775_1446 223
485 3300046683 Ga0495658_0004265 Ga0495658_0004265_3980_4666 223
486 3300046683 Ga0495658_0378902 Ga0495658_0378902_149_820 223
487 3300046684 Ga0495669_0144794 Ga0495669_0144794_84_770 223
488 3300046690 Ga0495624_0145483 Ga0495624_0145483_608_1279 223
489 3300046691 Ga0495670_0132658 Ga0495670_0132658_160_846 223
490 3300046692 Ga0495671_0087519 Ga0495671_0087519_325_1011 223
491 3300046794 Ga0495589_0060047 Ga0495589_0060047_1066_1752 223
492 3300046809 Ga0495600_0030572 Ga0495600_0030572_1111_1782 223
493 3300047315 Ga0495581_0009484 Ga0495581_0009484_241_927 223
494 3300047315 Ga0495581_0022991 Ga0495581_0022991_1569_2255 223
495 3300047317 Ga0495604_0055596 Ga0495604_0055596_931_1602 223
496 3300047318 Ga0495636_0122315 Ga0495636_0122315_234_920 223
497 3300047319 Ga0495674_0244140 Ga0495674_0244140_783_1454 223
498 3300047319 Ga0495674_0434654 Ga0495674_0434654_357_1040 223
499 3300047321 Ga0495676_0021257 Ga0495676_0021257_847_1533 223
500 3300047322 Ga0495680_0122013 Ga0495680_0122013_1117_1800 223
501 3300047322 Ga0495680_0282419 Ga0495680_0282419_143_814 223
502 3300047444 Ga0495675_0163811 Ga0495675_0163811_386_1057 223
503 3300047673 Ga0495593_0149464 Ga0495593_0149464_97_783 223
504 3300048088 Ga0495602_0101939 Ga0495602_0101939_791_1462 223
505 3300048903 Ga0496100_0065883 Ga0496100_0065883_1078_1842 223
506 3300048903 Ga0496100_0101946 Ga0496100_0101946_994_1680 223
507 3300048903 Ga0496100_0102946 Ga0496100_0102946_52_729 223
508 3300048903 Ga0496100_0318920 Ga0496100_0318920_463_1134 223
509 3300048904 Ga0496101_0032147 Ga0496101_0032147_1853_2539 223
510 3300048904 Ga0496101_0045916 Ga0496101_0045916_1689_2360 223
511 3300048904 Ga0496101_0067463 Ga0496101_0067463_1844_2530 223
512 3300048904 Ga0496101_0078937 Ga0496101_0078937_1456_2259 223
513 3300048904 Ga0496101_0251410 Ga0496101_0251410_134_820 223
514 3300048905 Ga0496102_0007349 Ga0496102_0007349_5743_6546 223
515 3300048905 Ga0496102_0011604 Ga0496102_0011604_4753_5439 223
516 3300048905 Ga0496102_0014734 Ga0496102_0014734_3105_3791 223
517 3300048905 Ga0496102_0067224 Ga0496102_0067224_1075_1752 223
518 3300048905 Ga0496102_0102019 Ga0496102_0102019_277_1014 223
519 3300048906 Ga0496103_0008781 Ga0496103_0008781_994_1680 223
520 3300048906 Ga0496103_0054418 Ga0496103_0054418_839_1525 223
521 3300048906 Ga0496103_0107421 Ga0496103_0107421_937_1740 223
522 3300048906 Ga0496103_0201480 Ga0496103_0201480_403_1080 223
523 3300048907 Ga0496104_0020574 Ga0496104_0020574_791_1528 223
524 3300048907 Ga0496104_0036555 Ga0496104_0036555_2575_3378 223
525 3300048907 Ga0496104_0042619 Ga0496104_0042619_3391_4128 223
526 3300048907 Ga0496104_0226077 Ga0496104_0226077_843_1520 223
527 3300048907 Ga0496104_0275142 Ga0496104_0275142_426_1112 223
528 3300048909 Ga0496106_0006374 Ga0496106_0006374_3310_3996 223
529 3300048909 Ga0496106_0662335 Ga0496106_0662335_111_797 223
530 3300048910 Ga0496107_0040302 Ga0496107_0040302_1374_2060 223
531 3300048910 Ga0496107_0103211 Ga0496107_0103211_1172_1849 223
532 3300048911 Ga0496108_0000999 Ga0496108_0000999_1907_2644 223
533 3300048911 Ga0496108_0750189 Ga0496108_0750189_134_820 223
534 3300048912 Ga0496109_0003779 Ga0496109_0003779_6804_7541 223
535 3300048912 Ga0496109_0012663 Ga0496109_0012663_861_1547 223
536 3300048912 Ga0496109_0162960 Ga0496109_0162960_534_1220 223
537 3300048913 Ga0496110_0010416 Ga0496110_0010416_4540_5277 223
538 3300048913 Ga0496110_0041585 Ga0496110_0041585_1438_2124 223
539 3300048913 Ga0496110_0099938 Ga0496110_0099938_819_1505 223
540 3300048913 Ga0496110_0342674 Ga0496110_0342674_636_1313 223
541 3300048913 Ga0496110_0346829 Ga0496110_0346829_296_1099 223
542 3300048914 Ga0496111_0022832 Ga0496111_0022832_2009_2746 223
543 3300048914 Ga0496111_0030725 Ga0496111_0030725_1513_2199 223
544 3300048914 Ga0496111_0067215 Ga0496111_0067215_45_731 223
545 3300048915 Ga0496112_0005069 Ga0496112_0005069_6727_7416 223
546 3300048915 Ga0496112_0016674 Ga0496112_0016674_4534_5220 223
547 3300048915 Ga0496112_0032966 Ga0496112_0032966_1422_2159 223
548 3300048915 Ga0496112_0089904 Ga0496112_0089904_1783_2469 223
549 3300048915 Ga0496112_0093485 Ga0496112_0093485_1204_1890 223
550 3300048915 Ga0496112_0175296 Ga0496112_0175296_1367_2053 223
551 3300048916 Ga0496113_0087848 Ga0496113_0087848_1634_2320 223
552 3300048916 Ga0496113_0095693 Ga0496113_0095693_370_1056 223
553 3300048916 Ga0496113_0121291 Ga0496113_0121291_1014_1700 223
554 3300048917 Ga0496114_0000264 Ga0496114_0000264_25845_26648 223
555 3300048917 Ga0496114_0005659 Ga0496114_0005659_6559_7245 223
556 3300048917 Ga0496114_0206432 Ga0496114_0206432_768_1505 223
557 3300048918 Ga0496115_0003038 Ga0496115_0003038_8591_9262 223
558 3300048918 Ga0496115_0007416 Ga0496115_0007416_3641_4327 223
559 3300049578 Ga0501042_0201784 Ga0501042_0201784_352_1038 223
560 3300049583 Ga0501067_0275471 Ga0501067_0275471_17_760 223
561 3300050489 nmdc:mga03683_173338_c1 nmdc:mga03683_173338_c1_95_787 223
562 3300050507 nmdc:mga05p37_218266_c1 nmdc:mga05p37_218266_c1_444_1130 223
563 3300050507 nmdc:mga05p37_2465_c1 nmdc:mga05p37_2465_c1_7407_8099 223
564 3300050507 nmdc:mga05p37_33557_c1 nmdc:mga05p37_33557_c1_128_814 223
565 3300050508 nmdc:mga09592_302191_c1 nmdc:mga09592_302191_c1_511_1254 223
566 3300050511 nmdc:mga08y16_849082_c1 nmdc:mga08y16_849082_c1_63_776 223
567 3300050512 nmdc:mga0n895_676522_c1 nmdc:mga0n895_676522_c1_98_784 223
568 3300050513 nmdc:mga0rr50_157181_c1 nmdc:mga0rr50_157181_c1_47_790 223
569 3300053077 Ga0495601_0062192 Ga0495601_0062192_1169_1840 223
570 3300053084 Ga0495595_0210647 Ga0495595_0210647_190_861 223
571 3300053085 Ga0495619_0029705 Ga0495619_0029705_464_1135 223
572 3300059424 Ga0590075_017661 Ga0590075_017661_401_1087 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

8

170

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8455 2 219
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8368 3 219
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8245 2 219
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8125 3 219
7p8g-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 - apo form 0.8051 2 220
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9 2 222 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8887 2 222 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8691 5 222 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8612 3 217 3.90.550.10
af_O06376_3_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8589 3 215 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A538H1F6-F1-model_v4 Glycosyltransferase family 2 protein 0.9784 2 222 GO:0016757
AF-A0A2V9XZG8-F1-model_v4 Glycosyl transferase 0.9771 67 222 GO:0016757
AF-A0A524B147-F1-model_v4 Glycosyl transferase 0.9693 3 220 GO:0016757
AF-A0A0F9N9V2-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9684 60 221 GO:0016757
AF-A0A7C2D6F6-F1-model_v4 Methyltransferase 0.9681 60 222 GO:0008168
GO:0016757
GO:0032259

Feature Viewer

pLDDT pTM Quality
85.28 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map