F465098
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 572 | 300 | 572 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0263983|Ga0436363_0263983_451_1281 |
| Length | 276 |
| Sequence | LPGSPRVSFIIPVYNEERTVGAVIERVRALPFDKQLVVVDDGSSDGTPAALAALAGDDLVALRQVNRGKGAAIRAAIPHLDGDVTVIQDADLEYDPAEVPSLIQPIVDGVADVVYGSRLIGGKPQRAYLFWHRVGNRLLSLVAGVLYNTTLTDMETGYKAFRADVLKSLDLRENGFSIEPEITAKVCKRHLRIYELPISYYGRTYAEGKKITWRDGFSALRVLFKIRLTPAARVSGVAQERPAGSVAGSDGATVALLPPRTKAIRREAKRQAAGGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 199 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 200 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 201 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 202 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 203 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 204 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 11.89 |
| Rhizosphere | 87.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10395646 | 3300005327 | Bacteria | 1186 |
| 2 | Ga0070676_10158162 | 3300005328 | Bacteria | 1456 |
| 3 | Ga0070683_100000102 | 3300005329 | Bacteria | 55400 |
| 4 | Ga0070683_100056637 | 3300005329 | Bacteria | 3640 |
| 5 | Ga0070683_100166084 | 3300005329 | Bacteria | 2094 |
| 6 | Ga0068869_100229252 | 3300005334 | Bacteria | 1475 |
| 7 | Ga0070680_100079101 | 3300005336 | Bacteria | 2710 |
| 8 | Ga0070682_100028092 | 3300005337 | Bacteria | 3381 |
| 9 | Ga0070682_100456355 | 3300005337 | Unclassified | 980 |
| 10 | Ga0068868_100045859 | 3300005338 | Bacteria | 3420 |
| 11 | Ga0070660_100022699 | 3300005339 | Bacteria | 4645 |
| 12 | Ga0070660_100025946 | 3300005339 | Bacteria | 4360 |
| 13 | Ga0070689_100041320 | 3300005340 | Bacteria | 3540 |
| 14 | Ga0070689_100183867 | 3300005340 | Bacteria | 1699 |
| 15 | Ga0070691_10010478 | 3300005341 | Bacteria | 4231 |
| 16 | Ga0070691_10036355 | 3300005341 | Bacteria | 2321 |
| 17 | Ga0070687_100068130 | 3300005343 | Bacteria | 1902 |
| 18 | Ga0070661_100219155 | 3300005344 | Bacteria | 1459 |
| 19 | Ga0070692_10070294 | 3300005345 | Bacteria | 1863 |
| 20 | Ga0070668_100017596 | 3300005347 | Bacteria | 5359 |
| 21 | Ga0070668_100241972 | 3300005347 | Bacteria | 1495 |
| 22 | Ga0070669_100494403 | 3300005353 | Bacteria | 1014 |
| 23 | Ga0070671_100031777 | 3300005355 | Bacteria | 4364 |
| 24 | Ga0070674_100032437 | 3300005356 | Bacteria | 3468 |
| 25 | Ga0070673_100138724 | 3300005364 | Bacteria | 2049 |
| 26 | Ga0070688_100002134 | 3300005365 | Bacteria | 9970 |
| 27 | Ga0070659_100033906 | 3300005366 | Bacteria | 3969 |
| 28 | Ga0070709_10009902 | 3300005434 | Bacteria | 5268 |
| 29 | Ga0070709_10352334 | 3300005434 | Bacteria | 1088 |
| 30 | Ga0070714_100004896 | 3300005435 | Bacteria | 10167 |
| 31 | Ga0070714_100121607 | 3300005435 | Bacteria | 2323 |
| 32 | Ga0070714_100163225 | 3300005435 | Bacteria | 2017 |
| 33 | Ga0070713_100000372 | 3300005436 | Bacteria | 28704 |
| 34 | Ga0070713_100106361 | 3300005436 | Bacteria | 2439 |
| 35 | Ga0070713_100298997 | 3300005436 | Bacteria | 1481 |
| 36 | Ga0070713_100314459 | 3300005436 | Bacteria | 1445 |
| 37 | Ga0070713_100431606 | 3300005436 | Bacteria | 1235 |
| 38 | Ga0070710_10018665 | 3300005437 | Bacteria | 3572 |
| 39 | Ga0070701_10002635 | 3300005438 | Bacteria | 6955 |
| 40 | Ga0070711_100020315 | 3300005439 | Bacteria | 4278 |
| 41 | Ga0070711_100192704 | 3300005439 | Bacteria | 1568 |
| 42 | Ga0070705_100007265 | 3300005440 | Bacteria | 5449 |
| 43 | Ga0070700_100001464 | 3300005441 | Bacteria | 11741 |
| 44 | Ga0070700_100024118 | 3300005441 | Bacteria | 3568 |
| 45 | Ga0070700_100034190 | 3300005441 | Bacteria | 3068 |
| 46 | Ga0070708_100050171 | 3300005445 | Bacteria | 3694 |
| 47 | Ga0070708_100148724 | 3300005445 | Bacteria | 2177 |
| 48 | Ga0070708_100517404 | 3300005445 | Bacteria | 1126 |
| 49 | Ga0070663_100021691 | 3300005455 | Bacteria | 4277 |
| 50 | Ga0070678_100003980 | 3300005456 | Bacteria | 8309 |
| 51 | Ga0070662_100082204 | 3300005457 | Bacteria | 2402 |
| 52 | Ga0070662_100154635 | 3300005457 | Bacteria | 1789 |
| 53 | Ga0070681_10106059 | 3300005458 | Bacteria | 2752 |
| 54 | Ga0070681_10262226 | 3300005458 | Bacteria | 1640 |
| 55 | Ga0068867_100004544 | 3300005459 | Bacteria | 9755 |
| 56 | Ga0070685_10017675 | 3300005466 | Bacteria | 3821 |
| 57 | Ga0070706_100024233 | 3300005467 | Bacteria | 5585 |
| 58 | Ga0070707_100002173 | 3300005468 | Bacteria | 18762 |
| 59 | Ga0070707_100628145 | 3300005468 | Bacteria | 1037 |
| 60 | Ga0070698_100078488 | 3300005471 | Bacteria | 3300 |
| 61 | Ga0070679_100136309 | 3300005530 | Bacteria | 2435 |
| 62 | Ga0070679_100171567 | 3300005530 | Bacteria | 2142 |
| 63 | Ga0070679_100250837 | 3300005530 | Bacteria | 1726 |
| 64 | Ga0070684_100000343 | 3300005535 | Bacteria | 32061 |
| 65 | Ga0070684_100003310 | 3300005535 | Bacteria | 12072 |
| 66 | Ga0070684_100117256 | 3300005535 | Bacteria | 2392 |
| 67 | Ga0070684_100567177 | 3300005535 | Bacteria | 1054 |
| 68 | Ga0068853_100018457 | 3300005539 | Bacteria | 5774 |
| 69 | Ga0070672_100002647 | 3300005543 | Bacteria | 11435 |
| 70 | Ga0070686_100004104 | 3300005544 | Bacteria | 8016 |
| 71 | Ga0070695_100003524 | 3300005545 | Bacteria | 9137 |
| 72 | Ga0070696_100104388 | 3300005546 | Bacteria | 2035 |
| 73 | Ga0070665_100039518 | 3300005548 | Bacteria | 4744 |
| 74 | Ga0070704_100017189 | 3300005549 | Bacteria | 4592 |
| 75 | Ga0070704_100139053 | 3300005549 | Bacteria | 1893 |
| 76 | Ga0068855_100052105 | 3300005563 | Bacteria | 4818 |
| 77 | Ga0068855_100332579 | 3300005563 | Bacteria | 1677 |
| 78 | Ga0068855_100355476 | 3300005563 | Bacteria | 1613 |
| 79 | Ga0070664_100020201 | 3300005564 | Bacteria | 5484 |
| 80 | Ga0070664_100230582 | 3300005564 | Unclassified | 1660 |
| 81 | Ga0068857_100000539 | 3300005577 | Bacteria | 27448 |
| 82 | Ga0068854_100626521 | 3300005578 | Bacteria | 921 |
| 83 | Ga0068856_100000481 | 3300005614 | Bacteria | 44194 |
| 84 | Ga0068856_100000869 | 3300005614 | Bacteria | 32365 |
| 85 | Ga0068856_100049621 | 3300005614 | Bacteria | 4137 |
| 86 | Ga0068856_100217444 | 3300005614 | Bacteria | 1926 |
| 87 | Ga0068856_100572477 | 3300005614 | Bacteria | 1151 |
| 88 | Ga0070702_100004297 | 3300005615 | Bacteria | 6492 |
| 89 | Ga0068859_100058218 | 3300005617 | Bacteria | 3892 |
| 90 | Ga0068866_10002247 | 3300005718 | Bacteria | 8005 |
| 91 | Ga0068866_10146251 | 3300005718 | Bacteria | 1363 |
| 92 | Ga0068861_100030270 | 3300005719 | Bacteria | 3965 |
| 93 | Ga0068870_10128950 | 3300005840 | Bacteria | 1467 |
| 94 | Ga0068860_100219166 | 3300005843 | Bacteria | 1847 |
| 95 | Ga0068862_100694592 | 3300005844 | Bacteria | 985 |
| 96 | Ga0081455_10187681 | 3300005937 | Bacteria | 1560 |
| 97 | Ga0081455_10484823 | 3300005937 | Bacteria | 835 |
| 98 | Ga0081539_10012953 | 3300005985 | Bacteria | 6341 |
| 99 | Ga0081539_10022801 | 3300005985 | Bacteria | 4125 |
| 100 | Ga0081539_10039804 | 3300005985 | Bacteria | 2768 |
| 101 | Ga0070716_100109878 | 3300006173 | Bacteria | 1706 |
| 102 | Ga0070712_100024368 | 3300006175 | Bacteria | 4009 |
| 103 | Ga0070712_100033478 | 3300006175 | Bacteria | 3478 |
| 104 | Ga0070712_100367098 | 3300006175 | Unclassified | 1182 |
| 105 | Ga0097621_100003227 | 3300006237 | Bacteria | 11209 |
| 106 | Ga0068871_100009924 | 3300006358 | Bacteria | 6914 |
| 107 | Ga0068871_100199159 | 3300006358 | Bacteria | 1728 |
| 108 | Ga0075428_100088776 | 3300006844 | Bacteria | 3372 |
| 109 | Ga0075428_100235246 | 3300006844 | Bacteria | 1977 |
| 110 | Ga0075428_100384344 | 3300006844 | Bacteria | 1505 |
| 111 | Ga0075428_100534136 | 3300006844 | Bacteria | 1254 |
| 112 | Ga0075431_100249448 | 3300006847 | Bacteria | 1804 |
| 113 | Ga0075433_10113124 | 3300006852 | Unclassified | 2408 |
| 114 | Ga0075433_10431940 | 3300006852 | Bacteria | 1161 |
| 115 | Ga0068865_100003596 | 3300006881 | Bacteria | 9315 |
| 116 | Ga0075436_100247037 | 3300006914 | Bacteria | 1270 |
| 117 | Ga0097620_100058219 | 3300006931 | Bacteria | 3892 |
| 118 | Ga0105240_10108268 | 3300009093 | Bacteria | 3367 |
| 119 | Ga0105240_10237181 | 3300009093 | Bacteria | 2116 |
| 120 | Ga0105240_10884825 | 3300009093 | Bacteria | 962 |
| 121 | Ga0111539_10294854 | 3300009094 | Bacteria | 1887 |
| 122 | Ga0111539_10321969 | 3300009094 | Bacteria | 1799 |
| 123 | Ga0105245_10002706 | 3300009098 | Bacteria | 15955 |
| 124 | Ga0105245_10013004 | 3300009098 | Bacteria | 7255 |
| 125 | Ga0105245_10110304 | 3300009098 | Bacteria | 2558 |
| 126 | Ga0105245_10409471 | 3300009098 | Bacteria | 1357 |
| 127 | Ga0105247_10027554 | 3300009101 | Bacteria | 3435 |
| 128 | Ga0114129_10001640 | 3300009147 | Bacteria | 30409 |
| 129 | Ga0114129_10118114 | 3300009147 | Bacteria | 3653 |
| 130 | Ga0114129_10962047 | 3300009147 | Bacteria | 1078 |
| 131 | Ga0105243_10026764 | 3300009148 | Bacteria | 4416 |
| 132 | Ga0105243_10854127 | 3300009148 | Bacteria | 902 |
| 133 | Ga0105243_10862300 | 3300009148 | Bacteria | 898 |
| 134 | Ga0105241_10066855 | 3300009174 | Bacteria | 2781 |
| 135 | Ga0105242_10034141 | 3300009176 | Bacteria | 4078 |
| 136 | Ga0105242_10197568 | 3300009176 | Bacteria | 1784 |
| 137 | Ga0105242_10367142 | 3300009176 | Bacteria | 1334 |
| 138 | Ga0105242_11096819 | 3300009176 | Bacteria | 810 |
| 139 | Ga0105248_10023479 | 3300009177 | Bacteria | 6850 |
| 140 | Ga0105237_10118894 | 3300009545 | Bacteria | 2636 |
| 141 | Ga0105237_10178968 | 3300009545 | Bacteria | 2121 |
| 142 | Ga0105238_10060339 | 3300009551 | Bacteria | 3797 |
| 143 | Ga0105238_10128090 | 3300009551 | Bacteria | 2517 |
| 144 | Ga0105249_10032429 | 3300009553 | Bacteria | 4726 |
| 145 | Ga0105249_10325888 | 3300009553 | Bacteria | 1548 |
| 146 | Ga0105249_10530253 | 3300009553 | Bacteria | 1226 |
| 147 | Ga0105239_10014340 | 3300010375 | Bacteria | 8793 |
| 148 | Ga0105246_10019434 | 3300011119 | Bacteria | 4341 |
| 149 | Ga0105246_10495510 | 3300011119 | Bacteria | 1036 |
| 150 | Ga0157371_10153699 | 3300013102 | Bacteria | 1642 |
| 151 | Ga0157370_10001997 | 3300013104 | Bacteria | 25058 |
| 152 | Ga0157370_10085237 | 3300013104 | Bacteria | 2968 |
| 153 | Ga0157369_10003031 | 3300013105 | Bacteria | 20050 |
| 154 | Ga0157369_10024504 | 3300013105 | Bacteria | 6711 |
| 155 | Ga0157369_10529054 | 3300013105 | Bacteria | 1219 |
| 156 | Ga0157374_10081816 | 3300013296 | Bacteria | 3065 |
| 157 | Ga0157374_10104084 | 3300013296 | Bacteria | 2725 |
| 158 | Ga0157374_10211230 | 3300013296 | Bacteria | 1903 |
| 159 | Ga0157374_10825616 | 3300013296 | Bacteria | 943 |
| 160 | Ga0157378_10015506 | 3300013297 | Bacteria | 6676 |
| 161 | Ga0157378_10508139 | 3300013297 | Bacteria | 1205 |
| 162 | Ga0163162_10004499 | 3300013306 | Bacteria | 13428 |
| 163 | Ga0163162_10943460 | 3300013306 | Bacteria | 974 |
| 164 | Ga0157372_10032864 | 3300013307 | Bacteria | 5693 |
| 165 | Ga0157372_10187749 | 3300013307 | Bacteria | 2393 |
| 166 | Ga0157372_10190952 | 3300013307 | Bacteria | 2373 |
| 167 | Ga0157372_10605377 | 3300013307 | Bacteria | 1277 |
| 168 | Ga0157372_10855802 | 3300013307 | Bacteria | 1055 |
| 169 | Ga0157375_10003905 | 3300013308 | Bacteria | 12927 |
| 170 | Ga0157375_10009361 | 3300013308 | Bacteria | 8598 |
| 171 | Ga0157375_10017420 | 3300013308 | Bacteria | 6482 |
| 172 | Ga0157375_10636534 | 3300013308 | Bacteria | 1223 |
| 173 | Ga0163163_10276674 | 3300014325 | Bacteria | 1730 |
| 174 | Ga0163163_10283913 | 3300014325 | Bacteria | 1707 |
| 175 | Ga0163163_10460252 | 3300014325 | Bacteria | 1332 |
| 176 | Ga0157380_10008025 | 3300014326 | Bacteria | 7522 |
| 177 | Ga0157380_10033809 | 3300014326 | Bacteria | 3940 |
| 178 | Ga0157380_10431362 | 3300014326 | Bacteria | 1260 |
| 179 | Ga0157377_10014331 | 3300014745 | Bacteria | 4032 |
| 180 | Ga0157377_10021940 | 3300014745 | Bacteria | 3365 |
| 181 | Ga0157379_10296648 | 3300014968 | Bacteria | 1473 |
| 182 | Ga0157379_10412375 | 3300014968 | Bacteria | 1243 |
| 183 | Ga0157376_10005990 | 3300014969 | Bacteria | 8544 |
| 184 | Ga0157376_10059597 | 3300014969 | Bacteria | 3201 |
| 185 | Ga0206353_10324991 | 3300020082 | Bacteria | 3862 |
| 186 | Ga0213871_10061320 | 3300021441 | Bacteria | 1048 |
| 187 | Ga0207692_10008725 | 3300025898 | Bacteria | 4209 |
| 188 | Ga0207692_10293429 | 3300025898 | Bacteria | 987 |
| 189 | Ga0207642_10002169 | 3300025899 | Bacteria | 6084 |
| 190 | Ga0207642_10237361 | 3300025899 | Bacteria | 1027 |
| 191 | Ga0207710_10018665 | 3300025900 | Bacteria | 2952 |
| 192 | Ga0207680_10011715 | 3300025903 | Bacteria | 4441 |
| 193 | Ga0207685_10040989 | 3300025905 | Bacteria | 1730 |
| 194 | Ga0207645_10214609 | 3300025907 | Bacteria | 1268 |
| 195 | Ga0207643_10029657 | 3300025908 | Bacteria | 3044 |
| 196 | Ga0207684_10143280 | 3300025910 | Bacteria | 2055 |
| 197 | Ga0207654_10102059 | 3300025911 | Bacteria | 1769 |
| 198 | Ga0207707_10008757 | 3300025912 | Bacteria | 8781 |
| 199 | Ga0207707_10202976 | 3300025912 | Bacteria | 1728 |
| 200 | Ga0207695_10381430 | 3300025913 | Bacteria | 1295 |
| 201 | Ga0207671_10043189 | 3300025914 | Bacteria | 3333 |
| 202 | Ga0207671_10247611 | 3300025914 | Bacteria | 1401 |
| 203 | Ga0207693_10000312 | 3300025915 | Bacteria | 45237 |
| 204 | Ga0207693_10028891 | 3300025915 | Bacteria | 4382 |
| 205 | Ga0207693_10622946 | 3300025915 | Bacteria | 839 |
| 206 | Ga0207663_10030427 | 3300025916 | Bacteria | 3185 |
| 207 | Ga0207663_10253026 | 3300025916 | Bacteria | 1297 |
| 208 | Ga0207660_10026729 | 3300025917 | Bacteria | 3932 |
| 209 | Ga0207660_10033590 | 3300025917 | Bacteria | 3550 |
| 210 | Ga0207660_10045516 | 3300025917 | Bacteria | 3091 |
| 211 | Ga0207660_10117830 | 3300025917 | Bacteria | 2008 |
| 212 | Ga0207662_10054602 | 3300025918 | Bacteria | 2383 |
| 213 | Ga0207657_10019237 | 3300025919 | Bacteria | 6489 |
| 214 | Ga0207657_10027058 | 3300025919 | Bacteria | 5258 |
| 215 | Ga0207657_10037462 | 3300025919 | Bacteria | 4329 |
| 216 | Ga0207652_10003706 | 3300025921 | Bacteria | 12544 |
| 217 | Ga0207652_10059605 | 3300025921 | Bacteria | 3291 |
| 218 | Ga0207652_10066594 | 3300025921 | Bacteria | 3122 |
| 219 | Ga0207652_10551862 | 3300025921 | Unclassified | 1035 |
| 220 | Ga0207646_10013625 | 3300025922 | Bacteria | 7765 |
| 221 | Ga0207646_10167520 | 3300025922 | Bacteria | 1984 |
| 222 | Ga0207646_10544432 | 3300025922 | Bacteria | 1044 |
| 223 | Ga0207681_10093240 | 3300025923 | Bacteria | 2155 |
| 224 | Ga0207694_10300094 | 3300025924 | Bacteria | 1322 |
| 225 | Ga0207659_10158407 | 3300025926 | Bacteria | 1775 |
| 226 | Ga0207687_10021127 | 3300025927 | Bacteria | 4322 |
| 227 | Ga0207687_10062483 | 3300025927 | Bacteria | 2634 |
| 228 | Ga0207687_10199711 | 3300025927 | Bacteria | 1562 |
| 229 | Ga0207687_10277116 | 3300025927 | Bacteria | 1343 |
| 230 | Ga0207700_10008619 | 3300025928 | Bacteria | 6330 |
| 231 | Ga0207700_10217673 | 3300025928 | Bacteria | 1617 |
| 232 | Ga0207700_10376703 | 3300025928 | Bacteria | 1240 |
| 233 | Ga0207664_10135341 | 3300025929 | Bacteria | 2079 |
| 234 | Ga0207664_10166862 | 3300025929 | Bacteria | 1882 |
| 235 | Ga0207644_10168953 | 3300025931 | Bacteria | 1706 |
| 236 | Ga0207690_10034370 | 3300025932 | Bacteria | 3266 |
| 237 | Ga0207690_10200565 | 3300025932 | Bacteria | 1515 |
| 238 | Ga0207706_10166978 | 3300025933 | Bacteria | 1934 |
| 239 | Ga0207706_10232086 | 3300025933 | Bacteria | 1614 |
| 240 | Ga0207686_10011305 | 3300025934 | Bacteria | 4884 |
| 241 | Ga0207686_10317611 | 3300025934 | Bacteria | 1162 |
| 242 | Ga0207709_10005693 | 3300025935 | Bacteria | 7038 |
| 243 | Ga0207670_10378840 | 3300025936 | Bacteria | 1126 |
| 244 | Ga0207669_10006579 | 3300025937 | Bacteria | 5324 |
| 245 | Ga0207704_10010965 | 3300025938 | Bacteria | 4444 |
| 246 | Ga0207704_10525911 | 3300025938 | Bacteria | 957 |
| 247 | Ga0207665_10027047 | 3300025939 | Bacteria | 3789 |
| 248 | Ga0207691_10002913 | 3300025940 | Bacteria | 16701 |
| 249 | Ga0207711_10083649 | 3300025941 | Bacteria | 2792 |
| 250 | Ga0207689_10492884 | 3300025942 | Bacteria | 1026 |
| 251 | Ga0207661_10000061 | 3300025944 | Bacteria | 77364 |
| 252 | Ga0207661_10000505 | 3300025944 | Bacteria | 25193 |
| 253 | Ga0207661_10004887 | 3300025944 | Bacteria | 9392 |
| 254 | Ga0207679_10178870 | 3300025945 | Bacteria | 1753 |
| 255 | Ga0207667_10103060 | 3300025949 | Bacteria | 2943 |
| 256 | Ga0207667_10178030 | 3300025949 | Bacteria | 2184 |
| 257 | Ga0207667_10190083 | 3300025949 | Bacteria | 2107 |
| 258 | Ga0207651_10240042 | 3300025960 | Bacteria | 1476 |
| 259 | Ga0207712_10021204 | 3300025961 | Bacteria | 4263 |
| 260 | Ga0207712_10458499 | 3300025961 | Bacteria | 1082 |
| 261 | Ga0207668_10050215 | 3300025972 | Bacteria | 2873 |
| 262 | Ga0207677_10023963 | 3300026023 | Bacteria | 3781 |
| 263 | Ga0207677_10104088 | 3300026023 | Bacteria | 2097 |
| 264 | Ga0207703_10045607 | 3300026035 | Bacteria | 3527 |
| 265 | Ga0207703_10531255 | 3300026035 | Bacteria | 1107 |
| 266 | Ga0207639_10013938 | 3300026041 | Bacteria | 5640 |
| 267 | Ga0207678_10015938 | 3300026067 | Bacteria | 6601 |
| 268 | Ga0207678_10053171 | 3300026067 | Bacteria | 3491 |
| 269 | Ga0207678_10191060 | 3300026067 | Bacteria | 1750 |
| 270 | Ga0207708_10000811 | 3300026075 | Bacteria | 23480 |
| 271 | Ga0207708_10027208 | 3300026075 | Bacteria | 4329 |
| 272 | Ga0207708_10046186 | 3300026075 | Bacteria | 3317 |
| 273 | Ga0207708_10500107 | 3300026075 | Bacteria | 1019 |
| 274 | Ga0207708_11005945 | 3300026075 | Bacteria | 724 |
| 275 | Ga0207702_10009855 | 3300026078 | Bacteria | 8008 |
| 276 | Ga0207702_10009994 | 3300026078 | Bacteria | 7954 |
| 277 | Ga0207702_10073971 | 3300026078 | Bacteria | 2939 |
| 278 | Ga0207648_10000214 | 3300026089 | Bacteria | 62323 |
| 279 | Ga0207674_10000149 | 3300026116 | Bacteria | 82289 |
| 280 | Ga0207675_100018153 | 3300026118 | Bacteria | 6559 |
| 281 | Ga0207675_100020426 | 3300026118 | Bacteria | 6173 |
| 282 | Ga0207683_10003027 | 3300026121 | Bacteria | 14682 |
| 283 | Ga0207683_10008122 | 3300026121 | Bacteria | 8975 |
| 284 | Ga0207698_10083579 | 3300026142 | Bacteria | 2584 |
| 285 | Ga0207698_10485358 | 3300026142 | Bacteria | 1199 |
| 286 | Ga0268266_10117293 | 3300028379 | Bacteria | 2365 |
| 287 | Ga0268265_10085160 | 3300028380 | Bacteria | 2508 |
| 288 | Ga0268265_10636038 | 3300028380 | Bacteria | 1024 |
| 289 | Ga0268264_10079376 | 3300028381 | Bacteria | 2799 |
| 290 | Ga0265319_1001263 | 3300028563 | Bacteria | 15386 |
| 291 | Ga0265319_1046554 | 3300028563 | Unclassified | 1446 |
| 292 | Ga0265334_10006301 | 3300028573 | Bacteria | 5123 |
| 293 | Ga0265322_10005172 | 3300028654 | Bacteria | 3862 |
| 294 | Ga0265330_10000410 | 3300031235 | Bacteria | 29517 |
| 295 | Ga0265332_10016383 | 3300031238 | Bacteria | 3270 |
| 296 | Ga0265320_10006802 | 3300031240 | Bacteria | 7170 |
| 297 | Ga0265329_10001722 | 3300031242 | Bacteria | 10461 |
| 298 | Ga0265331_10035729 | 3300031250 | Bacteria | 2443 |
| 299 | Ga0265327_10005924 | 3300031251 | Bacteria | 9979 |
| 300 | Ga0265327_10110695 | 3300031251 | Bacteria | 1313 |
| 301 | Ga0307408_100199122 | 3300031548 | Bacteria | 1620 |
| 302 | Ga0307408_100451014 | 3300031548 | Bacteria | 1116 |
| 303 | Ga0265313_10004185 | 3300031595 | Bacteria | 11196 |
| 304 | Ga0265314_10013117 | 3300031711 | Bacteria | 6713 |
| 305 | Ga0307405_10015818 | 3300031731 | Bacteria | 4096 |
| 306 | Ga0307410_10338584 | 3300031852 | Bacteria | 1198 |
| 307 | Ga0307410_10635663 | 3300031852 | Bacteria | 894 |
| 308 | Ga0307406_10189504 | 3300031901 | Bacteria | 1504 |
| 309 | Ga0307407_10070018 | 3300031903 | Bacteria | 2084 |
| 310 | Ga0307412_10031336 | 3300031911 | Bacteria | 3358 |
| 311 | Ga0307409_100616376 | 3300031995 | Bacteria | 1074 |
| 312 | Ga0307409_100668944 | 3300031995 | Bacteria | 1034 |
| 313 | Ga0307416_100016773 | 3300032002 | Bacteria | 5103 |
| 314 | Ga0307411_10008423 | 3300032005 | Bacteria | 5342 |
| 315 | Ga0307415_100196864 | 3300032126 | Bacteria | 1595 |
| 316 | Ga0307415_100582809 | 3300032126 | Bacteria | 992 |
| 317 | Ga0373926_0033457 | 3300035083 | Bacteria | 1817 |
| 318 | Ga0373936_0030485 | 3300035113 | Bacteria | 2127 |
| 319 | Ga0373945_0026895 | 3300035116 | Bacteria | 2006 |
| 320 | Ga0373943_0000814 | 3300035170 | Bacteria | 13690 |
| 321 | Ga0373943_0026075 | 3300035170 | Bacteria | 2736 |
| 322 | Ga0373946_0027258 | 3300035171 | Bacteria | 2259 |
| 323 | Ga0373935_0029502 | 3300035692 | Bacteria | 3395 |
| 324 | Ga0373933_0420350 | 3300035724 | Bacteria | 873 |
| 325 | Ga0373947_0181182 | 3300035725 | Bacteria | 1371 |
| 326 | Ga0373937_0735575 | 3300036401 | Unclassified | 934 |
| 327 | Ga0373925_0016594 | 3300037068 | Bacteria | 5335 |
| 328 | Ga0373925_0087923 | 3300037068 | Bacteria | 2372 |
| 329 | Ga0373925_0123935 | 3300037068 | Bacteria | 2009 |
| 330 | Ga0395899_0031127 | 3300037312 | Bacteria | 4011 |
| 331 | Ga0395899_0052220 | 3300037312 | Bacteria | 3031 |
| 332 | Ga0395899_0057368 | 3300037312 | Bacteria | 2875 |
| 333 | Ga0395899_0124948 | 3300037312 | Bacteria | 1840 |
| 334 | Ga0395899_0132670 | 3300037312 | Bacteria | 1777 |
| 335 | Ga0395900_0002110 | 3300037418 | Bacteria | 22278 |
| 336 | Ga0395900_0002210 | 3300037418 | Bacteria | 21742 |
| 337 | Ga0395900_0025706 | 3300037418 | Bacteria | 6028 |
| 338 | Ga0395900_0044339 | 3300037418 | Bacteria | 4583 |
| 339 | Ga0395900_0062824 | 3300037418 | Bacteria | 3817 |
| 340 | Ga0395900_0078922 | 3300037418 | Bacteria | 3382 |
| 341 | Ga0395900_0136393 | 3300037418 | Bacteria | 2514 |
| 342 | Ga0395900_0353981 | 3300037418 | Bacteria | 1441 |
| 343 | Ga0395900_0385668 | 3300037418 | Bacteria | 1368 |
| 344 | Ga0395900_0674040 | 3300037418 | Bacteria | 969 |
| 345 | Ga0395898_0002238 | 3300037466 | Bacteria | 23529 |
| 346 | Ga0395898_0004044 | 3300037466 | Bacteria | 16131 |
| 347 | Ga0395898_0014865 | 3300037466 | Bacteria | 7990 |
| 348 | Ga0395898_0036788 | 3300037466 | Bacteria | 4859 |
| 349 | Ga0395898_0056293 | 3300037466 | Bacteria | 3833 |
| 350 | Ga0395898_0058188 | 3300037466 | Bacteria | 3764 |
| 351 | Ga0395898_0071250 | 3300037466 | Bacteria | 3359 |
| 352 | Ga0395898_0103314 | 3300037466 | Bacteria | 2734 |
| 353 | Ga0395898_0106911 | 3300037466 | Bacteria | 2683 |
| 354 | Ga0395898_0205487 | 3300037466 | Bacteria | 1879 |
| 355 | Ga0395898_0232570 | 3300037466 | Bacteria | 1758 |
| 356 | Ga0395898_0241455 | 3300037466 | Bacteria | 1723 |
| 357 | Ga0395898_0515439 | 3300037466 | Bacteria | 1137 |
| 358 | Ga0395905_0005593 | 3300037471 | Bacteria | 12803 |
| 359 | Ga0395905_0012371 | 3300037471 | Bacteria | 8215 |
| 360 | Ga0395905_0012571 | 3300037471 | Bacteria | 8142 |
| 361 | Ga0395905_0020067 | 3300037471 | Bacteria | 6333 |
| 362 | Ga0395905_0070059 | 3300037471 | Bacteria | 3285 |
| 363 | Ga0395905_0149660 | 3300037471 | Bacteria | 2196 |
| 364 | Ga0395905_0155349 | 3300037471 | Bacteria | 2152 |
| 365 | Ga0395905_0191422 | 3300037471 | Bacteria | 1919 |
| 366 | Ga0395905_0381653 | 3300037471 | Bacteria | 1303 |
| 367 | Ga0395905_0560122 | 3300037471 | Bacteria | 1044 |
| 368 | Ga0436364_0616029 | 3300037853 | Bacteria | 1741 |
| 369 | Ga0395901_0005034 | 3300038443 | Bacteria | 13340 |
| 370 | Ga0395901_0007541 | 3300038443 | Bacteria | 10989 |
| 371 | Ga0395901_0023726 | 3300038443 | Bacteria | 6290 |
| 372 | Ga0395901_0025538 | 3300038443 | Bacteria | 6066 |
| 373 | Ga0395901_0046606 | 3300038443 | Bacteria | 4503 |
| 374 | Ga0395901_0065219 | 3300038443 | Bacteria | 3791 |
| 375 | Ga0395901_0081986 | 3300038443 | Bacteria | 3369 |
| 376 | Ga0395901_0213835 | 3300038443 | Bacteria | 2017 |
| 377 | Ga0395901_0457497 | 3300038443 | Bacteria | 1304 |
| 378 | Ga0395901_0835912 | 3300038443 | Bacteria | 907 |
| 379 | Ga0436365_0131966 | 3300039437 | Bacteria | 1906 |
| 380 | Ga0436365_0243590 | 3300039437 | Bacteria | 928 |
| 381 | Ga0436360_1329465 | 3300039438 | Bacteria | 1284 |
| 382 | Ga0436363_0263983 | 3300039450 | Bacteria | 2250 |
| 383 | Ga0439466_0049302 | 3300041411 | Bacteria | 1383 |
| 384 | Ga0439446_0028139 | 3300042156 | Bacteria | 1617 |
| 385 | Ga0439434_0101020 | 3300042435 | Bacteria | 929 |
| 386 | Ga0466972_0112699 | 3300044658 | Unclassified | 1285 |
| 387 | Ga0466961_0014524 | 3300044693 | Bacteria | 5060 |
| 388 | Ga0466963_0033573 | 3300044694 | Bacteria | 3333 |
| 389 | Ga0466963_0048036 | 3300044694 | Bacteria | 2818 |
| 390 | Ga0466963_0349567 | 3300044694 | Bacteria | 1041 |
| 391 | Ga0466964_0000875 | 3300044706 | Bacteria | 9862 |
| 392 | Ga0466964_0011091 | 3300044706 | Bacteria | 3404 |
| 393 | Ga0466964_0111894 | 3300044706 | Bacteria | 1219 |
| 394 | Ga0466964_0114443 | 3300044706 | Bacteria | 1207 |
| 395 | Ga0466968_0001713 | 3300044735 | Bacteria | 7907 |
| 396 | Ga0466957_0015334 | 3300044842 | Bacteria | 4478 |
| 397 | Ga0466960_0012863 | 3300044901 | Bacteria | 3543 |
| 398 | Ga0466959_0023648 | 3300045049 | Bacteria | 4548 |
| 399 | Ga0466959_0207033 | 3300045049 | Bacteria | 1364 |
| 400 | Ga0451576_0454306 | 3300045051 | Bacteria | 1345 |
| 401 | Ga0466958_0055499 | 3300045836 | Bacteria | 2404 |
| 402 | Ga0466967_0014199 | 3300045976 | Bacteria | 6193 |
| 403 | Ga0466967_0025765 | 3300045976 | Bacteria | 4854 |
| 404 | Ga0466967_0084067 | 3300045976 | Bacteria | 2879 |
| 405 | Ga0466967_0169526 | 3300045976 | Bacteria | 2053 |
| 406 | Ga0466967_0183577 | 3300045976 | Bacteria | 1974 |
| 407 | Ga0466967_0594545 | 3300045976 | Bacteria | 1092 |
| 408 | Ga0466967_1026905 | 3300045976 | Bacteria | 821 |
| 409 | Ga0495603_0004117 | 3300046455 | Bacteria | 8663 |
| 410 | Ga0495629_0442861 | 3300046459 | Bacteria | 880 |
| 411 | Ga0495641_0014608 | 3300046461 | Bacteria | 4240 |
| 412 | Ga0495641_0249803 | 3300046461 | Bacteria | 797 |
| 413 | Ga0495651_0027567 | 3300046462 | Bacteria | 4425 |
| 414 | Ga0495653_0206885 | 3300046463 | Bacteria | 1328 |
| 415 | Ga0495582_0032696 | 3300046473 | Bacteria | 2859 |
| 416 | Ga0495605_0104145 | 3300046474 | Bacteria | 1301 |
| 417 | Ga0495639_0094856 | 3300046475 | Bacteria | 1403 |
| 418 | Ga0495662_0058664 | 3300046476 | Bacteria | 1859 |
| 419 | Ga0495596_0063826 | 3300046500 | Bacteria | 1433 |
| 420 | Ga0495608_0006067 | 3300046511 | Bacteria | 8582 |
| 421 | Ga0495608_0296138 | 3300046511 | Bacteria | 1002 |
| 422 | Ga0495630_0061973 | 3300046517 | Unclassified | 2810 |
| 423 | Ga0495630_0253347 | 3300046517 | Bacteria | 1345 |
| 424 | Ga0495631_0077851 | 3300046518 | Bacteria | 1431 |
| 425 | Ga0495644_0105816 | 3300046523 | Bacteria | 1066 |
| 426 | Ga0495663_0007027 | 3300046525 | Bacteria | 3107 |
| 427 | Ga0495665_0025053 | 3300046531 | Bacteria | 3206 |
| 428 | Ga0495640_0036963 | 3300046533 | Unclassified | 3448 |
| 429 | Ga0495586_0002968 | 3300046535 | Bacteria | 9142 |
| 430 | Ga0495587_0308476 | 3300046536 | Bacteria | 884 |
| 431 | Ga0495609_0055855 | 3300046538 | Bacteria | 1751 |
| 432 | Ga0495622_0259060 | 3300046557 | Bacteria | 764 |
| 433 | Ga0495667_0026672 | 3300046559 | Bacteria | 3893 |
| 434 | Ga0495656_0058688 | 3300046615 | Bacteria | 1671 |
| 435 | Ga0495659_0002949 | 3300046664 | Bacteria | 5464 |
| 436 | Ga0495661_0191352 | 3300046665 | Bacteria | 1077 |
| 437 | Ga0495588_0139492 | 3300046674 | Unclassified | 1280 |
| 438 | Ga0495657_0030558 | 3300046675 | Bacteria | 3771 |
| 439 | Ga0495658_0004265 | 3300046683 | Bacteria | 7036 |
| 440 | Ga0495658_0011187 | 3300046683 | Bacteria | 4505 |
| 441 | Ga0495658_0060531 | 3300046683 | Bacteria | 2172 |
| 442 | Ga0495658_0378902 | 3300046683 | Bacteria | 901 |
| 443 | Ga0495669_0144794 | 3300046684 | Bacteria | 1123 |
| 444 | Ga0495613_0145237 | 3300046689 | Bacteria | 1693 |
| 445 | Ga0495624_0145483 | 3300046690 | Bacteria | 1451 |
| 446 | Ga0495670_0132658 | 3300046691 | Bacteria | 1299 |
| 447 | Ga0495671_0087519 | 3300046692 | Bacteria | 1526 |
| 448 | Ga0495589_0060047 | 3300046794 | Bacteria | 1868 |
| 449 | Ga0495600_0030572 | 3300046809 | Bacteria | 3488 |
| 450 | Ga0495600_0243752 | 3300046809 | Bacteria | 1145 |
| 451 | Ga0495581_0009484 | 3300047315 | Bacteria | 5633 |
| 452 | Ga0495581_0022991 | 3300047315 | Bacteria | 3611 |
| 453 | Ga0495604_0055596 | 3300047317 | Bacteria | 3050 |
| 454 | Ga0495636_0122315 | 3300047318 | Bacteria | 1152 |
| 455 | Ga0495674_0068712 | 3300047319 | Unclassified | 3065 |
| 456 | Ga0495674_0086551 | 3300047319 | Bacteria | 2683 |
| 457 | Ga0495674_0244140 | 3300047319 | Bacteria | 1479 |
| 458 | Ga0495674_0434654 | 3300047319 | Bacteria | 1056 |
| 459 | Ga0495676_0021257 | 3300047321 | Bacteria | 5671 |
| 460 | Ga0495680_0122013 | 3300047322 | Bacteria | 1923 |
| 461 | Ga0495680_0282419 | 3300047322 | Bacteria | 1170 |
| 462 | Ga0495675_0163811 | 3300047444 | Bacteria | 1368 |
| 463 | Ga0495684_0614276 | 3300047471 | Bacteria | 732 |
| 464 | Ga0495593_0149464 | 3300047673 | Unclassified | 1182 |
| 465 | Ga0495602_0101939 | 3300048088 | Bacteria | 2353 |
| 466 | Ga0496100_0065883 | 3300048903 | Bacteria | 2402 |
| 467 | Ga0496100_0101946 | 3300048903 | Bacteria | 1979 |
| 468 | Ga0496100_0102946 | 3300048903 | Bacteria | 1971 |
| 469 | Ga0496100_0318920 | 3300048903 | Bacteria | 1167 |
| 470 | Ga0496101_0032147 | 3300048904 | Bacteria | 3691 |
| 471 | Ga0496101_0045916 | 3300048904 | Bacteria | 3131 |
| 472 | Ga0496101_0067463 | 3300048904 | Bacteria | 2612 |
| 473 | Ga0496101_0078937 | 3300048904 | Bacteria | 2429 |
| 474 | Ga0496101_0251410 | 3300048904 | Bacteria | 1377 |
| 475 | Ga0496102_0007349 | 3300048905 | Bacteria | 9410 |
| 476 | Ga0496102_0011604 | 3300048905 | Bacteria | 7603 |
| 477 | Ga0496102_0014734 | 3300048905 | Bacteria | 6797 |
| 478 | Ga0496102_0067224 | 3300048905 | Bacteria | 3287 |
| 479 | Ga0496102_0102019 | 3300048905 | Bacteria | 2667 |
| 480 | Ga0496103_0008781 | 3300048906 | Bacteria | 5995 |
| 481 | Ga0496103_0054418 | 3300048906 | Bacteria | 2480 |
| 482 | Ga0496103_0107421 | 3300048906 | Bacteria | 1770 |
| 483 | Ga0496103_0201480 | 3300048906 | Bacteria | 1280 |
| 484 | Ga0496104_0020574 | 3300048907 | Bacteria | 6050 |
| 485 | Ga0496104_0036555 | 3300048907 | Bacteria | 4592 |
| 486 | Ga0496104_0042619 | 3300048907 | Bacteria | 4260 |
| 487 | Ga0496104_0226077 | 3300048907 | Bacteria | 1783 |
| 488 | Ga0496104_0247387 | 3300048907 | Bacteria | 1696 |
| 489 | Ga0496104_0275142 | 3300048907 | Bacteria | 1596 |
| 490 | Ga0496105_0268375 | 3300048908 | Bacteria | 1379 |
| 491 | Ga0496106_0006374 | 3300048909 | Bacteria | 8735 |
| 492 | Ga0496106_0632351 | 3300048909 | Bacteria | 856 |
| 493 | Ga0496106_0662335 | 3300048909 | Bacteria | 834 |
| 494 | Ga0496107_0040302 | 3300048910 | Bacteria | 3352 |
| 495 | Ga0496107_0103211 | 3300048910 | Bacteria | 2092 |
| 496 | Ga0496107_0121244 | 3300048910 | Bacteria | 1927 |
| 497 | Ga0496108_0000999 | 3300048911 | Bacteria | 22085 |
| 498 | Ga0496108_0002937 | 3300048911 | Bacteria | 13708 |
| 499 | Ga0496108_0750189 | 3300048911 | Bacteria | 844 |
| 500 | Ga0496109_0002225 | 3300048912 | Bacteria | 16101 |
| 501 | Ga0496109_0003779 | 3300048912 | Bacteria | 12640 |
| 502 | Ga0496109_0012663 | 3300048912 | Bacteria | 7286 |
| 503 | Ga0496109_0162960 | 3300048912 | Bacteria | 2089 |
| 504 | Ga0496109_0201979 | 3300048912 | Bacteria | 1869 |
| 505 | Ga0496110_0010416 | 3300048913 | Bacteria | 7559 |
| 506 | Ga0496110_0041585 | 3300048913 | Bacteria | 4011 |
| 507 | Ga0496110_0099938 | 3300048913 | Bacteria | 2600 |
| 508 | Ga0496110_0342674 | 3300048913 | Bacteria | 1361 |
| 509 | Ga0496110_0346829 | 3300048913 | Bacteria | 1353 |
| 510 | Ga0496111_0009333 | 3300048914 | Bacteria | 6541 |
| 511 | Ga0496111_0022832 | 3300048914 | Bacteria | 4384 |
| 512 | Ga0496111_0030725 | 3300048914 | Bacteria | 3821 |
| 513 | Ga0496111_0067215 | 3300048914 | Bacteria | 2604 |
| 514 | Ga0496111_0312689 | 3300048914 | Bacteria | 1164 |
| 515 | Ga0496112_0005069 | 3300048915 | Bacteria | 11319 |
| 516 | Ga0496112_0016674 | 3300048915 | Bacteria | 6888 |
| 517 | Ga0496112_0032966 | 3300048915 | Bacteria | 5031 |
| 518 | Ga0496112_0038875 | 3300048915 | Bacteria | 4648 |
| 519 | Ga0496112_0089904 | 3300048915 | Bacteria | 3039 |
| 520 | Ga0496112_0093485 | 3300048915 | Bacteria | 2977 |
| 521 | Ga0496112_0130039 | 3300048915 | Bacteria | 2489 |
| 522 | Ga0496112_0175296 | 3300048915 | Bacteria | 2109 |
| 523 | Ga0496113_0087848 | 3300048916 | Bacteria | 2391 |
| 524 | Ga0496113_0095693 | 3300048916 | Bacteria | 2295 |
| 525 | Ga0496113_0121291 | 3300048916 | Bacteria | 2044 |
| 526 | Ga0496114_0000264 | 3300048917 | Bacteria | 38127 |
| 527 | Ga0496114_0005659 | 3300048917 | Bacteria | 9797 |
| 528 | Ga0496114_0206432 | 3300048917 | Bacteria | 1722 |
| 529 | Ga0496114_0245446 | 3300048917 | Bacteria | 1575 |
| 530 | Ga0496115_0003038 | 3300048918 | Bacteria | 12054 |
| 531 | Ga0496115_0007416 | 3300048918 | Bacteria | 8069 |
| 532 | Ga0496115_0489616 | 3300048918 | Bacteria | 989 |
| 533 | Ga0496115_0656011 | 3300048918 | Bacteria | 829 |
| 534 | Ga0501036_0859240 | 3300049572 | Bacteria | 746 |
| 535 | Ga0501042_0201784 | 3300049578 | Bacteria | 1434 |
| 536 | Ga0501047_0161809 | 3300049581 | Bacteria | 2110 |
| 537 | Ga0501067_0031012 | 3300049583 | Bacteria | 2966 |
| 538 | Ga0501067_0275471 | 3300049583 | Bacteria | 937 |
| 539 | Ga0501069_0012076 | 3300049585 | Bacteria | 4587 |
| 540 | Ga0501070_0035888 | 3300049586 | Bacteria | 4140 |
| 541 | Ga0501070_0238318 | 3300049586 | Bacteria | 1489 |
| 542 | Ga0501070_0259660 | 3300049586 | Bacteria | 1420 |
| 543 | Ga0501072_0476754 | 3300049588 | Bacteria | 987 |
| 544 | Ga0501072_0750547 | 3300049588 | Bacteria | 766 |
| 545 | Ga0501074_0131729 | 3300049590 | Bacteria | 1788 |
| 546 | Ga0501199_008104 | 3300049650 | Unclassified | 1095 |
| 547 | Ga0501079_0569649 | 3300049741 | Bacteria | 891 |
| 548 | Ga0501080_0177577 | 3300049742 | Bacteria | 1961 |
| 549 | Ga0501080_0225177 | 3300049742 | Bacteria | 1715 |
| 550 | Ga0501080_0448994 | 3300049742 | Bacteria | 1156 |
| 551 | Ga0501081_0566238 | 3300049743 | Bacteria | 849 |
| 552 | Ga0501044_0104577 | 3300049823 | Bacteria | 2845 |
| 553 | Ga0501045_0158991 | 3300049824 | Bacteria | 1682 |
| 554 | nmdc:mga03683_173338_c1 | 3300050489 | Bacteria | 981 |
| 555 | nmdc:mga05p37_218266_c1 | 3300050507 | Bacteria | 2302 |
| 556 | nmdc:mga05p37_2465_c1 | 3300050507 | Bacteria | 21530 |
| 557 | nmdc:mga05p37_33557_c1 | 3300050507 | Bacteria | 2292 |
| 558 | nmdc:mga09592_302191_c1 | 3300050508 | Bacteria | 1387 |
| 559 | nmdc:mga08y16_849082_c1 | 3300050511 | Bacteria | 902 |
| 560 | nmdc:mga0n895_676522_c1 | 3300050512 | Bacteria | 1029 |
| 561 | nmdc:mga0rr50_157181_c1 | 3300050513 | Bacteria | 1842 |
| 562 | nmdc:mga0a205_142414_c1 | 3300050515 | Bacteria | 2297 |
| 563 | Ga0495601_0025071 | 3300053077 | Unclassified | 3676 |
| 564 | Ga0495601_0062192 | 3300053077 | Bacteria | 2371 |
| 565 | Ga0495612_0077209 | 3300053078 | Unclassified | 1395 |
| 566 | Ga0495595_0210647 | 3300053084 | Bacteria | 969 |
| 567 | Ga0495619_0029705 | 3300053085 | Bacteria | 3533 |
| 568 | Ga0495619_0046116 | 3300053085 | Bacteria | 2865 |
| 569 | Ga0590075_017661 | 3300059424 | Bacteria | 1760 |
| 570 | Ga0501082_0768230 | 3300060353 | Bacteria | 843 |
| 571 | Ga0530510_0002898 | 3300061734 | Bacteria | 11760 |
| 572 | Ga0530510_0247323 | 3300061734 | Bacteria | 1328 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049650 | Ga0501199_008104 | Ga0501199_008104_132_797 | 214 |
| 2 | 3300048909 | Ga0496106_0632351 | Ga0496106_0632351_68_736 | 217 |
| 3 | 3300048911 | Ga0496108_0002937 | Ga0496108_0002937_2759_3427 | 217 |
| 4 | 3300048912 | Ga0496109_0002225 | Ga0496109_0002225_8176_8844 | 217 |
| 5 | 3300048914 | Ga0496111_0009333 | Ga0496111_0009333_2373_3041 | 217 |
| 6 | 3300048917 | Ga0496114_0245446 | Ga0496114_0245446_773_1441 | 217 |
| 7 | 3300005458 | Ga0070681_10262226 | Ga0070681_102622262 | 218 |
| 8 | 3300009093 | Ga0105240_10884825 | Ga0105240_108848252 | 218 |
| 9 | 3300013307 | Ga0157372_10855802 | Ga0157372_108558022 | 218 |
| 10 | 3300020082 | Ga0206353_10324991 | Ga0206353_103249913 | 218 |
| 11 | 3300025917 | Ga0207660_10033590 | Ga0207660_100335902 | 218 |
| 12 | 3300025921 | Ga0207652_10059605 | Ga0207652_100596053 | 218 |
| 13 | 3300005329 | Ga0070683_100000102 | Ga0070683_10000010242 | 220 |
| 14 | 3300005329 | Ga0070683_100166084 | Ga0070683_1001660841 | 220 |
| 15 | 3300005336 | Ga0070680_100079101 | Ga0070680_1000791011 | 220 |
| 16 | 3300005337 | Ga0070682_100456355 | Ga0070682_1004563551 | 220 |
| 17 | 3300005341 | Ga0070691_10036355 | Ga0070691_100363552 | 220 |
| 18 | 3300005435 | Ga0070714_100004896 | Ga0070714_1000048966 | 220 |
| 19 | 3300005436 | Ga0070713_100000372 | Ga0070713_1000003726 | 220 |
| 20 | 3300005439 | Ga0070711_100192704 | Ga0070711_1001927041 | 220 |
| 21 | 3300005530 | Ga0070679_100171567 | Ga0070679_1001715672 | 220 |
| 22 | 3300005535 | Ga0070684_100000343 | Ga0070684_10000034312 | 220 |
| 23 | 3300005564 | Ga0070664_100230582 | Ga0070664_1002305822 | 220 |
| 24 | 3300005577 | Ga0068857_100000539 | Ga0068857_1000005398 | 220 |
| 25 | 3300005614 | Ga0068856_100000481 | Ga0068856_10000048134 | 220 |
| 26 | 3300009551 | Ga0105238_10128090 | Ga0105238_101280902 | 220 |
| 27 | 3300009553 | Ga0105249_10325888 | Ga0105249_103258882 | 220 |
| 28 | 3300013105 | Ga0157369_10003031 | Ga0157369_100030311 | 220 |
| 29 | 3300013307 | Ga0157372_10190952 | Ga0157372_101909523 | 220 |
| 30 | 3300013307 | Ga0157372_10605377 | Ga0157372_106053771 | 220 |
| 31 | 3300025912 | Ga0207707_10202976 | Ga0207707_102029761 | 220 |
| 32 | 3300025917 | Ga0207660_10117830 | Ga0207660_101178302 | 220 |
| 33 | 3300025928 | Ga0207700_10008619 | Ga0207700_100086196 | 220 |
| 34 | 3300025944 | Ga0207661_10000061 | Ga0207661_1000006112 | 220 |
| 35 | 3300025944 | Ga0207661_10004887 | Ga0207661_100048874 | 220 |
| 36 | 3300025945 | Ga0207679_10178870 | Ga0207679_101788702 | 220 |
| 37 | 3300026078 | Ga0207702_10009994 | Ga0207702_100099942 | 220 |
| 38 | 3300026116 | Ga0207674_10000149 | Ga0207674_1000014966 | 220 |
| 39 | 3300036401 | Ga0373937_0735575 | Ga0373937_0735575_17_754 | 220 |
| 40 | 3300047319 | Ga0495674_0086551 | Ga0495674_0086551_1355_2125 | 220 |
| 41 | 3300049588 | Ga0501072_0476754 | Ga0501072_0476754_195_908 | 220 |
| 42 | 3300053077 | Ga0495601_0025071 | Ga0495601_0025071_1392_2084 | 220 |
| 43 | 3300053078 | Ga0495612_0077209 | Ga0495612_0077209_641_1333 | 220 |
| 44 | 3300053085 | Ga0495619_0046116 | Ga0495619_0046116_773_1543 | 220 |
| 45 | 3300060353 | Ga0501082_0768230 | Ga0501082_0768230_23_736 | 220 |
| 46 | 3300061734 | Ga0530510_0002898 | Ga0530510_0002898_4921_5634 | 220 |
| 47 | 3300044693 | Ga0466961_0014524 | Ga0466961_0014524_3516_4235 | 221 |
| 48 | 3300044735 | Ga0466968_0001713 | Ga0466968_0001713_1628_2347 | 221 |
| 49 | 3300045049 | Ga0466959_0023648 | Ga0466959_0023648_995_1714 | 221 |
| 50 | 3300005339 | Ga0070660_100025946 | Ga0070660_1000259463 | 222 |
| 51 | 3300005435 | Ga0070714_100121607 | Ga0070714_1001216072 | 222 |
| 52 | 3300005530 | Ga0070679_100136309 | Ga0070679_1001363092 | 222 |
| 53 | 3300005530 | Ga0070679_100250837 | Ga0070679_1002508372 | 222 |
| 54 | 3300005535 | Ga0070684_100567177 | Ga0070684_1005671772 | 222 |
| 55 | 3300005563 | Ga0068855_100052105 | Ga0068855_1000521052 | 222 |
| 56 | 3300005937 | Ga0081455_10187681 | Ga0081455_101876812 | 222 |
| 57 | 3300006852 | Ga0075433_10113124 | Ga0075433_101131242 | 222 |
| 58 | 3300009093 | Ga0105240_10108268 | Ga0105240_101082682 | 222 |
| 59 | 3300009147 | Ga0114129_10962047 | Ga0114129_109620471 | 222 |
| 60 | 3300013104 | Ga0157370_10085237 | Ga0157370_100852372 | 222 |
| 61 | 3300013105 | Ga0157369_10529054 | Ga0157369_105290542 | 222 |
| 62 | 3300013296 | Ga0157374_10825616 | Ga0157374_108256162 | 222 |
| 63 | 3300013307 | Ga0157372_10032864 | Ga0157372_100328642 | 222 |
| 64 | 3300021441 | Ga0213871_10061320 | Ga0213871_100613202 | 222 |
| 65 | 3300025913 | Ga0207695_10381430 | Ga0207695_103814302 | 222 |
| 66 | 3300025915 | Ga0207693_10622946 | Ga0207693_106229462 | 222 |
| 67 | 3300025916 | Ga0207663_10253026 | Ga0207663_102530262 | 222 |
| 68 | 3300025919 | Ga0207657_10037462 | Ga0207657_100374622 | 222 |
| 69 | 3300025921 | Ga0207652_10066594 | Ga0207652_100665941 | 222 |
| 70 | 3300025929 | Ga0207664_10135341 | Ga0207664_101353412 | 222 |
| 71 | 3300025929 | Ga0207664_10166862 | Ga0207664_101668622 | 222 |
| 72 | 3300025932 | Ga0207690_10200565 | Ga0207690_102005652 | 222 |
| 73 | 3300025949 | Ga0207667_10178030 | Ga0207667_101780302 | 222 |
| 74 | 3300026075 | Ga0207708_11005945 | Ga0207708_110059451 | 222 |
| 75 | 3300028563 | Ga0265319_1001263 | Ga0265319_10012638 | 222 |
| 76 | 3300028563 | Ga0265319_1046554 | Ga0265319_10465542 | 222 |
| 77 | 3300028573 | Ga0265334_10006301 | Ga0265334_100063014 | 222 |
| 78 | 3300028654 | Ga0265322_10005172 | Ga0265322_100051722 | 222 |
| 79 | 3300031235 | Ga0265330_10000410 | Ga0265330_1000041011 | 222 |
| 80 | 3300031238 | Ga0265332_10016383 | Ga0265332_100163832 | 222 |
| 81 | 3300031240 | Ga0265320_10006802 | Ga0265320_100068024 | 222 |
| 82 | 3300031242 | Ga0265329_10001722 | Ga0265329_1000172210 | 222 |
| 83 | 3300031250 | Ga0265331_10035729 | Ga0265331_100357292 | 222 |
| 84 | 3300031251 | Ga0265327_10005924 | Ga0265327_100059246 | 222 |
| 85 | 3300031251 | Ga0265327_10110695 | Ga0265327_101106951 | 222 |
| 86 | 3300031595 | Ga0265313_10004185 | Ga0265313_100041854 | 222 |
| 87 | 3300031711 | Ga0265314_10013117 | Ga0265314_100131176 | 222 |
| 88 | 3300031995 | Ga0307409_100668944 | Ga0307409_1006689442 | 222 |
| 89 | 3300032002 | Ga0307416_100016773 | Ga0307416_1000167734 | 222 |
| 90 | 3300032126 | Ga0307415_100196864 | Ga0307415_1001968642 | 222 |
| 91 | 3300035083 | Ga0373926_0033457 | Ga0373926_0033457_315_986 | 222 |
| 92 | 3300035113 | Ga0373936_0030485 | Ga0373936_0030485_1043_1765 | 222 |
| 93 | 3300035116 | Ga0373945_0026895 | Ga0373945_0026895_1239_1961 | 222 |
| 94 | 3300035170 | Ga0373943_0000814 | Ga0373943_0000814_9119_9841 | 222 |
| 95 | 3300035170 | Ga0373943_0026075 | Ga0373943_0026075_345_1016 | 222 |
| 96 | 3300035171 | Ga0373946_0027258 | Ga0373946_0027258_621_1343 | 222 |
| 97 | 3300035692 | Ga0373935_0029502 | Ga0373935_0029502_964_1686 | 222 |
| 98 | 3300035725 | Ga0373947_0181182 | Ga0373947_0181182_531_1253 | 222 |
| 99 | 3300037068 | Ga0373925_0016594 | Ga0373925_0016594_1086_1757 | 222 |
| 100 | 3300037068 | Ga0373925_0087923 | Ga0373925_0087923_675_1397 | 222 |
| 101 | 3300037418 | Ga0395900_0136393 | Ga0395900_0136393_483_1154 | 222 |
| 102 | 3300037418 | Ga0395900_0385668 | Ga0395900_0385668_309_980 | 222 |
| 103 | 3300037418 | Ga0395900_0674040 | Ga0395900_0674040_74_754 | 222 |
| 104 | 3300037471 | Ga0395905_0155349 | Ga0395905_0155349_536_1207 | 222 |
| 105 | 3300037471 | Ga0395905_0191422 | Ga0395905_0191422_438_1109 | 222 |
| 106 | 3300037853 | Ga0436364_0616029 | Ga0436364_0616029_340_1029 | 222 |
| 107 | 3300038443 | Ga0395901_0007541 | Ga0395901_0007541_8691_9407 | 222 |
| 108 | 3300039438 | Ga0436360_1329465 | Ga0436360_1329465_595_1266 | 222 |
| 109 | 3300039450 | Ga0436363_0263983 | Ga0436363_0263983_451_1281 | 222 |
| 110 | 3300044694 | Ga0466963_0033573 | Ga0466963_0033573_1312_1983 | 222 |
| 111 | 3300044694 | Ga0466963_0048036 | Ga0466963_0048036_1894_2571 | 222 |
| 112 | 3300044694 | Ga0466963_0349567 | Ga0466963_0349567_352_1023 | 222 |
| 113 | 3300044706 | Ga0466964_0000875 | Ga0466964_0000875_4904_5644 | 222 |
| 114 | 3300044842 | Ga0466957_0015334 | Ga0466957_0015334_373_1050 | 222 |
| 115 | 3300045051 | Ga0451576_0454306 | Ga0451576_0454306_166_837 | 222 |
| 116 | 3300045836 | Ga0466958_0055499 | Ga0466958_0055499_420_1091 | 222 |
| 117 | 3300045976 | Ga0466967_0014199 | Ga0466967_0014199_4852_5523 | 222 |
| 118 | 3300045976 | Ga0466967_0025765 | Ga0466967_0025765_1110_1787 | 222 |
| 119 | 3300045976 | Ga0466967_0084067 | Ga0466967_0084067_1710_2450 | 222 |
| 120 | 3300045976 | Ga0466967_0183577 | Ga0466967_0183577_448_1119 | 222 |
| 121 | 3300045976 | Ga0466967_1026905 | Ga0466967_1026905_35_706 | 222 |
| 122 | 3300046459 | Ga0495629_0442861 | Ga0495629_0442861_164_835 | 222 |
| 123 | 3300046461 | Ga0495641_0014608 | Ga0495641_0014608_2394_3074 | 222 |
| 124 | 3300046461 | Ga0495641_0249803 | Ga0495641_0249803_14_685 | 222 |
| 125 | 3300046517 | Ga0495630_0061973 | Ga0495630_0061973_1977_2762 | 222 |
| 126 | 3300046517 | Ga0495630_0253347 | Ga0495630_0253347_198_869 | 222 |
| 127 | 3300046533 | Ga0495640_0036963 | Ga0495640_0036963_283_1068 | 222 |
| 128 | 3300046535 | Ga0495586_0002968 | Ga0495586_0002968_4784_5455 | 222 |
| 129 | 3300046557 | Ga0495622_0259060 | Ga0495622_0259060_70_741 | 222 |
| 130 | 3300046683 | Ga0495658_0011187 | Ga0495658_0011187_205_927 | 222 |
| 131 | 3300046683 | Ga0495658_0060531 | Ga0495658_0060531_350_1021 | 222 |
| 132 | 3300046689 | Ga0495613_0145237 | Ga0495613_0145237_651_1322 | 222 |
| 133 | 3300046809 | Ga0495600_0243752 | Ga0495600_0243752_436_1107 | 222 |
| 134 | 3300047319 | Ga0495674_0068712 | Ga0495674_0068712_191_976 | 222 |
| 135 | 3300047471 | Ga0495684_0614276 | Ga0495684_0614276_30_701 | 222 |
| 136 | 3300048907 | Ga0496104_0247387 | Ga0496104_0247387_215_886 | 222 |
| 137 | 3300048908 | Ga0496105_0268375 | Ga0496105_0268375_637_1308 | 222 |
| 138 | 3300048910 | Ga0496107_0121244 | Ga0496107_0121244_413_1102 | 222 |
| 139 | 3300048912 | Ga0496109_0201979 | Ga0496109_0201979_926_1597 | 222 |
| 140 | 3300048914 | Ga0496111_0312689 | Ga0496111_0312689_267_947 | 222 |
| 141 | 3300048915 | Ga0496112_0038875 | Ga0496112_0038875_589_1278 | 222 |
| 142 | 3300048915 | Ga0496112_0130039 | Ga0496112_0130039_706_1377 | 222 |
| 143 | 3300048918 | Ga0496115_0489616 | Ga0496115_0489616_148_819 | 222 |
| 144 | 3300048918 | Ga0496115_0656011 | Ga0496115_0656011_82_753 | 222 |
| 145 | 3300049572 | Ga0501036_0859240 | Ga0501036_0859240_32_703 | 222 |
| 146 | 3300049581 | Ga0501047_0161809 | Ga0501047_0161809_674_1345 | 222 |
| 147 | 3300049583 | Ga0501067_0031012 | Ga0501067_0031012_954_1694 | 222 |
| 148 | 3300049585 | Ga0501069_0012076 | Ga0501069_0012076_3074_3814 | 222 |
| 149 | 3300049586 | Ga0501070_0035888 | Ga0501070_0035888_3267_3938 | 222 |
| 150 | 3300049586 | Ga0501070_0238318 | Ga0501070_0238318_95_808 | 222 |
| 151 | 3300049586 | Ga0501070_0259660 | Ga0501070_0259660_298_1014 | 222 |
| 152 | 3300049588 | Ga0501072_0750547 | Ga0501072_0750547_50_721 | 222 |
| 153 | 3300049590 | Ga0501074_0131729 | Ga0501074_0131729_745_1461 | 222 |
| 154 | 3300049741 | Ga0501079_0569649 | Ga0501079_0569649_29_700 | 222 |
| 155 | 3300049742 | Ga0501080_0177577 | Ga0501080_0177577_652_1323 | 222 |
| 156 | 3300049742 | Ga0501080_0225177 | Ga0501080_0225177_174_890 | 222 |
| 157 | 3300049742 | Ga0501080_0448994 | Ga0501080_0448994_129_845 | 222 |
| 158 | 3300049743 | Ga0501081_0566238 | Ga0501081_0566238_38_778 | 222 |
| 159 | 3300049823 | Ga0501044_0104577 | Ga0501044_0104577_2079_2750 | 222 |
| 160 | 3300049824 | Ga0501045_0158991 | Ga0501045_0158991_370_1041 | 222 |
| 161 | 3300050515 | nmdc:mga0a205_142414_c1 | nmdc:mga0a205_142414_c1_188_859 | 222 |
| 162 | 3300061734 | Ga0530510_0247323 | Ga0530510_0247323_234_974 | 222 |
| 163 | 3300005327 | Ga0070658_10395646 | Ga0070658_103956462 | 223 |
| 164 | 3300005328 | Ga0070676_10158162 | Ga0070676_101581622 | 223 |
| 165 | 3300005329 | Ga0070683_100056637 | Ga0070683_1000566372 | 223 |
| 166 | 3300005334 | Ga0068869_100229252 | Ga0068869_1002292521 | 223 |
| 167 | 3300005337 | Ga0070682_100028092 | Ga0070682_1000280923 | 223 |
| 168 | 3300005338 | Ga0068868_100045859 | Ga0068868_1000458593 | 223 |
| 169 | 3300005339 | Ga0070660_100022699 | Ga0070660_1000226992 | 223 |
| 170 | 3300005340 | Ga0070689_100041320 | Ga0070689_1000413204 | 223 |
| 171 | 3300005340 | Ga0070689_100183867 | Ga0070689_1001838672 | 223 |
| 172 | 3300005341 | Ga0070691_10010478 | Ga0070691_100104783 | 223 |
| 173 | 3300005343 | Ga0070687_100068130 | Ga0070687_1000681303 | 223 |
| 174 | 3300005344 | Ga0070661_100219155 | Ga0070661_1002191551 | 223 |
| 175 | 3300005345 | Ga0070692_10070294 | Ga0070692_100702942 | 223 |
| 176 | 3300005347 | Ga0070668_100017596 | Ga0070668_1000175966 | 223 |
| 177 | 3300005347 | Ga0070668_100241972 | Ga0070668_1002419722 | 223 |
| 178 | 3300005353 | Ga0070669_100494403 | Ga0070669_1004944032 | 223 |
| 179 | 3300005355 | Ga0070671_100031777 | Ga0070671_1000317772 | 223 |
| 180 | 3300005356 | Ga0070674_100032437 | Ga0070674_1000324372 | 223 |
| 181 | 3300005364 | Ga0070673_100138724 | Ga0070673_1001387242 | 223 |
| 182 | 3300005365 | Ga0070688_100002134 | Ga0070688_1000021342 | 223 |
| 183 | 3300005366 | Ga0070659_100033906 | Ga0070659_1000339062 | 223 |
| 184 | 3300005434 | Ga0070709_10009902 | Ga0070709_100099023 | 223 |
| 185 | 3300005434 | Ga0070709_10352334 | Ga0070709_103523341 | 223 |
| 186 | 3300005435 | Ga0070714_100163225 | Ga0070714_1001632253 | 223 |
| 187 | 3300005436 | Ga0070713_100106361 | Ga0070713_1001063613 | 223 |
| 188 | 3300005436 | Ga0070713_100298997 | Ga0070713_1002989972 | 223 |
| 189 | 3300005436 | Ga0070713_100314459 | Ga0070713_1003144592 | 223 |
| 190 | 3300005436 | Ga0070713_100431606 | Ga0070713_1004316062 | 223 |
| 191 | 3300005437 | Ga0070710_10018665 | Ga0070710_100186652 | 223 |
| 192 | 3300005438 | Ga0070701_10002635 | Ga0070701_100026355 | 223 |
| 193 | 3300005439 | Ga0070711_100020315 | Ga0070711_1000203153 | 223 |
| 194 | 3300005440 | Ga0070705_100007265 | Ga0070705_1000072651 | 223 |
| 195 | 3300005441 | Ga0070700_100001464 | Ga0070700_1000014642 | 223 |
| 196 | 3300005441 | Ga0070700_100024118 | Ga0070700_1000241183 | 223 |
| 197 | 3300005441 | Ga0070700_100034190 | Ga0070700_1000341903 | 223 |
| 198 | 3300005445 | Ga0070708_100050171 | Ga0070708_1000501712 | 223 |
| 199 | 3300005445 | Ga0070708_100148724 | Ga0070708_1001487241 | 223 |
| 200 | 3300005445 | Ga0070708_100517404 | Ga0070708_1005174042 | 223 |
| 201 | 3300005455 | Ga0070663_100021691 | Ga0070663_1000216915 | 223 |
| 202 | 3300005456 | Ga0070678_100003980 | Ga0070678_1000039803 | 223 |
| 203 | 3300005457 | Ga0070662_100082204 | Ga0070662_1000822041 | 223 |
| 204 | 3300005457 | Ga0070662_100154635 | Ga0070662_1001546351 | 223 |
| 205 | 3300005458 | Ga0070681_10106059 | Ga0070681_101060592 | 223 |
| 206 | 3300005459 | Ga0068867_100004544 | Ga0068867_10000454412 | 223 |
| 207 | 3300005466 | Ga0070685_10017675 | Ga0070685_100176753 | 223 |
| 208 | 3300005467 | Ga0070706_100024233 | Ga0070706_1000242334 | 223 |
| 209 | 3300005468 | Ga0070707_100002173 | Ga0070707_10000217316 | 223 |
| 210 | 3300005468 | Ga0070707_100628145 | Ga0070707_1006281451 | 223 |
| 211 | 3300005471 | Ga0070698_100078488 | Ga0070698_1000784883 | 223 |
| 212 | 3300005535 | Ga0070684_100003310 | Ga0070684_1000033102 | 223 |
| 213 | 3300005535 | Ga0070684_100117256 | Ga0070684_1001172563 | 223 |
| 214 | 3300005539 | Ga0068853_100018457 | Ga0068853_1000184573 | 223 |
| 215 | 3300005543 | Ga0070672_100002647 | Ga0070672_10000264714 | 223 |
| 216 | 3300005544 | Ga0070686_100004104 | Ga0070686_1000041047 | 223 |
| 217 | 3300005545 | Ga0070695_100003524 | Ga0070695_1000035247 | 223 |
| 218 | 3300005546 | Ga0070696_100104388 | Ga0070696_1001043882 | 223 |
| 219 | 3300005548 | Ga0070665_100039518 | Ga0070665_1000395184 | 223 |
| 220 | 3300005549 | Ga0070704_100017189 | Ga0070704_1000171893 | 223 |
| 221 | 3300005549 | Ga0070704_100139053 | Ga0070704_1001390532 | 223 |
| 222 | 3300005563 | Ga0068855_100332579 | Ga0068855_1003325792 | 223 |
| 223 | 3300005563 | Ga0068855_100355476 | Ga0068855_1003554762 | 223 |
| 224 | 3300005564 | Ga0070664_100020201 | Ga0070664_1000202012 | 223 |
| 225 | 3300005578 | Ga0068854_100626521 | Ga0068854_1006265211 | 223 |
| 226 | 3300005614 | Ga0068856_100000869 | Ga0068856_10000086932 | 223 |
| 227 | 3300005614 | Ga0068856_100049621 | Ga0068856_1000496212 | 223 |
| 228 | 3300005614 | Ga0068856_100217444 | Ga0068856_1002174443 | 223 |
| 229 | 3300005614 | Ga0068856_100572477 | Ga0068856_1005724772 | 223 |
| 230 | 3300005615 | Ga0070702_100004297 | Ga0070702_1000042972 | 223 |
| 231 | 3300005617 | Ga0068859_100058218 | Ga0068859_1000582183 | 223 |
| 232 | 3300005718 | Ga0068866_10002247 | Ga0068866_100022477 | 223 |
| 233 | 3300005718 | Ga0068866_10146251 | Ga0068866_101462512 | 223 |
| 234 | 3300005719 | Ga0068861_100030270 | Ga0068861_1000302704 | 223 |
| 235 | 3300005840 | Ga0068870_10128950 | Ga0068870_101289502 | 223 |
| 236 | 3300005843 | Ga0068860_100219166 | Ga0068860_1002191663 | 223 |
| 237 | 3300005844 | Ga0068862_100694592 | Ga0068862_1006945922 | 223 |
| 238 | 3300005937 | Ga0081455_10484823 | Ga0081455_104848231 | 223 |
| 239 | 3300005985 | Ga0081539_10012953 | Ga0081539_100129534 | 223 |
| 240 | 3300005985 | Ga0081539_10022801 | Ga0081539_100228011 | 223 |
| 241 | 3300005985 | Ga0081539_10039804 | Ga0081539_100398043 | 223 |
| 242 | 3300006173 | Ga0070716_100109878 | Ga0070716_1001098782 | 223 |
| 243 | 3300006175 | Ga0070712_100024368 | Ga0070712_1000243682 | 223 |
| 244 | 3300006175 | Ga0070712_100033478 | Ga0070712_1000334783 | 223 |
| 245 | 3300006175 | Ga0070712_100367098 | Ga0070712_1003670982 | 223 |
| 246 | 3300006237 | Ga0097621_100003227 | Ga0097621_1000032275 | 223 |
| 247 | 3300006358 | Ga0068871_100009924 | Ga0068871_1000099246 | 223 |
| 248 | 3300006358 | Ga0068871_100199159 | Ga0068871_1001991592 | 223 |
| 249 | 3300006844 | Ga0075428_100088776 | Ga0075428_1000887761 | 223 |
| 250 | 3300006844 | Ga0075428_100235246 | Ga0075428_1002352463 | 223 |
| 251 | 3300006844 | Ga0075428_100384344 | Ga0075428_1003843442 | 223 |
| 252 | 3300006844 | Ga0075428_100534136 | Ga0075428_1005341362 | 223 |
| 253 | 3300006847 | Ga0075431_100249448 | Ga0075431_1002494482 | 223 |
| 254 | 3300006852 | Ga0075433_10431940 | Ga0075433_104319402 | 223 |
| 255 | 3300006881 | Ga0068865_100003596 | Ga0068865_1000035964 | 223 |
| 256 | 3300006914 | Ga0075436_100247037 | Ga0075436_1002470372 | 223 |
| 257 | 3300006931 | Ga0097620_100058219 | Ga0097620_1000582194 | 223 |
| 258 | 3300009093 | Ga0105240_10237181 | Ga0105240_102371812 | 223 |
| 259 | 3300009094 | Ga0111539_10294854 | Ga0111539_102948542 | 223 |
| 260 | 3300009094 | Ga0111539_10321969 | Ga0111539_103219692 | 223 |
| 261 | 3300009098 | Ga0105245_10002706 | Ga0105245_1000270614 | 223 |
| 262 | 3300009098 | Ga0105245_10013004 | Ga0105245_100130042 | 223 |
| 263 | 3300009098 | Ga0105245_10110304 | Ga0105245_101103042 | 223 |
| 264 | 3300009098 | Ga0105245_10409471 | Ga0105245_104094712 | 223 |
| 265 | 3300009101 | Ga0105247_10027554 | Ga0105247_100275543 | 223 |
| 266 | 3300009147 | Ga0114129_10001640 | Ga0114129_1000164021 | 223 |
| 267 | 3300009147 | Ga0114129_10118114 | Ga0114129_101181144 | 223 |
| 268 | 3300009148 | Ga0105243_10026764 | Ga0105243_100267642 | 223 |
| 269 | 3300009148 | Ga0105243_10854127 | Ga0105243_108541272 | 223 |
| 270 | 3300009148 | Ga0105243_10862300 | Ga0105243_108623002 | 223 |
| 271 | 3300009174 | Ga0105241_10066855 | Ga0105241_100668553 | 223 |
| 272 | 3300009176 | Ga0105242_10034141 | Ga0105242_100341414 | 223 |
| 273 | 3300009176 | Ga0105242_10197568 | Ga0105242_101975682 | 223 |
| 274 | 3300009176 | Ga0105242_10367142 | Ga0105242_103671421 | 223 |
| 275 | 3300009176 | Ga0105242_11096819 | Ga0105242_110968191 | 223 |
| 276 | 3300009177 | Ga0105248_10023479 | Ga0105248_100234794 | 223 |
| 277 | 3300009545 | Ga0105237_10118894 | Ga0105237_101188943 | 223 |
| 278 | 3300009545 | Ga0105237_10178968 | Ga0105237_101789683 | 223 |
| 279 | 3300009551 | Ga0105238_10060339 | Ga0105238_100603395 | 223 |
| 280 | 3300009553 | Ga0105249_10032429 | Ga0105249_100324292 | 223 |
| 281 | 3300009553 | Ga0105249_10530253 | Ga0105249_105302532 | 223 |
| 282 | 3300010375 | Ga0105239_10014340 | Ga0105239_100143405 | 223 |
| 283 | 3300011119 | Ga0105246_10019434 | Ga0105246_100194344 | 223 |
| 284 | 3300011119 | Ga0105246_10495510 | Ga0105246_104955102 | 223 |
| 285 | 3300013102 | Ga0157371_10153699 | Ga0157371_101536992 | 223 |
| 286 | 3300013104 | Ga0157370_10001997 | Ga0157370_100019976 | 223 |
| 287 | 3300013105 | Ga0157369_10024504 | Ga0157369_100245045 | 223 |
| 288 | 3300013296 | Ga0157374_10081816 | Ga0157374_100818162 | 223 |
| 289 | 3300013296 | Ga0157374_10104084 | Ga0157374_101040843 | 223 |
| 290 | 3300013296 | Ga0157374_10211230 | Ga0157374_102112302 | 223 |
| 291 | 3300013297 | Ga0157378_10015506 | Ga0157378_100155065 | 223 |
| 292 | 3300013297 | Ga0157378_10508139 | Ga0157378_105081392 | 223 |
| 293 | 3300013306 | Ga0163162_10004499 | Ga0163162_1000449912 | 223 |
| 294 | 3300013306 | Ga0163162_10943460 | Ga0163162_109434602 | 223 |
| 295 | 3300013307 | Ga0157372_10187749 | Ga0157372_101877491 | 223 |
| 296 | 3300013308 | Ga0157375_10003905 | Ga0157375_1000390511 | 223 |
| 297 | 3300013308 | Ga0157375_10009361 | Ga0157375_100093614 | 223 |
| 298 | 3300013308 | Ga0157375_10017420 | Ga0157375_100174202 | 223 |
| 299 | 3300013308 | Ga0157375_10636534 | Ga0157375_106365342 | 223 |
| 300 | 3300014325 | Ga0163163_10276674 | Ga0163163_102766741 | 223 |
| 301 | 3300014325 | Ga0163163_10283913 | Ga0163163_102839131 | 223 |
| 302 | 3300014325 | Ga0163163_10460252 | Ga0163163_104602522 | 223 |
| 303 | 3300014326 | Ga0157380_10008025 | Ga0157380_100080254 | 223 |
| 304 | 3300014326 | Ga0157380_10033809 | Ga0157380_100338092 | 223 |
| 305 | 3300014326 | Ga0157380_10431362 | Ga0157380_104313622 | 223 |
| 306 | 3300014745 | Ga0157377_10014331 | Ga0157377_100143312 | 223 |
| 307 | 3300014745 | Ga0157377_10021940 | Ga0157377_100219402 | 223 |
| 308 | 3300014968 | Ga0157379_10296648 | Ga0157379_102966483 | 223 |
| 309 | 3300014968 | Ga0157379_10412375 | Ga0157379_104123751 | 223 |
| 310 | 3300014969 | Ga0157376_10005990 | Ga0157376_1000599010 | 223 |
| 311 | 3300014969 | Ga0157376_10059597 | Ga0157376_100595973 | 223 |
| 312 | 3300025898 | Ga0207692_10008725 | Ga0207692_100087253 | 223 |
| 313 | 3300025898 | Ga0207692_10293429 | Ga0207692_102934292 | 223 |
| 314 | 3300025899 | Ga0207642_10002169 | Ga0207642_100021698 | 223 |
| 315 | 3300025899 | Ga0207642_10237361 | Ga0207642_102373611 | 223 |
| 316 | 3300025900 | Ga0207710_10018665 | Ga0207710_100186652 | 223 |
| 317 | 3300025903 | Ga0207680_10011715 | Ga0207680_100117153 | 223 |
| 318 | 3300025905 | Ga0207685_10040989 | Ga0207685_100409892 | 223 |
| 319 | 3300025907 | Ga0207645_10214609 | Ga0207645_102146091 | 223 |
| 320 | 3300025908 | Ga0207643_10029657 | Ga0207643_100296573 | 223 |
| 321 | 3300025910 | Ga0207684_10143280 | Ga0207684_101432804 | 223 |
| 322 | 3300025911 | Ga0207654_10102059 | Ga0207654_101020593 | 223 |
| 323 | 3300025912 | Ga0207707_10008757 | Ga0207707_100087573 | 223 |
| 324 | 3300025914 | Ga0207671_10043189 | Ga0207671_100431893 | 223 |
| 325 | 3300025914 | Ga0207671_10247611 | Ga0207671_102476112 | 223 |
| 326 | 3300025915 | Ga0207693_10000312 | Ga0207693_100003124 | 223 |
| 327 | 3300025915 | Ga0207693_10028891 | Ga0207693_100288913 | 223 |
| 328 | 3300025916 | Ga0207663_10030427 | Ga0207663_100304272 | 223 |
| 329 | 3300025917 | Ga0207660_10026729 | Ga0207660_100267293 | 223 |
| 330 | 3300025917 | Ga0207660_10045516 | Ga0207660_100455162 | 223 |
| 331 | 3300025918 | Ga0207662_10054602 | Ga0207662_100546023 | 223 |
| 332 | 3300025919 | Ga0207657_10019237 | Ga0207657_100192375 | 223 |
| 333 | 3300025919 | Ga0207657_10027058 | Ga0207657_100270584 | 223 |
| 334 | 3300025921 | Ga0207652_10003706 | Ga0207652_100037065 | 223 |
| 335 | 3300025921 | Ga0207652_10551862 | Ga0207652_105518622 | 223 |
| 336 | 3300025922 | Ga0207646_10013625 | Ga0207646_100136256 | 223 |
| 337 | 3300025922 | Ga0207646_10167520 | Ga0207646_101675202 | 223 |
| 338 | 3300025922 | Ga0207646_10544432 | Ga0207646_105444322 | 223 |
| 339 | 3300025923 | Ga0207681_10093240 | Ga0207681_100932402 | 223 |
| 340 | 3300025924 | Ga0207694_10300094 | Ga0207694_103000942 | 223 |
| 341 | 3300025926 | Ga0207659_10158407 | Ga0207659_101584072 | 223 |
| 342 | 3300025927 | Ga0207687_10021127 | Ga0207687_100211273 | 223 |
| 343 | 3300025927 | Ga0207687_10062483 | Ga0207687_100624833 | 223 |
| 344 | 3300025927 | Ga0207687_10199711 | Ga0207687_101997113 | 223 |
| 345 | 3300025927 | Ga0207687_10277116 | Ga0207687_102771162 | 223 |
| 346 | 3300025928 | Ga0207700_10217673 | Ga0207700_102176733 | 223 |
| 347 | 3300025928 | Ga0207700_10376703 | Ga0207700_103767032 | 223 |
| 348 | 3300025931 | Ga0207644_10168953 | Ga0207644_101689532 | 223 |
| 349 | 3300025932 | Ga0207690_10034370 | Ga0207690_100343704 | 223 |
| 350 | 3300025933 | Ga0207706_10166978 | Ga0207706_101669781 | 223 |
| 351 | 3300025933 | Ga0207706_10232086 | Ga0207706_102320862 | 223 |
| 352 | 3300025934 | Ga0207686_10011305 | Ga0207686_100113055 | 223 |
| 353 | 3300025934 | Ga0207686_10317611 | Ga0207686_103176112 | 223 |
| 354 | 3300025935 | Ga0207709_10005693 | Ga0207709_100056935 | 223 |
| 355 | 3300025936 | Ga0207670_10378840 | Ga0207670_103788401 | 223 |
| 356 | 3300025937 | Ga0207669_10006579 | Ga0207669_100065793 | 223 |
| 357 | 3300025938 | Ga0207704_10010965 | Ga0207704_100109652 | 223 |
| 358 | 3300025938 | Ga0207704_10525911 | Ga0207704_105259111 | 223 |
| 359 | 3300025939 | Ga0207665_10027047 | Ga0207665_100270472 | 223 |
| 360 | 3300025940 | Ga0207691_10002913 | Ga0207691_100029134 | 223 |
| 361 | 3300025941 | Ga0207711_10083649 | Ga0207711_100836492 | 223 |
| 362 | 3300025942 | Ga0207689_10492884 | Ga0207689_104928841 | 223 |
| 363 | 3300025944 | Ga0207661_10000505 | Ga0207661_100005055 | 223 |
| 364 | 3300025949 | Ga0207667_10103060 | Ga0207667_101030602 | 223 |
| 365 | 3300025949 | Ga0207667_10190083 | Ga0207667_101900833 | 223 |
| 366 | 3300025960 | Ga0207651_10240042 | Ga0207651_102400421 | 223 |
| 367 | 3300025961 | Ga0207712_10021204 | Ga0207712_100212044 | 223 |
| 368 | 3300025961 | Ga0207712_10458499 | Ga0207712_104584991 | 223 |
| 369 | 3300025972 | Ga0207668_10050215 | Ga0207668_100502154 | 223 |
| 370 | 3300026023 | Ga0207677_10023963 | Ga0207677_100239633 | 223 |
| 371 | 3300026023 | Ga0207677_10104088 | Ga0207677_101040883 | 223 |
| 372 | 3300026035 | Ga0207703_10045607 | Ga0207703_100456072 | 223 |
| 373 | 3300026035 | Ga0207703_10531255 | Ga0207703_105312552 | 223 |
| 374 | 3300026041 | Ga0207639_10013938 | Ga0207639_100139383 | 223 |
| 375 | 3300026067 | Ga0207678_10015938 | Ga0207678_100159384 | 223 |
| 376 | 3300026067 | Ga0207678_10053171 | Ga0207678_100531714 | 223 |
| 377 | 3300026067 | Ga0207678_10191060 | Ga0207678_101910601 | 223 |
| 378 | 3300026075 | Ga0207708_10000811 | Ga0207708_1000081113 | 223 |
| 379 | 3300026075 | Ga0207708_10027208 | Ga0207708_100272083 | 223 |
| 380 | 3300026075 | Ga0207708_10046186 | Ga0207708_100461863 | 223 |
| 381 | 3300026075 | Ga0207708_10500107 | Ga0207708_105001072 | 223 |
| 382 | 3300026078 | Ga0207702_10009855 | Ga0207702_100098555 | 223 |
| 383 | 3300026078 | Ga0207702_10073971 | Ga0207702_100739712 | 223 |
| 384 | 3300026089 | Ga0207648_10000214 | Ga0207648_1000021414 | 223 |
| 385 | 3300026118 | Ga0207675_100018153 | Ga0207675_1000181534 | 223 |
| 386 | 3300026118 | Ga0207675_100020426 | Ga0207675_1000204265 | 223 |
| 387 | 3300026121 | Ga0207683_10003027 | Ga0207683_100030278 | 223 |
| 388 | 3300026121 | Ga0207683_10008122 | Ga0207683_100081225 | 223 |
| 389 | 3300026142 | Ga0207698_10083579 | Ga0207698_100835793 | 223 |
| 390 | 3300026142 | Ga0207698_10485358 | Ga0207698_104853581 | 223 |
| 391 | 3300028379 | Ga0268266_10117293 | Ga0268266_101172932 | 223 |
| 392 | 3300028380 | Ga0268265_10085160 | Ga0268265_100851603 | 223 |
| 393 | 3300028380 | Ga0268265_10636038 | Ga0268265_106360382 | 223 |
| 394 | 3300028381 | Ga0268264_10079376 | Ga0268264_100793763 | 223 |
| 395 | 3300031548 | Ga0307408_100199122 | Ga0307408_1001991222 | 223 |
| 396 | 3300031548 | Ga0307408_100451014 | Ga0307408_1004510142 | 223 |
| 397 | 3300031731 | Ga0307405_10015818 | Ga0307405_100158182 | 223 |
| 398 | 3300031852 | Ga0307410_10338584 | Ga0307410_103385842 | 223 |
| 399 | 3300031852 | Ga0307410_10635663 | Ga0307410_106356631 | 223 |
| 400 | 3300031901 | Ga0307406_10189504 | Ga0307406_101895042 | 223 |
| 401 | 3300031903 | Ga0307407_10070018 | Ga0307407_100700182 | 223 |
| 402 | 3300031911 | Ga0307412_10031336 | Ga0307412_100313363 | 223 |
| 403 | 3300031995 | Ga0307409_100616376 | Ga0307409_1006163762 | 223 |
| 404 | 3300032005 | Ga0307411_10008423 | Ga0307411_100084234 | 223 |
| 405 | 3300032126 | Ga0307415_100582809 | Ga0307415_1005828092 | 223 |
| 406 | 3300035724 | Ga0373933_0420350 | Ga0373933_0420350_191_862 | 223 |
| 407 | 3300037068 | Ga0373925_0123935 | Ga0373925_0123935_1138_1824 | 223 |
| 408 | 3300037312 | Ga0395899_0031127 | Ga0395899_0031127_1412_2155 | 223 |
| 409 | 3300037312 | Ga0395899_0052220 | Ga0395899_0052220_1137_1823 | 223 |
| 410 | 3300037312 | Ga0395899_0057368 | Ga0395899_0057368_1944_2633 | 223 |
| 411 | 3300037312 | Ga0395899_0124948 | Ga0395899_0124948_908_1660 | 223 |
| 412 | 3300037312 | Ga0395899_0132670 | Ga0395899_0132670_809_1495 | 223 |
| 413 | 3300037418 | Ga0395900_0002110 | Ga0395900_0002110_9295_10047 | 223 |
| 414 | 3300037418 | Ga0395900_0002210 | Ga0395900_0002210_15359_16030 | 223 |
| 415 | 3300037418 | Ga0395900_0025706 | Ga0395900_0025706_333_1019 | 223 |
| 416 | 3300037418 | Ga0395900_0044339 | Ga0395900_0044339_741_1484 | 223 |
| 417 | 3300037418 | Ga0395900_0062824 | Ga0395900_0062824_1695_2381 | 223 |
| 418 | 3300037418 | Ga0395900_0078922 | Ga0395900_0078922_2066_2752 | 223 |
| 419 | 3300037418 | Ga0395900_0353981 | Ga0395900_0353981_156_845 | 223 |
| 420 | 3300037466 | Ga0395898_0002238 | Ga0395898_0002238_11254_11940 | 223 |
| 421 | 3300037466 | Ga0395898_0004044 | Ga0395898_0004044_6355_7107 | 223 |
| 422 | 3300037466 | Ga0395898_0014865 | Ga0395898_0014865_676_1347 | 223 |
| 423 | 3300037466 | Ga0395898_0036788 | Ga0395898_0036788_2969_3655 | 223 |
| 424 | 3300037466 | Ga0395898_0056293 | Ga0395898_0056293_113_784 | 223 |
| 425 | 3300037466 | Ga0395898_0058188 | Ga0395898_0058188_649_1338 | 223 |
| 426 | 3300037466 | Ga0395898_0071250 | Ga0395898_0071250_530_1216 | 223 |
| 427 | 3300037466 | Ga0395898_0103314 | Ga0395898_0103314_1832_2518 | 223 |
| 428 | 3300037466 | Ga0395898_0106911 | Ga0395898_0106911_660_1346 | 223 |
| 429 | 3300037466 | Ga0395898_0205487 | Ga0395898_0205487_999_1742 | 223 |
| 430 | 3300037466 | Ga0395898_0232570 | Ga0395898_0232570_490_1176 | 223 |
| 431 | 3300037466 | Ga0395898_0241455 | Ga0395898_0241455_246_923 | 223 |
| 432 | 3300037466 | Ga0395898_0515439 | Ga0395898_0515439_287_973 | 223 |
| 433 | 3300037471 | Ga0395905_0005593 | Ga0395905_0005593_11602_12273 | 223 |
| 434 | 3300037471 | Ga0395905_0012371 | Ga0395905_0012371_6786_7472 | 223 |
| 435 | 3300037471 | Ga0395905_0012571 | Ga0395905_0012571_232_984 | 223 |
| 436 | 3300037471 | Ga0395905_0020067 | Ga0395905_0020067_4715_5401 | 223 |
| 437 | 3300037471 | Ga0395905_0070059 | Ga0395905_0070059_1951_2640 | 223 |
| 438 | 3300037471 | Ga0395905_0149660 | Ga0395905_0149660_175_918 | 223 |
| 439 | 3300037471 | Ga0395905_0381653 | Ga0395905_0381653_536_1222 | 223 |
| 440 | 3300037471 | Ga0395905_0560122 | Ga0395905_0560122_319_1005 | 223 |
| 441 | 3300038443 | Ga0395901_0005034 | Ga0395901_0005034_210_962 | 223 |
| 442 | 3300038443 | Ga0395901_0023726 | Ga0395901_0023726_2626_3297 | 223 |
| 443 | 3300038443 | Ga0395901_0025538 | Ga0395901_0025538_2276_2962 | 223 |
| 444 | 3300038443 | Ga0395901_0046606 | Ga0395901_0046606_156_842 | 223 |
| 445 | 3300038443 | Ga0395901_0065219 | Ga0395901_0065219_1979_2665 | 223 |
| 446 | 3300038443 | Ga0395901_0081986 | Ga0395901_0081986_1523_2266 | 223 |
| 447 | 3300038443 | Ga0395901_0213835 | Ga0395901_0213835_585_1271 | 223 |
| 448 | 3300038443 | Ga0395901_0457497 | Ga0395901_0457497_587_1276 | 223 |
| 449 | 3300038443 | Ga0395901_0835912 | Ga0395901_0835912_147_833 | 223 |
| 450 | 3300039437 | Ga0436365_0131966 | Ga0436365_0131966_1036_1860 | 223 |
| 451 | 3300039437 | Ga0436365_0243590 | Ga0436365_0243590_149_820 | 223 |
| 452 | 3300041411 | Ga0439466_0049302 | Ga0439466_0049302_617_1303 | 223 |
| 453 | 3300042156 | Ga0439446_0028139 | Ga0439446_0028139_366_1052 | 223 |
| 454 | 3300042435 | Ga0439434_0101020 | Ga0439434_0101020_138_824 | 223 |
| 455 | 3300044658 | Ga0466972_0112699 | Ga0466972_0112699_190_882 | 223 |
| 456 | 3300044706 | Ga0466964_0011091 | Ga0466964_0011091_2479_3165 | 223 |
| 457 | 3300044706 | Ga0466964_0111894 | Ga0466964_0111894_213_896 | 223 |
| 458 | 3300044706 | Ga0466964_0114443 | Ga0466964_0114443_120_791 | 223 |
| 459 | 3300044901 | Ga0466960_0012863 | Ga0466960_0012863_595_1287 | 223 |
| 460 | 3300045049 | Ga0466959_0207033 | Ga0466959_0207033_626_1309 | 223 |
| 461 | 3300045976 | Ga0466967_0169526 | Ga0466967_0169526_1223_1909 | 223 |
| 462 | 3300045976 | Ga0466967_0594545 | Ga0466967_0594545_344_1039 | 223 |
| 463 | 3300046455 | Ga0495603_0004117 | Ga0495603_0004117_6032_6718 | 223 |
| 464 | 3300046462 | Ga0495651_0027567 | Ga0495651_0027567_1597_2268 | 223 |
| 465 | 3300046463 | Ga0495653_0206885 | Ga0495653_0206885_554_1225 | 223 |
| 466 | 3300046473 | Ga0495582_0032696 | Ga0495582_0032696_206_892 | 223 |
| 467 | 3300046474 | Ga0495605_0104145 | Ga0495605_0104145_470_1156 | 223 |
| 468 | 3300046475 | Ga0495639_0094856 | Ga0495639_0094856_471_1157 | 223 |
| 469 | 3300046476 | Ga0495662_0058664 | Ga0495662_0058664_510_1196 | 223 |
| 470 | 3300046500 | Ga0495596_0063826 | Ga0495596_0063826_378_1064 | 223 |
| 471 | 3300046511 | Ga0495608_0006067 | Ga0495608_0006067_2481_3152 | 223 |
| 472 | 3300046511 | Ga0495608_0296138 | Ga0495608_0296138_149_820 | 223 |
| 473 | 3300046518 | Ga0495631_0077851 | Ga0495631_0077851_315_1001 | 223 |
| 474 | 3300046523 | Ga0495644_0105816 | Ga0495644_0105816_111_797 | 223 |
| 475 | 3300046525 | Ga0495663_0007027 | Ga0495663_0007027_1503_2189 | 223 |
| 476 | 3300046531 | Ga0495665_0025053 | Ga0495665_0025053_2455_3141 | 223 |
| 477 | 3300046536 | Ga0495587_0308476 | Ga0495587_0308476_69_740 | 223 |
| 478 | 3300046538 | Ga0495609_0055855 | Ga0495609_0055855_795_1481 | 223 |
| 479 | 3300046559 | Ga0495667_0026672 | Ga0495667_0026672_1099_1770 | 223 |
| 480 | 3300046615 | Ga0495656_0058688 | Ga0495656_0058688_883_1569 | 223 |
| 481 | 3300046664 | Ga0495659_0002949 | Ga0495659_0002949_470_1156 | 223 |
| 482 | 3300046665 | Ga0495661_0191352 | Ga0495661_0191352_228_914 | 223 |
| 483 | 3300046674 | Ga0495588_0139492 | Ga0495588_0139492_402_1088 | 223 |
| 484 | 3300046675 | Ga0495657_0030558 | Ga0495657_0030558_775_1446 | 223 |
| 485 | 3300046683 | Ga0495658_0004265 | Ga0495658_0004265_3980_4666 | 223 |
| 486 | 3300046683 | Ga0495658_0378902 | Ga0495658_0378902_149_820 | 223 |
| 487 | 3300046684 | Ga0495669_0144794 | Ga0495669_0144794_84_770 | 223 |
| 488 | 3300046690 | Ga0495624_0145483 | Ga0495624_0145483_608_1279 | 223 |
| 489 | 3300046691 | Ga0495670_0132658 | Ga0495670_0132658_160_846 | 223 |
| 490 | 3300046692 | Ga0495671_0087519 | Ga0495671_0087519_325_1011 | 223 |
| 491 | 3300046794 | Ga0495589_0060047 | Ga0495589_0060047_1066_1752 | 223 |
| 492 | 3300046809 | Ga0495600_0030572 | Ga0495600_0030572_1111_1782 | 223 |
| 493 | 3300047315 | Ga0495581_0009484 | Ga0495581_0009484_241_927 | 223 |
| 494 | 3300047315 | Ga0495581_0022991 | Ga0495581_0022991_1569_2255 | 223 |
| 495 | 3300047317 | Ga0495604_0055596 | Ga0495604_0055596_931_1602 | 223 |
| 496 | 3300047318 | Ga0495636_0122315 | Ga0495636_0122315_234_920 | 223 |
| 497 | 3300047319 | Ga0495674_0244140 | Ga0495674_0244140_783_1454 | 223 |
| 498 | 3300047319 | Ga0495674_0434654 | Ga0495674_0434654_357_1040 | 223 |
| 499 | 3300047321 | Ga0495676_0021257 | Ga0495676_0021257_847_1533 | 223 |
| 500 | 3300047322 | Ga0495680_0122013 | Ga0495680_0122013_1117_1800 | 223 |
| 501 | 3300047322 | Ga0495680_0282419 | Ga0495680_0282419_143_814 | 223 |
| 502 | 3300047444 | Ga0495675_0163811 | Ga0495675_0163811_386_1057 | 223 |
| 503 | 3300047673 | Ga0495593_0149464 | Ga0495593_0149464_97_783 | 223 |
| 504 | 3300048088 | Ga0495602_0101939 | Ga0495602_0101939_791_1462 | 223 |
| 505 | 3300048903 | Ga0496100_0065883 | Ga0496100_0065883_1078_1842 | 223 |
| 506 | 3300048903 | Ga0496100_0101946 | Ga0496100_0101946_994_1680 | 223 |
| 507 | 3300048903 | Ga0496100_0102946 | Ga0496100_0102946_52_729 | 223 |
| 508 | 3300048903 | Ga0496100_0318920 | Ga0496100_0318920_463_1134 | 223 |
| 509 | 3300048904 | Ga0496101_0032147 | Ga0496101_0032147_1853_2539 | 223 |
| 510 | 3300048904 | Ga0496101_0045916 | Ga0496101_0045916_1689_2360 | 223 |
| 511 | 3300048904 | Ga0496101_0067463 | Ga0496101_0067463_1844_2530 | 223 |
| 512 | 3300048904 | Ga0496101_0078937 | Ga0496101_0078937_1456_2259 | 223 |
| 513 | 3300048904 | Ga0496101_0251410 | Ga0496101_0251410_134_820 | 223 |
| 514 | 3300048905 | Ga0496102_0007349 | Ga0496102_0007349_5743_6546 | 223 |
| 515 | 3300048905 | Ga0496102_0011604 | Ga0496102_0011604_4753_5439 | 223 |
| 516 | 3300048905 | Ga0496102_0014734 | Ga0496102_0014734_3105_3791 | 223 |
| 517 | 3300048905 | Ga0496102_0067224 | Ga0496102_0067224_1075_1752 | 223 |
| 518 | 3300048905 | Ga0496102_0102019 | Ga0496102_0102019_277_1014 | 223 |
| 519 | 3300048906 | Ga0496103_0008781 | Ga0496103_0008781_994_1680 | 223 |
| 520 | 3300048906 | Ga0496103_0054418 | Ga0496103_0054418_839_1525 | 223 |
| 521 | 3300048906 | Ga0496103_0107421 | Ga0496103_0107421_937_1740 | 223 |
| 522 | 3300048906 | Ga0496103_0201480 | Ga0496103_0201480_403_1080 | 223 |
| 523 | 3300048907 | Ga0496104_0020574 | Ga0496104_0020574_791_1528 | 223 |
| 524 | 3300048907 | Ga0496104_0036555 | Ga0496104_0036555_2575_3378 | 223 |
| 525 | 3300048907 | Ga0496104_0042619 | Ga0496104_0042619_3391_4128 | 223 |
| 526 | 3300048907 | Ga0496104_0226077 | Ga0496104_0226077_843_1520 | 223 |
| 527 | 3300048907 | Ga0496104_0275142 | Ga0496104_0275142_426_1112 | 223 |
| 528 | 3300048909 | Ga0496106_0006374 | Ga0496106_0006374_3310_3996 | 223 |
| 529 | 3300048909 | Ga0496106_0662335 | Ga0496106_0662335_111_797 | 223 |
| 530 | 3300048910 | Ga0496107_0040302 | Ga0496107_0040302_1374_2060 | 223 |
| 531 | 3300048910 | Ga0496107_0103211 | Ga0496107_0103211_1172_1849 | 223 |
| 532 | 3300048911 | Ga0496108_0000999 | Ga0496108_0000999_1907_2644 | 223 |
| 533 | 3300048911 | Ga0496108_0750189 | Ga0496108_0750189_134_820 | 223 |
| 534 | 3300048912 | Ga0496109_0003779 | Ga0496109_0003779_6804_7541 | 223 |
| 535 | 3300048912 | Ga0496109_0012663 | Ga0496109_0012663_861_1547 | 223 |
| 536 | 3300048912 | Ga0496109_0162960 | Ga0496109_0162960_534_1220 | 223 |
| 537 | 3300048913 | Ga0496110_0010416 | Ga0496110_0010416_4540_5277 | 223 |
| 538 | 3300048913 | Ga0496110_0041585 | Ga0496110_0041585_1438_2124 | 223 |
| 539 | 3300048913 | Ga0496110_0099938 | Ga0496110_0099938_819_1505 | 223 |
| 540 | 3300048913 | Ga0496110_0342674 | Ga0496110_0342674_636_1313 | 223 |
| 541 | 3300048913 | Ga0496110_0346829 | Ga0496110_0346829_296_1099 | 223 |
| 542 | 3300048914 | Ga0496111_0022832 | Ga0496111_0022832_2009_2746 | 223 |
| 543 | 3300048914 | Ga0496111_0030725 | Ga0496111_0030725_1513_2199 | 223 |
| 544 | 3300048914 | Ga0496111_0067215 | Ga0496111_0067215_45_731 | 223 |
| 545 | 3300048915 | Ga0496112_0005069 | Ga0496112_0005069_6727_7416 | 223 |
| 546 | 3300048915 | Ga0496112_0016674 | Ga0496112_0016674_4534_5220 | 223 |
| 547 | 3300048915 | Ga0496112_0032966 | Ga0496112_0032966_1422_2159 | 223 |
| 548 | 3300048915 | Ga0496112_0089904 | Ga0496112_0089904_1783_2469 | 223 |
| 549 | 3300048915 | Ga0496112_0093485 | Ga0496112_0093485_1204_1890 | 223 |
| 550 | 3300048915 | Ga0496112_0175296 | Ga0496112_0175296_1367_2053 | 223 |
| 551 | 3300048916 | Ga0496113_0087848 | Ga0496113_0087848_1634_2320 | 223 |
| 552 | 3300048916 | Ga0496113_0095693 | Ga0496113_0095693_370_1056 | 223 |
| 553 | 3300048916 | Ga0496113_0121291 | Ga0496113_0121291_1014_1700 | 223 |
| 554 | 3300048917 | Ga0496114_0000264 | Ga0496114_0000264_25845_26648 | 223 |
| 555 | 3300048917 | Ga0496114_0005659 | Ga0496114_0005659_6559_7245 | 223 |
| 556 | 3300048917 | Ga0496114_0206432 | Ga0496114_0206432_768_1505 | 223 |
| 557 | 3300048918 | Ga0496115_0003038 | Ga0496115_0003038_8591_9262 | 223 |
| 558 | 3300048918 | Ga0496115_0007416 | Ga0496115_0007416_3641_4327 | 223 |
| 559 | 3300049578 | Ga0501042_0201784 | Ga0501042_0201784_352_1038 | 223 |
| 560 | 3300049583 | Ga0501067_0275471 | Ga0501067_0275471_17_760 | 223 |
| 561 | 3300050489 | nmdc:mga03683_173338_c1 | nmdc:mga03683_173338_c1_95_787 | 223 |
| 562 | 3300050507 | nmdc:mga05p37_218266_c1 | nmdc:mga05p37_218266_c1_444_1130 | 223 |
| 563 | 3300050507 | nmdc:mga05p37_2465_c1 | nmdc:mga05p37_2465_c1_7407_8099 | 223 |
| 564 | 3300050507 | nmdc:mga05p37_33557_c1 | nmdc:mga05p37_33557_c1_128_814 | 223 |
| 565 | 3300050508 | nmdc:mga09592_302191_c1 | nmdc:mga09592_302191_c1_511_1254 | 223 |
| 566 | 3300050511 | nmdc:mga08y16_849082_c1 | nmdc:mga08y16_849082_c1_63_776 | 223 |
| 567 | 3300050512 | nmdc:mga0n895_676522_c1 | nmdc:mga0n895_676522_c1_98_784 | 223 |
| 568 | 3300050513 | nmdc:mga0rr50_157181_c1 | nmdc:mga0rr50_157181_c1_47_790 | 223 |
| 569 | 3300053077 | Ga0495601_0062192 | Ga0495601_0062192_1169_1840 | 223 |
| 570 | 3300053084 | Ga0495595_0210647 | Ga0495595_0210647_190_861 | 223 |
| 571 | 3300053085 | Ga0495619_0029705 | Ga0495619_0029705_464_1135 | 223 |
| 572 | 3300059424 | Ga0590075_017661 | Ga0590075_017661_401_1087 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.8455 | 2 | 219 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.8368 | 3 | 219 |
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.8245 | 2 | 219 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.8125 | 3 | 219 |
| 7p8g-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 - apo form | 0.8051 | 2 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9 | 2 | 222 | 3.90.550.10 |
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8887 | 2 | 222 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8691 | 5 | 222 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8612 | 3 | 217 | 3.90.550.10 |
| af_O06376_3_236_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8589 | 3 | 215 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538H1F6-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9784 | 2 | 222 |
GO:0016757
|
| AF-A0A2V9XZG8-F1-model_v4 | Glycosyl transferase | 0.9771 | 67 | 222 |
GO:0016757
|
| AF-A0A524B147-F1-model_v4 | Glycosyl transferase | 0.9693 | 3 | 220 |
GO:0016757
|
| AF-A0A0F9N9V2-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9684 | 60 | 221 |
GO:0016757
|
| AF-A0A7C2D6F6-F1-model_v4 | Methyltransferase | 0.9681 | 60 | 222 |
GO:0008168
GO:0016757 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar