F465110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 572 | 281 | 572 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300046511|Ga0495608_0105424|Ga0495608_0105424_51_1055 |
| Length | 334 |
| Sequence | MHPKELSRKPTGAGRAHTIKWAPSQRRALAALAGSGVAVYDVSSLPIERKDKVVFEKKLLSGKKILVTGGATGLGKSMGKRFLELGAQLYICGRREEVLKQAADELQKATGGTVKTFSCDVRDNERVEAMIENIWQDGPLDALVNNAAGNFLCRTEELSIGAFEAVIGIVLMGTIHATMACGRRWIKEKRKASVLSITTTYAQWGSPYVVPSSVAKAGVLNLTRSLAVEWGKYGIRFNAIAPGPVPTEGAFSRLMPVKSLEEMAKKRNPLGRFGTHQELADLAAFLVSDQSGYVNGEQIVMDGGEQLKGASEFSHLGDLLTEEQWQMMKPKKKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 120 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 121 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 186 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 1.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.42 |
| Rhizosphere | 93.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_12170407 | 2162886012 | Bacteria | 1387 |
| 2 | MBSR1b_contig_831446 | 2162886012 | Bacteria | 2964 |
| 3 | LJNas_1000712 | 3300000546 | Bacteria | 5595 |
| 4 | JGI24752J21851_1000691 | 3300001976 | Bacteria | 4508 |
| 5 | JGI24748J21848_1007843 | 3300002074 | Unclassified | 1253 |
| 6 | JGI24738J21930_10024257 | 3300002075 | Unclassified | 1248 |
| 7 | JGI24034J26672_10003883 | 3300002239 | Bacteria | 2101 |
| 8 | JGI24034J26672_10004102 | 3300002239 | Bacteria | 2054 |
| 9 | JGI24751J29686_10001089 | 3300002459 | Bacteria | 5889 |
| 10 | Ga0065715_10091077 | 3300005293 | Bacteria | 6144 |
| 11 | Ga0070658_10105845 | 3300005327 | Bacteria | 2327 |
| 12 | Ga0070676_10000861 | 3300005328 | Bacteria | 14943 |
| 13 | Ga0070683_100000141 | 3300005329 | Bacteria | 46683 |
| 14 | Ga0070683_100049686 | 3300005329 | Bacteria | 3880 |
| 15 | Ga0070690_100008269 | 3300005330 | Bacteria | 5985 |
| 16 | Ga0070670_100009672 | 3300005331 | Bacteria | 8230 |
| 17 | Ga0070670_100032237 | 3300005331 | Bacteria | 4512 |
| 18 | Ga0070670_100042640 | 3300005331 | Bacteria | 3901 |
| 19 | Ga0070670_100100921 | 3300005331 | Bacteria | 2485 |
| 20 | Ga0070677_10003474 | 3300005333 | Bacteria | 5084 |
| 21 | Ga0068869_100007756 | 3300005334 | Bacteria | 6883 |
| 22 | Ga0068869_100151546 | 3300005334 | Bacteria | 1799 |
| 23 | Ga0070666_10019520 | 3300005335 | Bacteria | 4377 |
| 24 | Ga0070666_10274844 | 3300005335 | Bacteria | 1196 |
| 25 | Ga0070680_100075542 | 3300005336 | Bacteria | 2774 |
| 26 | Ga0070682_100020375 | 3300005337 | Bacteria | 3900 |
| 27 | Ga0070682_100029737 | 3300005337 | Bacteria | 3292 |
| 28 | Ga0068868_100002724 | 3300005338 | Bacteria | 12242 |
| 29 | Ga0068868_100013441 | 3300005338 | Bacteria | 6002 |
| 30 | Ga0070660_100008269 | 3300005339 | Bacteria | 7271 |
| 31 | Ga0070660_100017786 | 3300005339 | Bacteria | 5185 |
| 32 | Ga0070689_100001981 | 3300005340 | Bacteria | 13261 |
| 33 | Ga0070687_100000859 | 3300005343 | Bacteria | 10193 |
| 34 | Ga0070661_100001978 | 3300005344 | Bacteria | 14167 |
| 35 | Ga0070661_100012142 | 3300005344 | Bacteria | 6022 |
| 36 | Ga0070668_100044255 | 3300005347 | Bacteria | 3415 |
| 37 | Ga0070669_100000984 | 3300005353 | Bacteria | 20777 |
| 38 | Ga0070675_100013076 | 3300005354 | Bacteria | 6521 |
| 39 | Ga0070671_100019576 | 3300005355 | Bacteria | 5511 |
| 40 | Ga0070674_100111497 | 3300005356 | Bacteria | 2009 |
| 41 | Ga0070673_100001798 | 3300005364 | Bacteria | 12794 |
| 42 | Ga0070688_100000404 | 3300005365 | Bacteria | 21870 |
| 43 | Ga0070659_100006119 | 3300005366 | Bacteria | 8683 |
| 44 | Ga0070659_100061366 | 3300005366 | Bacteria | 2971 |
| 45 | Ga0070667_100037279 | 3300005367 | Bacteria | 4076 |
| 46 | Ga0070667_100096344 | 3300005367 | Bacteria | 2552 |
| 47 | Ga0070667_100237547 | 3300005367 | Bacteria | 1626 |
| 48 | Ga0070709_10000339 | 3300005434 | Bacteria | 29052 |
| 49 | Ga0070709_10002189 | 3300005434 | Bacteria | 10591 |
| 50 | Ga0070709_10035373 | 3300005434 | Bacteria | 3035 |
| 51 | Ga0070709_10048774 | 3300005434 | Bacteria | 2644 |
| 52 | Ga0070709_10286731 | 3300005434 | Bacteria | 1198 |
| 53 | Ga0070709_10324113 | 3300005434 | Unclassified | 1131 |
| 54 | Ga0070709_10354711 | 3300005434 | Bacteria | 1085 |
| 55 | Ga0070714_100000047 | 3300005435 | Bacteria | 112707 |
| 56 | Ga0070714_100003325 | 3300005435 | Bacteria | 11986 |
| 57 | Ga0070714_100213503 | 3300005435 | Bacteria | 1770 |
| 58 | Ga0070714_100428218 | 3300005435 | Unclassified | 1254 |
| 59 | Ga0070713_100000590 | 3300005436 | Bacteria | 23065 |
| 60 | Ga0070713_100016431 | 3300005436 | Bacteria | 5565 |
| 61 | Ga0070713_100041917 | 3300005436 | Bacteria | 3732 |
| 62 | Ga0070713_100100709 | 3300005436 | Unclassified | 2502 |
| 63 | Ga0070713_100154838 | 3300005436 | Bacteria | 2042 |
| 64 | Ga0070713_100219240 | 3300005436 | Bacteria | 1725 |
| 65 | Ga0070710_10000881 | 3300005437 | Bacteria | 14369 |
| 66 | Ga0070710_10046337 | 3300005437 | Bacteria | 2421 |
| 67 | Ga0070710_10251915 | 3300005437 | Bacteria | 1135 |
| 68 | Ga0070701_10017230 | 3300005438 | Bacteria | 3374 |
| 69 | Ga0070711_100002546 | 3300005439 | Bacteria | 10431 |
| 70 | Ga0070711_100004478 | 3300005439 | Bacteria | 8255 |
| 71 | Ga0070711_100022800 | 3300005439 | Bacteria | 4063 |
| 72 | Ga0070711_100030337 | 3300005439 | Bacteria | 3578 |
| 73 | Ga0070711_100093833 | 3300005439 | Bacteria | 2168 |
| 74 | Ga0070700_100049186 | 3300005441 | Bacteria | 2616 |
| 75 | Ga0070708_100000435 | 3300005445 | Bacteria | 31161 |
| 76 | Ga0070708_100000898 | 3300005445 | Bacteria | 22525 |
| 77 | Ga0070708_100007462 | 3300005445 | Bacteria | 8756 |
| 78 | Ga0070708_100025170 | 3300005445 | Bacteria | 5085 |
| 79 | Ga0070708_100193845 | 3300005445 | Bacteria | 1901 |
| 80 | Ga0070708_100197058 | 3300005445 | Bacteria | 1884 |
| 81 | Ga0070708_100297116 | 3300005445 | Bacteria | 1521 |
| 82 | Ga0070708_100641301 | 3300005445 | Bacteria | 1001 |
| 83 | Ga0070663_100052878 | 3300005455 | Bacteria | 2898 |
| 84 | Ga0070678_100006009 | 3300005456 | Bacteria | 7076 |
| 85 | Ga0070678_100037841 | 3300005456 | Bacteria | 3391 |
| 86 | Ga0070678_100272458 | 3300005456 | Bacteria | 1428 |
| 87 | Ga0070662_100001110 | 3300005457 | Bacteria | 16436 |
| 88 | Ga0070662_100051482 | 3300005457 | Bacteria | 2974 |
| 89 | Ga0070662_100051928 | 3300005457 | Bacteria | 2962 |
| 90 | Ga0070681_10000179 | 3300005458 | Bacteria | 48474 |
| 91 | Ga0070681_10024932 | 3300005458 | Bacteria | 6017 |
| 92 | Ga0070681_10051431 | 3300005458 | Bacteria | 4109 |
| 93 | Ga0070681_10110912 | 3300005458 | Bacteria | 2683 |
| 94 | Ga0070681_10117793 | 3300005458 | Bacteria | 2592 |
| 95 | Ga0068867_100002720 | 3300005459 | Bacteria | 12472 |
| 96 | Ga0070685_10000636 | 3300005466 | Bacteria | 19191 |
| 97 | Ga0070706_100008394 | 3300005467 | Bacteria | 9625 |
| 98 | Ga0070706_100032684 | 3300005467 | Bacteria | 4800 |
| 99 | Ga0070707_100000605 | 3300005468 | Bacteria | 36094 |
| 100 | Ga0070707_100024260 | 3300005468 | Bacteria | 5742 |
| 101 | Ga0070707_100540316 | 3300005468 | Bacteria | 1127 |
| 102 | Ga0070698_100003037 | 3300005471 | Bacteria | 18494 |
| 103 | Ga0070699_100001736 | 3300005518 | Bacteria | 19896 |
| 104 | Ga0070699_100045766 | 3300005518 | Bacteria | 3787 |
| 105 | Ga0070699_100109505 | 3300005518 | Bacteria | 2424 |
| 106 | Ga0070679_100007952 | 3300005530 | Bacteria | 9953 |
| 107 | Ga0070679_100070161 | 3300005530 | Bacteria | 3496 |
| 108 | Ga0070679_100228259 | 3300005530 | Bacteria | 1822 |
| 109 | Ga0070679_100333753 | 3300005530 | Bacteria | 1465 |
| 110 | Ga0070684_100000935 | 3300005535 | Bacteria | 20763 |
| 111 | Ga0070684_100005398 | 3300005535 | Bacteria | 9793 |
| 112 | Ga0070697_100000199 | 3300005536 | Bacteria | 49135 |
| 113 | Ga0070697_100008683 | 3300005536 | Bacteria | 7937 |
| 114 | Ga0070697_100044885 | 3300005536 | Bacteria | 3580 |
| 115 | Ga0068853_100003141 | 3300005539 | Bacteria | 12626 |
| 116 | Ga0068853_100024047 | 3300005539 | Bacteria | 5106 |
| 117 | Ga0070672_100024156 | 3300005543 | Bacteria | 4487 |
| 118 | Ga0070686_100000598 | 3300005544 | Bacteria | 21308 |
| 119 | Ga0070695_100003295 | 3300005545 | Bacteria | 9436 |
| 120 | Ga0070693_100019825 | 3300005547 | Bacteria | 3535 |
| 121 | Ga0070693_100104995 | 3300005547 | Bacteria | 1728 |
| 122 | Ga0070693_100231424 | 3300005547 | Bacteria | 1216 |
| 123 | Ga0070665_100009022 | 3300005548 | Bacteria | 10101 |
| 124 | Ga0068855_100020807 | 3300005563 | Bacteria | 7866 |
| 125 | Ga0068855_100050505 | 3300005563 | Unclassified | 4900 |
| 126 | Ga0068855_100083045 | 3300005563 | Bacteria | 3711 |
| 127 | Ga0070664_100009623 | 3300005564 | Bacteria | 7840 |
| 128 | Ga0070664_100254223 | 3300005564 | Bacteria | 1580 |
| 129 | Ga0068857_100002528 | 3300005577 | Bacteria | 14974 |
| 130 | Ga0068857_100206883 | 3300005577 | Bacteria | 1790 |
| 131 | Ga0068854_100150108 | 3300005578 | Bacteria | 1796 |
| 132 | Ga0068856_100018179 | 3300005614 | Bacteria | 6816 |
| 133 | Ga0068856_100041109 | 3300005614 | Unclassified | 4543 |
| 134 | Ga0068856_100042660 | 3300005614 | Bacteria | 4463 |
| 135 | Ga0068856_100277212 | 3300005614 | Bacteria | 1693 |
| 136 | Ga0070702_100005603 | 3300005615 | Bacteria | 5872 |
| 137 | Ga0068852_100012174 | 3300005616 | Bacteria | 6517 |
| 138 | Ga0068852_100067024 | 3300005616 | Bacteria | 3138 |
| 139 | Ga0068859_100004950 | 3300005617 | Bacteria | 13535 |
| 140 | Ga0068859_100265693 | 3300005617 | Bacteria | 1808 |
| 141 | Ga0068864_100074565 | 3300005618 | Bacteria | 2961 |
| 142 | Ga0068864_100110438 | 3300005618 | Bacteria | 2449 |
| 143 | Ga0068866_10001000 | 3300005718 | Bacteria | 12409 |
| 144 | Ga0068861_100035178 | 3300005719 | Bacteria | 3709 |
| 145 | Ga0068861_100036800 | 3300005719 | Bacteria | 3635 |
| 146 | Ga0068851_10011241 | 3300005834 | Bacteria | 4194 |
| 147 | Ga0068870_10006694 | 3300005840 | Bacteria | 5097 |
| 148 | Ga0068863_100055548 | 3300005841 | Bacteria | 3749 |
| 149 | Ga0068863_100359978 | 3300005841 | Bacteria | 1418 |
| 150 | Ga0068858_100007225 | 3300005842 | Bacteria | 10768 |
| 151 | Ga0068860_100017192 | 3300005843 | Bacteria | 7050 |
| 152 | Ga0068860_100059040 | 3300005843 | Bacteria | 3648 |
| 153 | Ga0068860_100079354 | 3300005843 | Bacteria | 3121 |
| 154 | Ga0068862_100003656 | 3300005844 | Bacteria | 13153 |
| 155 | Ga0068862_100025221 | 3300005844 | Bacteria | 4991 |
| 156 | Ga0081455_10024699 | 3300005937 | Bacteria | 5559 |
| 157 | Ga0070717_10016809 | 3300006028 | Bacteria | 5679 |
| 158 | Ga0070717_10035429 | 3300006028 | Bacteria | 4040 |
| 159 | Ga0070717_10044469 | 3300006028 | Bacteria | 3626 |
| 160 | Ga0070717_10113225 | 3300006028 | Bacteria | 2316 |
| 161 | Ga0070717_10120763 | 3300006028 | Unclassified | 2245 |
| 162 | Ga0070717_10305421 | 3300006028 | Bacteria | 1415 |
| 163 | Ga0070717_10385091 | 3300006028 | Unclassified | 1258 |
| 164 | Ga0070717_10423416 | 3300006028 | Unclassified | 1198 |
| 165 | Ga0070715_10022890 | 3300006163 | Bacteria | 2441 |
| 166 | Ga0070715_10066827 | 3300006163 | Bacteria | 1595 |
| 167 | Ga0070716_100003260 | 3300006173 | Bacteria | 7622 |
| 168 | Ga0070716_100003551 | 3300006173 | Bacteria | 7361 |
| 169 | Ga0070716_100006703 | 3300006173 | Bacteria | 5641 |
| 170 | Ga0070716_100062535 | 3300006173 | Bacteria | 2158 |
| 171 | Ga0070716_100180654 | 3300006173 | Bacteria | 1385 |
| 172 | Ga0070712_100000340 | 3300006175 | Bacteria | 26355 |
| 173 | Ga0070712_100001045 | 3300006175 | Bacteria | 16718 |
| 174 | Ga0070712_100002589 | 3300006175 | Bacteria | 11179 |
| 175 | Ga0070712_100003020 | 3300006175 | Bacteria | 10412 |
| 176 | Ga0070712_100003173 | 3300006175 | Bacteria | 10127 |
| 177 | Ga0070712_100005954 | 3300006175 | Bacteria | 7538 |
| 178 | Ga0070712_100089675 | 3300006175 | Unclassified | 2250 |
| 179 | Ga0097621_100028124 | 3300006237 | Bacteria | 4429 |
| 180 | Ga0068871_100068619 | 3300006358 | Bacteria | 2911 |
| 181 | Ga0075428_100000099 | 3300006844 | Bacteria | 72800 |
| 182 | Ga0075428_100005868 | 3300006844 | Bacteria | 13646 |
| 183 | Ga0075434_100001284 | 3300006871 | Bacteria | 20946 |
| 184 | Ga0075434_100002596 | 3300006871 | Bacteria | 15947 |
| 185 | Ga0068865_100007877 | 3300006881 | Bacteria | 6575 |
| 186 | Ga0097620_100004950 | 3300006931 | Bacteria | 13535 |
| 187 | Ga0097620_100265684 | 3300006931 | Bacteria | 1808 |
| 188 | Ga0075435_100004417 | 3300007076 | Bacteria | 9654 |
| 189 | Ga0099794_10016565 | 3300007265 | Bacteria | 3270 |
| 190 | Ga0099794_10022719 | 3300007265 | Bacteria | 2861 |
| 191 | Ga0105240_10022103 | 3300009093 | Bacteria | 8442 |
| 192 | Ga0105240_10096230 | 3300009093 | Bacteria | 3609 |
| 193 | Ga0105240_10159352 | 3300009093 | Bacteria | 2682 |
| 194 | Ga0105240_10289601 | 3300009093 | Bacteria | 1878 |
| 195 | Ga0111539_10676782 | 3300009094 | Bacteria | 1201 |
| 196 | Ga0105245_10002320 | 3300009098 | Bacteria | 17210 |
| 197 | Ga0105245_10010241 | 3300009098 | Bacteria | 8164 |
| 198 | Ga0105245_10219522 | 3300009098 | Bacteria | 1834 |
| 199 | Ga0105247_10009920 | 3300009101 | Bacteria | 5769 |
| 200 | Ga0105241_10050454 | 3300009174 | Bacteria | 3171 |
| 201 | Ga0105241_10051379 | 3300009174 | Bacteria | 3143 |
| 202 | Ga0105241_10082150 | 3300009174 | Unclassified | 2525 |
| 203 | Ga0105242_10016155 | 3300009176 | Bacteria | 5799 |
| 204 | Ga0105242_10213773 | 3300009176 | Bacteria | 1720 |
| 205 | Ga0105248_10073600 | 3300009177 | Bacteria | 3839 |
| 206 | Ga0105238_10104554 | 3300009551 | Bacteria | 2813 |
| 207 | Ga0105238_10173094 | 3300009551 | Bacteria | 2135 |
| 208 | Ga0105249_10013083 | 3300009553 | Bacteria | 7327 |
| 209 | Ga0105249_10130349 | 3300009553 | Bacteria | 2400 |
| 210 | Ga0105249_10383364 | 3300009553 | Bacteria | 1432 |
| 211 | Ga0105239_10007719 | 3300010375 | Bacteria | 12313 |
| 212 | Ga0105239_10060543 | 3300010375 | Bacteria | 4155 |
| 213 | Ga0105239_10241074 | 3300010375 | Bacteria | 2029 |
| 214 | Ga0105246_10001796 | 3300011119 | Bacteria | 12836 |
| 215 | Ga0157373_10008624 | 3300013100 | Bacteria | 7566 |
| 216 | Ga0157373_10062406 | 3300013100 | Bacteria | 2639 |
| 217 | Ga0157371_10010946 | 3300013102 | Bacteria | 7030 |
| 218 | Ga0157371_10238502 | 3300013102 | Bacteria | 1308 |
| 219 | Ga0157370_10046235 | 3300013104 | Bacteria | 4173 |
| 220 | Ga0157370_10054008 | 3300013104 | Unclassified | 3830 |
| 221 | Ga0157369_10010680 | 3300013105 | Bacteria | 10451 |
| 222 | Ga0157369_10089967 | 3300013105 | Unclassified | 3277 |
| 223 | Ga0157369_10117275 | 3300013105 | Unclassified | 2826 |
| 224 | Ga0157374_10014371 | 3300013296 | Bacteria | 6929 |
| 225 | Ga0157374_10018502 | 3300013296 | Bacteria | 6150 |
| 226 | Ga0157374_10050608 | 3300013296 | Bacteria | 3863 |
| 227 | Ga0157378_10075654 | 3300013297 | Bacteria | 3032 |
| 228 | Ga0157378_10095794 | 3300013297 | Bacteria | 2704 |
| 229 | Ga0157372_10001689 | 3300013307 | Bacteria | 23868 |
| 230 | Ga0157372_10031121 | 3300013307 | Bacteria | 5843 |
| 231 | Ga0157372_10317463 | 3300013307 | Bacteria | 1814 |
| 232 | Ga0157375_10028067 | 3300013308 | Bacteria | 5270 |
| 233 | Ga0163163_10000850 | 3300014325 | Bacteria | 25970 |
| 234 | Ga0163163_10036350 | 3300014325 | Bacteria | 4784 |
| 235 | Ga0163163_10045846 | 3300014325 | Bacteria | 4293 |
| 236 | Ga0163163_10231872 | 3300014325 | Bacteria | 1895 |
| 237 | Ga0157380_10094176 | 3300014326 | Bacteria | 2478 |
| 238 | Ga0182008_10010699 | 3300014497 | Bacteria | 4905 |
| 239 | Ga0157377_10000535 | 3300014745 | Bacteria | 16132 |
| 240 | Ga0157379_10028884 | 3300014968 | Bacteria | 4932 |
| 241 | Ga0157376_10005692 | 3300014969 | Bacteria | 8730 |
| 242 | Ga0157376_10036676 | 3300014969 | Bacteria | 3973 |
| 243 | Ga0182006_1008740 | 3300015261 | Bacteria | 4582 |
| 244 | Ga0182006_1010280 | 3300015261 | Bacteria | 4168 |
| 245 | Ga0182005_1006704 | 3300015265 | Bacteria | 3495 |
| 246 | Ga0163161_10001298 | 3300017792 | Bacteria | 18632 |
| 247 | Ga0213874_10005998 | 3300021377 | Bacteria | 2857 |
| 248 | Ga0224570_101524 | 3300022730 | Bacteria | 1710 |
| 249 | Ga0224569_101211 | 3300022732 | Bacteria | 2187 |
| 250 | Ga0228598_1000061 | 3300024227 | Bacteria | 15965 |
| 251 | Ga0228598_1000687 | 3300024227 | Bacteria | 7168 |
| 252 | Ga0228598_1007740 | 3300024227 | Bacteria | 2181 |
| 253 | Ga0207697_10007464 | 3300025315 | Bacteria | 4874 |
| 254 | Ga0207656_10084667 | 3300025321 | Bacteria | 1430 |
| 255 | Ga0207656_10138597 | 3300025321 | Bacteria | 1145 |
| 256 | Ga0207682_10001380 | 3300025893 | Bacteria | 11215 |
| 257 | Ga0207692_10079457 | 3300025898 | Bacteria | 1750 |
| 258 | Ga0207642_10029081 | 3300025899 | Bacteria | 2284 |
| 259 | Ga0207710_10026910 | 3300025900 | Bacteria | 2487 |
| 260 | Ga0207688_10001352 | 3300025901 | Bacteria | 12744 |
| 261 | Ga0207680_10006311 | 3300025903 | Bacteria | 5722 |
| 262 | Ga0207647_10005760 | 3300025904 | Bacteria | 9041 |
| 263 | Ga0207685_10009497 | 3300025905 | Bacteria | 2828 |
| 264 | Ga0207685_10051162 | 3300025905 | Bacteria | 1595 |
| 265 | Ga0207699_10001110 | 3300025906 | Bacteria | 12729 |
| 266 | Ga0207699_10004886 | 3300025906 | Bacteria | 6416 |
| 267 | Ga0207699_10037285 | 3300025906 | Bacteria | 2778 |
| 268 | Ga0207699_10044556 | 3300025906 | Bacteria | 2583 |
| 269 | Ga0207699_10068357 | 3300025906 | Bacteria | 2163 |
| 270 | Ga0207699_10172077 | 3300025906 | Unclassified | 1449 |
| 271 | Ga0207645_10000069 | 3300025907 | Bacteria | 75174 |
| 272 | Ga0207643_10005786 | 3300025908 | Bacteria | 6607 |
| 273 | Ga0207643_10009653 | 3300025908 | Bacteria | 5182 |
| 274 | Ga0207705_10458096 | 3300025909 | Unclassified | 989 |
| 275 | Ga0207684_10001311 | 3300025910 | Bacteria | 27341 |
| 276 | Ga0207684_10024057 | 3300025910 | Bacteria | 5197 |
| 277 | Ga0207654_10031178 | 3300025911 | Bacteria | 2934 |
| 278 | Ga0207654_10037191 | 3300025911 | Bacteria | 2723 |
| 279 | Ga0207707_10002140 | 3300025912 | Bacteria | 17887 |
| 280 | Ga0207707_10030298 | 3300025912 | Unclassified | 4734 |
| 281 | Ga0207695_10119919 | 3300025913 | Unclassified | 2600 |
| 282 | Ga0207671_10259258 | 3300025914 | Bacteria | 1368 |
| 283 | Ga0207693_10000038 | 3300025915 | Bacteria | 109225 |
| 284 | Ga0207693_10000182 | 3300025915 | Bacteria | 57166 |
| 285 | Ga0207693_10003133 | 3300025915 | Bacteria | 14225 |
| 286 | Ga0207693_10005353 | 3300025915 | Bacteria | 10723 |
| 287 | Ga0207693_10008388 | 3300025915 | Bacteria | 8455 |
| 288 | Ga0207693_10009178 | 3300025915 | Bacteria | 8077 |
| 289 | Ga0207663_10003648 | 3300025916 | Bacteria | 7563 |
| 290 | Ga0207663_10024132 | 3300025916 | Bacteria | 3499 |
| 291 | Ga0207663_10058857 | 3300025916 | Bacteria | 2428 |
| 292 | Ga0207663_10128455 | 3300025916 | Bacteria | 1747 |
| 293 | Ga0207660_10000064 | 3300025917 | Bacteria | 55686 |
| 294 | Ga0207660_10108483 | 3300025917 | Bacteria | 2085 |
| 295 | Ga0207660_10440099 | 3300025917 | Bacteria | 1053 |
| 296 | Ga0207662_10008546 | 3300025918 | Bacteria | 5612 |
| 297 | Ga0207657_10000217 | 3300025919 | Bacteria | 59841 |
| 298 | Ga0207657_10011100 | 3300025919 | Bacteria | 8954 |
| 299 | Ga0207649_10008473 | 3300025920 | Bacteria | 5607 |
| 300 | Ga0207652_10002404 | 3300025921 | Bacteria | 15803 |
| 301 | Ga0207652_10250274 | 3300025921 | Bacteria | 1598 |
| 302 | Ga0207646_10001857 | 3300025922 | Bacteria | 25474 |
| 303 | Ga0207646_10060331 | 3300025922 | Bacteria | 3387 |
| 304 | Ga0207646_10115803 | 3300025922 | Bacteria | 2407 |
| 305 | Ga0207646_10231266 | 3300025922 | Bacteria | 1670 |
| 306 | Ga0207681_10011657 | 3300025923 | Bacteria | 5404 |
| 307 | Ga0207681_10024111 | 3300025923 | Bacteria | 3901 |
| 308 | Ga0207650_10000416 | 3300025925 | Bacteria | 37860 |
| 309 | Ga0207650_10052316 | 3300025925 | Bacteria | 3025 |
| 310 | Ga0207687_10005810 | 3300025927 | Bacteria | 8164 |
| 311 | Ga0207687_10006118 | 3300025927 | Bacteria | 7966 |
| 312 | Ga0207687_10150264 | 3300025927 | Bacteria | 1776 |
| 313 | Ga0207700_10000217 | 3300025928 | Bacteria | 34284 |
| 314 | Ga0207700_10001212 | 3300025928 | Bacteria | 14785 |
| 315 | Ga0207700_10002922 | 3300025928 | Bacteria | 9852 |
| 316 | Ga0207700_10015985 | 3300025928 | Bacteria | 4972 |
| 317 | Ga0207700_10176573 | 3300025928 | Bacteria | 1785 |
| 318 | Ga0207700_10333641 | 3300025928 | Unclassified | 1317 |
| 319 | Ga0207700_10601545 | 3300025928 | Unclassified | 978 |
| 320 | Ga0207664_10000414 | 3300025929 | Bacteria | 30456 |
| 321 | Ga0207664_10010642 | 3300025929 | Bacteria | 6503 |
| 322 | Ga0207664_10163691 | 3300025929 | Bacteria | 1899 |
| 323 | Ga0207664_10186744 | 3300025929 | Bacteria | 1782 |
| 324 | Ga0207664_10232064 | 3300025929 | Bacteria | 1604 |
| 325 | Ga0207644_10000489 | 3300025931 | Bacteria | 25447 |
| 326 | Ga0207690_10080881 | 3300025932 | Bacteria | 2269 |
| 327 | Ga0207690_10144929 | 3300025932 | Bacteria | 1755 |
| 328 | Ga0207706_10007326 | 3300025933 | Bacteria | 10202 |
| 329 | Ga0207706_10012998 | 3300025933 | Bacteria | 7575 |
| 330 | Ga0207706_10072460 | 3300025933 | Bacteria | 3030 |
| 331 | Ga0207706_10234569 | 3300025933 | Bacteria | 1604 |
| 332 | Ga0207686_10009222 | 3300025934 | Bacteria | 5351 |
| 333 | Ga0207704_10050829 | 3300025938 | Bacteria | 2503 |
| 334 | Ga0207665_10001393 | 3300025939 | Bacteria | 16271 |
| 335 | Ga0207665_10007198 | 3300025939 | Bacteria | 7361 |
| 336 | Ga0207665_10017505 | 3300025939 | Bacteria | 4710 |
| 337 | Ga0207665_10022780 | 3300025939 | Bacteria | 4123 |
| 338 | Ga0207665_10112561 | 3300025939 | Bacteria | 1914 |
| 339 | Ga0207665_10123572 | 3300025939 | Unclassified | 1830 |
| 340 | Ga0207665_10283900 | 3300025939 | Bacteria | 1233 |
| 341 | Ga0207691_10001375 | 3300025940 | Bacteria | 24284 |
| 342 | Ga0207711_10012249 | 3300025941 | Bacteria | 7130 |
| 343 | Ga0207711_10049412 | 3300025941 | Bacteria | 3602 |
| 344 | Ga0207689_10006810 | 3300025942 | Bacteria | 10054 |
| 345 | Ga0207689_10018519 | 3300025942 | Bacteria | 5875 |
| 346 | Ga0207689_10029835 | 3300025942 | Bacteria | 4548 |
| 347 | Ga0207689_10229576 | 3300025942 | Bacteria | 1534 |
| 348 | Ga0207661_10010921 | 3300025944 | Bacteria | 6557 |
| 349 | Ga0207679_10000120 | 3300025945 | Bacteria | 63924 |
| 350 | Ga0207667_10009748 | 3300025949 | Bacteria | 11294 |
| 351 | Ga0207667_10033752 | 3300025949 | Bacteria | 5499 |
| 352 | Ga0207667_10118490 | 3300025949 | Bacteria | 2728 |
| 353 | Ga0207651_10009101 | 3300025960 | Bacteria | 5407 |
| 354 | Ga0207712_10172276 | 3300025961 | Bacteria | 1693 |
| 355 | Ga0207668_10034231 | 3300025972 | Bacteria | 3372 |
| 356 | Ga0207640_10272291 | 3300025981 | Bacteria | 1325 |
| 357 | Ga0207658_10010665 | 3300025986 | Bacteria | 6246 |
| 358 | Ga0207677_10008083 | 3300026023 | Bacteria | 5856 |
| 359 | Ga0207703_10307768 | 3300026035 | Bacteria | 1447 |
| 360 | Ga0207639_10004056 | 3300026041 | Bacteria | 9879 |
| 361 | Ga0207639_10010241 | 3300026041 | Bacteria | 6487 |
| 362 | Ga0207639_10030949 | 3300026041 | Bacteria | 3930 |
| 363 | Ga0207678_10001451 | 3300026067 | Bacteria | 21777 |
| 364 | Ga0207708_10147310 | 3300026075 | Bacteria | 1851 |
| 365 | Ga0207702_10027171 | 3300026078 | Bacteria | 4752 |
| 366 | Ga0207702_10057668 | 3300026078 | Bacteria | 3302 |
| 367 | Ga0207702_10085385 | 3300026078 | Bacteria | 2750 |
| 368 | Ga0207702_10107505 | 3300026078 | Bacteria | 2474 |
| 369 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 370 | Ga0207641_10337876 | 3300026088 | Bacteria | 1432 |
| 371 | Ga0207648_10000546 | 3300026089 | Bacteria | 42051 |
| 372 | Ga0207648_10028022 | 3300026089 | Bacteria | 4998 |
| 373 | Ga0207676_10000417 | 3300026095 | Bacteria | 36070 |
| 374 | Ga0207676_10195183 | 3300026095 | Bacteria | 1785 |
| 375 | Ga0207674_10000566 | 3300026116 | Bacteria | 48425 |
| 376 | Ga0207674_10430183 | 3300026116 | Bacteria | 1276 |
| 377 | Ga0207675_100009894 | 3300026118 | Bacteria | 8920 |
| 378 | Ga0207675_100047375 | 3300026118 | Bacteria | 4013 |
| 379 | Ga0207683_10001155 | 3300026121 | Bacteria | 24032 |
| 380 | Ga0207683_10037223 | 3300026121 | Bacteria | 4237 |
| 381 | Ga0207698_10018922 | 3300026142 | Bacteria | 4703 |
| 382 | Ga0209588_1005826 | 3300027671 | Bacteria | 3549 |
| 383 | Ga0265354_1001498 | 3300028016 | Bacteria | 3302 |
| 384 | Ga0265356_1000309 | 3300028017 | Bacteria | 9112 |
| 385 | Ga0268266_10002040 | 3300028379 | Bacteria | 22418 |
| 386 | Ga0268266_10243290 | 3300028379 | Bacteria | 1661 |
| 387 | Ga0268265_10002458 | 3300028380 | Bacteria | 13941 |
| 388 | Ga0268264_10002179 | 3300028381 | Bacteria | 17422 |
| 389 | Ga0265338_10015603 | 3300028800 | Bacteria | 8325 |
| 390 | Ga0265338_10029924 | 3300028800 | Bacteria | 5384 |
| 391 | Ga0265338_10106664 | 3300028800 | Bacteria | 2267 |
| 392 | Ga0265338_10121027 | 3300028800 | Bacteria | 2086 |
| 393 | Ga0265338_10186053 | 3300028800 | Unclassified | 1579 |
| 394 | Ga0265762_1000635 | 3300030760 | Bacteria | 6176 |
| 395 | Ga0265762_1001637 | 3300030760 | Bacteria | 4078 |
| 396 | Ga0265762_1002224 | 3300030760 | Unclassified | 3511 |
| 397 | Ga0265762_1033635 | 3300030760 | Bacteria | 982 |
| 398 | Ga0265760_10000193 | 3300031090 | Bacteria | 16134 |
| 399 | Ga0265760_10001146 | 3300031090 | Bacteria | 7711 |
| 400 | Ga0265760_10048401 | 3300031090 | Bacteria | 1277 |
| 401 | Ga0265328_10023226 | 3300031239 | Bacteria | 2355 |
| 402 | Ga0265325_10003919 | 3300031241 | Bacteria | 9530 |
| 403 | Ga0265325_10117091 | 3300031241 | Bacteria | 1288 |
| 404 | Ga0265325_10154828 | 3300031241 | Bacteria | 1082 |
| 405 | Ga0265340_10036097 | 3300031247 | Bacteria | 2452 |
| 406 | Ga0265339_10015289 | 3300031249 | Bacteria | 4604 |
| 407 | Ga0265339_10034680 | 3300031249 | Bacteria | 2834 |
| 408 | Ga0265339_10053455 | 3300031249 | Unclassified | 2197 |
| 409 | Ga0265339_10107573 | 3300031249 | Bacteria | 1446 |
| 410 | Ga0265316_10041516 | 3300031344 | Bacteria | 3681 |
| 411 | Ga0265316_10071120 | 3300031344 | Bacteria | 2682 |
| 412 | Ga0265314_10003366 | 3300031711 | Bacteria | 15501 |
| 413 | Ga0265314_10017964 | 3300031711 | Bacteria | 5534 |
| 414 | Ga0265342_10011481 | 3300031712 | Bacteria | 6061 |
| 415 | Ga0316214_1003119 | 3300033545 | Bacteria | 2079 |
| 416 | Ga0373926_0016904 | 3300035083 | Bacteria | 2500 |
| 417 | Ga0373934_0151142 | 3300035086 | Unclassified | 951 |
| 418 | Ga0373944_0013304 | 3300035089 | Bacteria | 2280 |
| 419 | Ga0373936_0006256 | 3300035113 | Bacteria | 4490 |
| 420 | Ga0373936_0008642 | 3300035113 | Bacteria | 3834 |
| 421 | Ga0373936_0101667 | 3300035113 | Bacteria | 1213 |
| 422 | Ga0373945_0000872 | 3300035116 | Bacteria | 8910 |
| 423 | Ga0373945_0020585 | 3300035116 | Bacteria | 2259 |
| 424 | Ga0373945_0033686 | 3300035116 | Bacteria | 1822 |
| 425 | Ga0373953_0157143 | 3300035117 | Bacteria | 976 |
| 426 | Ga0373956_0057132 | 3300035119 | Bacteria | 1763 |
| 427 | Ga0373957_0002345 | 3300035120 | Bacteria | 5383 |
| 428 | Ga0373943_0002667 | 3300035170 | Bacteria | 8125 |
| 429 | Ga0373943_0005384 | 3300035170 | Bacteria | 5759 |
| 430 | Ga0373943_0082260 | 3300035170 | Unclassified | 1653 |
| 431 | Ga0373943_0221142 | 3300035170 | Bacteria | 1055 |
| 432 | Ga0373946_0005783 | 3300035171 | Bacteria | 4473 |
| 433 | Ga0373946_0026981 | 3300035171 | Bacteria | 2269 |
| 434 | Ga0373946_0200923 | 3300035171 | Bacteria | 955 |
| 435 | Ga0373955_0006956 | 3300035172 | Bacteria | 5176 |
| 436 | Ga0373955_0291370 | 3300035172 | Bacteria | 983 |
| 437 | Ga0373924_0000033 | 3300035410 | Bacteria | 35461 |
| 438 | Ga0373924_0014465 | 3300035410 | Bacteria | 2983 |
| 439 | Ga0373924_0030333 | 3300035410 | Bacteria | 2167 |
| 440 | Ga0373935_0000723 | 3300035692 | Bacteria | 17580 |
| 441 | Ga0373935_0009713 | 3300035692 | Bacteria | 5761 |
| 442 | Ga0373935_0022591 | 3300035692 | Bacteria | 3859 |
| 443 | Ga0373935_0191381 | 3300035692 | Bacteria | 1409 |
| 444 | Ga0373927_0000297 | 3300035695 | Bacteria | 39222 |
| 445 | Ga0373927_0068529 | 3300035695 | Bacteria | 2296 |
| 446 | Ga0373927_0216757 | 3300035695 | Bacteria | 1257 |
| 447 | Ga0373933_0018335 | 3300035724 | Bacteria | 3935 |
| 448 | Ga0373933_0020408 | 3300035724 | Bacteria | 3755 |
| 449 | Ga0373947_0023967 | 3300035725 | Bacteria | 3553 |
| 450 | Ga0373947_0027393 | 3300035725 | Bacteria | 3335 |
| 451 | Ga0373947_0047580 | 3300035725 | Unclassified | 2571 |
| 452 | Ga0373947_0141249 | 3300035725 | Bacteria | 1544 |
| 453 | Ga0373937_0002928 | 3300036401 | Bacteria | 14276 |
| 454 | Ga0373937_0010493 | 3300036401 | Bacteria | 8090 |
| 455 | Ga0373937_0018616 | 3300036401 | Bacteria | 6204 |
| 456 | Ga0373937_0033071 | 3300036401 | Bacteria | 4694 |
| 457 | Ga0373937_0053141 | 3300036401 | Bacteria | 3716 |
| 458 | Ga0373937_0065238 | 3300036401 | Bacteria | 3351 |
| 459 | Ga0373937_0145838 | 3300036401 | Bacteria | 2216 |
| 460 | Ga0373937_0165664 | 3300036401 | Bacteria | 2073 |
| 461 | Ga0316584_0056681 | 3300036712 | Bacteria | 2933 |
| 462 | Ga0316584_0116110 | 3300036712 | Bacteria | 2002 |
| 463 | Ga0373925_0000684 | 3300037068 | Bacteria | 31822 |
| 464 | Ga0373925_0012023 | 3300037068 | Bacteria | 6268 |
| 465 | Ga0373925_0013265 | 3300037068 | Bacteria | 5964 |
| 466 | Ga0373925_0017480 | 3300037068 | Bacteria | 5198 |
| 467 | Ga0373925_0137028 | 3300037068 | Bacteria | 1913 |
| 468 | Ga0373925_0259602 | 3300037068 | Bacteria | 1395 |
| 469 | Ga0395900_0191558 | 3300037418 | Unclassified | 2074 |
| 470 | Ga0395901_0289934 | 3300038443 | Unclassified | 1699 |
| 471 | Ga0436363_0379760 | 3300039450 | Bacteria | 3464 |
| 472 | Ga0436363_1066446 | 3300039450 | Bacteria | 1273 |
| 473 | Ga0436362_0226101 | 3300039453 | Bacteria | 2658 |
| 474 | Ga0436362_1103826 | 3300039453 | Bacteria | 2928 |
| 475 | Ga0451577_0135601 | 3300042876 | Bacteria | 2210 |
| 476 | Ga0466963_0006934 | 3300044694 | Bacteria | 6740 |
| 477 | Ga0466957_0007239 | 3300044842 | Bacteria | 6272 |
| 478 | Ga0466957_0130583 | 3300044842 | Bacteria | 1609 |
| 479 | Ga0466957_0243859 | 3300044842 | Bacteria | 1193 |
| 480 | Ga0466957_0379528 | 3300044842 | Bacteria | 964 |
| 481 | Ga0466959_0041003 | 3300045049 | Bacteria | 3419 |
| 482 | Ga0466967_0007320 | 3300045976 | Bacteria | 7949 |
| 483 | Ga0466967_0009616 | 3300045976 | Bacteria | 7186 |
| 484 | Ga0495592_0185654 | 3300046454 | Bacteria | 1413 |
| 485 | Ga0495603_0092898 | 3300046455 | Bacteria | 1764 |
| 486 | Ga0495603_0112811 | 3300046455 | Bacteria | 1585 |
| 487 | Ga0495629_0000065 | 3300046459 | Bacteria | 93747 |
| 488 | Ga0495629_0012021 | 3300046459 | Bacteria | 6275 |
| 489 | Ga0495651_0087723 | 3300046462 | Bacteria | 2339 |
| 490 | Ga0495580_0004509 | 3300046472 | Bacteria | 11696 |
| 491 | Ga0495580_0004931 | 3300046472 | Bacteria | 11155 |
| 492 | Ga0495580_0018653 | 3300046472 | Bacteria | 5163 |
| 493 | Ga0495580_0032970 | 3300046472 | Bacteria | 3732 |
| 494 | Ga0495580_0066761 | 3300046472 | Bacteria | 2517 |
| 495 | Ga0495580_0100270 | 3300046472 | Bacteria | 2014 |
| 496 | Ga0495580_0264236 | 3300046472 | Bacteria | 1176 |
| 497 | Ga0495580_0284918 | 3300046472 | Bacteria | 1127 |
| 498 | Ga0495582_0053997 | 3300046473 | Bacteria | 2216 |
| 499 | Ga0495582_0147818 | 3300046473 | Bacteria | 1333 |
| 500 | Ga0495639_0004865 | 3300046475 | Bacteria | 5763 |
| 501 | Ga0495639_0101365 | 3300046475 | Bacteria | 1359 |
| 502 | Ga0495664_0006322 | 3300046477 | Bacteria | 6544 |
| 503 | Ga0495664_0071311 | 3300046477 | Bacteria | 2075 |
| 504 | Ga0495594_0010861 | 3300046499 | Bacteria | 4729 |
| 505 | Ga0495594_0040837 | 3300046499 | Bacteria | 2540 |
| 506 | Ga0495608_0105424 | 3300046511 | Bacteria | 1815 |
| 507 | Ga0495630_0129587 | 3300046517 | Bacteria | 1915 |
| 508 | Ga0495652_0275639 | 3300046529 | Bacteria | 1234 |
| 509 | Ga0495640_0023686 | 3300046533 | Bacteria | 4468 |
| 510 | Ga0495645_0422154 | 3300046543 | Bacteria | 846 |
| 511 | Ga0495634_0074288 | 3300046642 | Bacteria | 2234 |
| 512 | Ga0495635_0002612 | 3300046663 | Bacteria | 12332 |
| 513 | Ga0495599_0209399 | 3300046678 | Unclassified | 1196 |
| 514 | Ga0495623_0002920 | 3300046679 | Bacteria | 11248 |
| 515 | Ga0495623_0164924 | 3300046679 | Unclassified | 1299 |
| 516 | Ga0495647_0060389 | 3300046681 | Bacteria | 1494 |
| 517 | Ga0495658_0000013 | 3300046683 | Bacteria | 98426 |
| 518 | Ga0495658_0027496 | 3300046683 | Bacteria | 3062 |
| 519 | Ga0495669_0032391 | 3300046684 | Bacteria | 2298 |
| 520 | Ga0495613_0001534 | 3300046689 | Bacteria | 17575 |
| 521 | Ga0495581_0014954 | 3300047315 | Bacteria | 4502 |
| 522 | Ga0495581_0150795 | 3300047315 | Bacteria | 1357 |
| 523 | Ga0495604_0070773 | 3300047317 | Bacteria | 2641 |
| 524 | Ga0495674_0079170 | 3300047319 | Bacteria | 2822 |
| 525 | Ga0495674_0106278 | 3300047319 | Bacteria | 2384 |
| 526 | Ga0495676_0004693 | 3300047321 | Bacteria | 12506 |
| 527 | Ga0495676_0248423 | 3300047321 | Bacteria | 1214 |
| 528 | Ga0495680_0000072 | 3300047322 | Bacteria | 87431 |
| 529 | Ga0495680_0144556 | 3300047322 | Bacteria | 1738 |
| 530 | Ga0495684_0112423 | 3300047471 | Bacteria | 2054 |
| 531 | Ga0495593_0221467 | 3300047673 | Bacteria | 949 |
| 532 | Ga0495614_0000906 | 3300048089 | Bacteria | 12609 |
| 533 | Ga0495614_0027109 | 3300048089 | Bacteria | 2471 |
| 534 | Ga0496100_0044609 | 3300048903 | Bacteria | 2841 |
| 535 | Ga0496101_0225654 | 3300048904 | Bacteria | 1455 |
| 536 | Ga0496102_0023530 | 3300048905 | Bacteria | 5474 |
| 537 | Ga0496102_0046059 | 3300048905 | Bacteria | 3960 |
| 538 | Ga0496102_0077167 | 3300048905 | Unclassified | 3066 |
| 539 | Ga0496102_0415785 | 3300048905 | Bacteria | 1263 |
| 540 | Ga0496103_0076671 | 3300048906 | Bacteria | 2098 |
| 541 | Ga0496104_0035311 | 3300048907 | Bacteria | 4668 |
| 542 | Ga0496104_0104660 | 3300048907 | Bacteria | 2712 |
| 543 | Ga0496105_0002203 | 3300048908 | Bacteria | 14114 |
| 544 | Ga0496105_0415499 | 3300048908 | Unclassified | 1066 |
| 545 | Ga0496106_0094029 | 3300048909 | Bacteria | 2317 |
| 546 | Ga0496107_0064753 | 3300048910 | Bacteria | 2650 |
| 547 | Ga0496108_0000095 | 3300048911 | Bacteria | 92520 |
| 548 | Ga0496108_0057686 | 3300048911 | Bacteria | 3262 |
| 549 | Ga0496109_0000243 | 3300048912 | Bacteria | 52776 |
| 550 | Ga0496109_0061060 | 3300048912 | Bacteria | 3445 |
| 551 | Ga0496110_0010266 | 3300048913 | Bacteria | 7610 |
| 552 | Ga0496110_0027838 | 3300048913 | Bacteria | 4849 |
| 553 | Ga0496110_0028225 | 3300048913 | Bacteria | 4817 |
| 554 | Ga0496111_0001306 | 3300048914 | Bacteria | 13976 |
| 555 | Ga0496111_0068894 | 3300048914 | Bacteria | 2572 |
| 556 | Ga0496111_0074205 | 3300048914 | Bacteria | 2478 |
| 557 | Ga0496112_0000038 | 3300048915 | Bacteria | 94892 |
| 558 | Ga0496112_0027316 | 3300048915 | Bacteria | 5503 |
| 559 | Ga0496112_0032608 | 3300048915 | Bacteria | 5058 |
| 560 | Ga0496113_0000145 | 3300048916 | Bacteria | 30751 |
| 561 | Ga0496113_0000169 | 3300048916 | Bacteria | 28802 |
| 562 | Ga0496114_0180447 | 3300048917 | Bacteria | 1844 |
| 563 | Ga0496115_0011881 | 3300048918 | Bacteria | 6541 |
| 564 | Ga0496115_0517939 | 3300048918 | Bacteria | 957 |
| 565 | Ga0501077_0347194 | 3300049593 | Bacteria | 947 |
| 566 | nmdc:mga08y16_744418_c1 | 3300050511 | Bacteria | 977 |
| 567 | nmdc:mga0n895_215189_c1 | 3300050512 | Bacteria | 1951 |
| 568 | nmdc:mga0n895_3333_c1 | 3300050512 | Bacteria | 12910 |
| 569 | nmdc:mga0rr50_108122_c1 | 3300050513 | Bacteria | 2197 |
| 570 | nmdc:mga0a205_731_c1 | 3300050515 | Bacteria | 26481 |
| 571 | Ga0495595_0179441 | 3300053084 | Bacteria | 1050 |
| 572 | Ga0495619_0001673 | 3300053085 | Bacteria | 14653 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0135601 | Ga0451577_0135601_914_1669 | 237 |
| 2 | 3300006871 | Ga0075434_100002596 | Ga0075434_1000025963 | 242 |
| 3 | 3300007076 | Ga0075435_100004417 | Ga0075435_1000044172 | 242 |
| 4 | 3300035172 | Ga0373955_0291370 | Ga0373955_0291370_140_898 | 242 |
| 5 | 3300050512 | nmdc:mga0n895_3333_c1 | nmdc:mga0n895_3333_c1_1474_2346 | 242 |
| 6 | 3300050513 | nmdc:mga0rr50_108122_c1 | nmdc:mga0rr50_108122_c1_249_1121 | 242 |
| 7 | 3300050515 | nmdc:mga0a205_731_c1 | nmdc:mga0a205_731_c1_15836_16708 | 242 |
| 8 | 3300005457 | Ga0070662_100051928 | Ga0070662_1000519282 | 252 |
| 9 | 3300005545 | Ga0070695_100003295 | Ga0070695_1000032953 | 252 |
| 10 | 3300014326 | Ga0157380_10094176 | Ga0157380_100941762 | 252 |
| 11 | 3300025933 | Ga0207706_10072460 | Ga0207706_100724603 | 252 |
| 12 | 3300000546 | LJNas_1000712 | LJNas_10007124 | 253 |
| 13 | 3300046543 | Ga0495645_0422154 | Ga0495645_0422154_24_800 | 256 |
| 14 | 3300048914 | Ga0496111_0068894 | Ga0496111_0068894_23_799 | 257 |
| 15 | 3300039453 | Ga0436362_1103826 | Ga0436362_1103826_2116_2907 | 258 |
| 16 | 3300046455 | Ga0495603_0092898 | Ga0495603_0092898_786_1625 | 262 |
| 17 | 3300046459 | Ga0495629_0012021 | Ga0495629_0012021_2474_3313 | 262 |
| 18 | 3300046475 | Ga0495639_0004865 | Ga0495639_0004865_2311_3150 | 262 |
| 19 | 3300047315 | Ga0495581_0014954 | Ga0495581_0014954_3534_4373 | 262 |
| 20 | 3300047321 | Ga0495676_0004693 | Ga0495676_0004693_5836_6675 | 262 |
| 21 | 3300028379 | Ga0268266_10243290 | Ga0268266_102432902 | 263 |
| 22 | 3300046459 | Ga0495629_0000065 | Ga0495629_0000065_11352_12176 | 263 |
| 23 | 3300046473 | Ga0495582_0053997 | Ga0495582_0053997_286_1110 | 263 |
| 24 | 3300046475 | Ga0495639_0101365 | Ga0495639_0101365_426_1250 | 263 |
| 25 | 3300046499 | Ga0495594_0040837 | Ga0495594_0040837_1344_2168 | 263 |
| 26 | 3300046533 | Ga0495640_0023686 | Ga0495640_0023686_162_986 | 263 |
| 27 | 3300046642 | Ga0495634_0074288 | Ga0495634_0074288_979_1803 | 263 |
| 28 | 3300046663 | Ga0495635_0002612 | Ga0495635_0002612_8836_9660 | 263 |
| 29 | 3300046681 | Ga0495647_0060389 | Ga0495647_0060389_14_838 | 263 |
| 30 | 3300046683 | Ga0495658_0000013 | Ga0495658_0000013_29777_30601 | 263 |
| 31 | 3300046689 | Ga0495613_0001534 | Ga0495613_0001534_13455_14279 | 263 |
| 32 | 3300047315 | Ga0495581_0150795 | Ga0495581_0150795_407_1231 | 263 |
| 33 | 3300047321 | Ga0495676_0248423 | Ga0495676_0248423_19_843 | 263 |
| 34 | 3300047322 | Ga0495680_0000072 | Ga0495680_0000072_56482_57306 | 263 |
| 35 | 3300048089 | Ga0495614_0000906 | Ga0495614_0000906_5013_5837 | 263 |
| 36 | 3300053085 | Ga0495619_0001673 | Ga0495619_0001673_11417_12241 | 263 |
| 37 | 3300036401 | Ga0373937_0145838 | Ga0373937_0145838_133_1005 | 264 |
| 38 | 3300005333 | Ga0070677_10003474 | Ga0070677_100034743 | 266 |
| 39 | 3300005367 | Ga0070667_100096344 | Ga0070667_1000963442 | 266 |
| 40 | 3300026075 | Ga0207708_10147310 | Ga0207708_101473102 | 266 |
| 41 | 3300035170 | Ga0373943_0082260 | Ga0373943_0082260_666_1526 | 266 |
| 42 | 3300035410 | Ga0373924_0030333 | Ga0373924_0030333_1140_2000 | 266 |
| 43 | 3300035725 | Ga0373947_0047580 | Ga0373947_0047580_1080_1940 | 266 |
| 44 | 3300047322 | Ga0495680_0144556 | Ga0495680_0144556_33_881 | 266 |
| 45 | 3300005331 | Ga0070670_100042640 | Ga0070670_1000426404 | 267 |
| 46 | 3300005335 | Ga0070666_10274844 | Ga0070666_102748442 | 267 |
| 47 | 3300005456 | Ga0070678_100037841 | Ga0070678_1000378413 | 267 |
| 48 | 3300005548 | Ga0070665_100009022 | Ga0070665_1000090223 | 267 |
| 49 | 3300005564 | Ga0070664_100254223 | Ga0070664_1002542232 | 267 |
| 50 | 3300005618 | Ga0068864_100074565 | Ga0068864_1000745653 | 267 |
| 51 | 3300005843 | Ga0068860_100059040 | Ga0068860_1000590404 | 267 |
| 52 | 3300006844 | Ga0075428_100000099 | Ga0075428_1000000999 | 267 |
| 53 | 3300014325 | Ga0163163_10036350 | Ga0163163_100363502 | 267 |
| 54 | 3300025893 | Ga0207682_10001380 | Ga0207682_100013809 | 267 |
| 55 | 3300025925 | Ga0207650_10052316 | Ga0207650_100523162 | 267 |
| 56 | 3300025933 | Ga0207706_10234569 | Ga0207706_102345692 | 267 |
| 57 | 3300026089 | Ga0207648_10028022 | Ga0207648_100280225 | 267 |
| 58 | 3300026121 | Ga0207683_10037223 | Ga0207683_100372232 | 267 |
| 59 | 3300005841 | Ga0068863_100359978 | Ga0068863_1003599782 | 268 |
| 60 | 3300005937 | Ga0081455_10024699 | Ga0081455_100246993 | 268 |
| 61 | 3300026088 | Ga0207641_10337876 | Ga0207641_103378762 | 268 |
| 62 | 3300009553 | Ga0105249_10383364 | Ga0105249_103833642 | 270 |
| 63 | 3300025961 | Ga0207712_10172276 | Ga0207712_101722762 | 270 |
| 64 | 3300005445 | Ga0070708_100197058 | Ga0070708_1001970582 | 272 |
| 65 | 3300005536 | Ga0070697_100044885 | Ga0070697_1000448853 | 272 |
| 66 | 3300044842 | Ga0466957_0130583 | Ga0466957_0130583_381_1217 | 273 |
| 67 | 3300005445 | Ga0070708_100000898 | Ga0070708_10000089821 | 274 |
| 68 | 3300005518 | Ga0070699_100109505 | Ga0070699_1001095053 | 274 |
| 69 | 3300005530 | Ga0070679_100228259 | Ga0070679_1002282592 | 274 |
| 70 | 3300005536 | Ga0070697_100008683 | Ga0070697_1000086833 | 274 |
| 71 | 3300006173 | Ga0070716_100180654 | Ga0070716_1001806542 | 274 |
| 72 | 3300007265 | Ga0099794_10016565 | Ga0099794_100165654 | 274 |
| 73 | 3300007265 | Ga0099794_10022719 | Ga0099794_100227192 | 274 |
| 74 | 3300027671 | Ga0209588_1005826 | Ga0209588_10058263 | 274 |
| 75 | 3300053084 | Ga0495595_0179441 | Ga0495595_0179441_130_978 | 274 |
| 76 | 3300005617 | Ga0068859_100265693 | Ga0068859_1002656932 | 276 |
| 77 | 3300006931 | Ga0097620_100265684 | Ga0097620_1002656842 | 276 |
| 78 | 3300005434 | Ga0070709_10000339 | Ga0070709_100003396 | 277 |
| 79 | 3300005436 | Ga0070713_100000590 | Ga0070713_10000059017 | 277 |
| 80 | 3300005437 | Ga0070710_10046337 | Ga0070710_100463372 | 277 |
| 81 | 3300005439 | Ga0070711_100022800 | Ga0070711_1000228003 | 277 |
| 82 | 3300006028 | Ga0070717_10044469 | Ga0070717_100444695 | 277 |
| 83 | 3300006173 | Ga0070716_100003551 | Ga0070716_1000035518 | 277 |
| 84 | 3300006175 | Ga0070712_100000340 | Ga0070712_1000003402 | 277 |
| 85 | 3300006844 | Ga0075428_100005868 | Ga0075428_1000058685 | 277 |
| 86 | 3300013296 | Ga0157374_10050608 | Ga0157374_100506083 | 277 |
| 87 | 3300025898 | Ga0207692_10079457 | Ga0207692_100794573 | 277 |
| 88 | 3300025906 | Ga0207699_10001110 | Ga0207699_100011107 | 277 |
| 89 | 3300025915 | Ga0207693_10000182 | Ga0207693_1000018236 | 277 |
| 90 | 3300025928 | Ga0207700_10000217 | Ga0207700_1000021724 | 277 |
| 91 | 3300025939 | Ga0207665_10007198 | Ga0207665_100071984 | 277 |
| 92 | 3300030760 | Ga0265762_1002224 | Ga0265762_10022243 | 277 |
| 93 | 3300031090 | Ga0265760_10048401 | Ga0265760_100484012 | 277 |
| 94 | 3300039450 | Ga0436363_1066446 | Ga0436363_1066446_259_1095 | 277 |
| 95 | 3300045976 | Ga0466967_0007320 | Ga0466967_0007320_423_1265 | 277 |
| 96 | 3300046472 | Ga0495580_0100270 | Ga0495580_0100270_945_1781 | 277 |
| 97 | 3300005437 | Ga0070710_10000881 | Ga0070710_100008816 | 278 |
| 98 | 3300006028 | Ga0070717_10035429 | Ga0070717_100354292 | 278 |
| 99 | 3300006028 | Ga0070717_10120763 | Ga0070717_101207634 | 278 |
| 100 | 3300036401 | Ga0373937_0053141 | Ga0373937_0053141_291_1217 | 278 |
| 101 | 3300036712 | Ga0316584_0056681 | Ga0316584_0056681_924_1763 | 278 |
| 102 | 3300036712 | Ga0316584_0116110 | Ga0316584_0116110_373_1254 | 278 |
| 103 | 3300044694 | Ga0466963_0006934 | Ga0466963_0006934_3514_4359 | 278 |
| 104 | 3300044842 | Ga0466957_0243859 | Ga0466957_0243859_237_1082 | 278 |
| 105 | 3300047319 | Ga0495674_0106278 | Ga0495674_0106278_800_1726 | 278 |
| 106 | 3300005336 | Ga0070680_100075542 | Ga0070680_1000755423 | 279 |
| 107 | 3300005434 | Ga0070709_10324113 | Ga0070709_103241132 | 279 |
| 108 | 3300005436 | Ga0070713_100100709 | Ga0070713_1001007093 | 279 |
| 109 | 3300005445 | Ga0070708_100025170 | Ga0070708_1000251706 | 279 |
| 110 | 3300005445 | Ga0070708_100641301 | Ga0070708_1006413011 | 279 |
| 111 | 3300005457 | Ga0070662_100051482 | Ga0070662_1000514822 | 279 |
| 112 | 3300005458 | Ga0070681_10117793 | Ga0070681_101177932 | 279 |
| 113 | 3300005535 | Ga0070684_100005398 | Ga0070684_1000053987 | 279 |
| 114 | 3300005719 | Ga0068861_100035178 | Ga0068861_1000351782 | 279 |
| 115 | 3300006028 | Ga0070717_10305421 | Ga0070717_103054212 | 279 |
| 116 | 3300009093 | Ga0105240_10159352 | Ga0105240_101593521 | 279 |
| 117 | 3300009098 | Ga0105245_10010241 | Ga0105245_100102414 | 279 |
| 118 | 3300009174 | Ga0105241_10082150 | Ga0105241_100821501 | 279 |
| 119 | 3300009551 | Ga0105238_10104554 | Ga0105238_101045544 | 279 |
| 120 | 3300009553 | Ga0105249_10130349 | Ga0105249_101303492 | 279 |
| 121 | 3300010375 | Ga0105239_10241074 | Ga0105239_102410742 | 279 |
| 122 | 3300013296 | Ga0157374_10014371 | Ga0157374_100143715 | 279 |
| 123 | 3300013297 | Ga0157378_10075654 | Ga0157378_100756543 | 279 |
| 124 | 3300014497 | Ga0182008_10010699 | Ga0182008_100106995 | 279 |
| 125 | 3300015261 | Ga0182006_1010280 | Ga0182006_10102804 | 279 |
| 126 | 3300025906 | Ga0207699_10172077 | Ga0207699_101720772 | 279 |
| 127 | 3300025908 | Ga0207643_10009653 | Ga0207643_100096532 | 279 |
| 128 | 3300025917 | Ga0207660_10108483 | Ga0207660_101084831 | 279 |
| 129 | 3300025923 | Ga0207681_10024111 | Ga0207681_100241113 | 279 |
| 130 | 3300025927 | Ga0207687_10005810 | Ga0207687_100058104 | 279 |
| 131 | 3300025928 | Ga0207700_10015985 | Ga0207700_100159852 | 279 |
| 132 | 3300025928 | Ga0207700_10333641 | Ga0207700_103336411 | 279 |
| 133 | 3300025928 | Ga0207700_10601545 | Ga0207700_106015451 | 279 |
| 134 | 3300025932 | Ga0207690_10144929 | Ga0207690_101449292 | 279 |
| 135 | 3300025933 | Ga0207706_10012998 | Ga0207706_100129982 | 279 |
| 136 | 3300025942 | Ga0207689_10018519 | Ga0207689_100185195 | 279 |
| 137 | 3300026041 | Ga0207639_10030949 | Ga0207639_100309492 | 279 |
| 138 | 3300026118 | Ga0207675_100009894 | Ga0207675_1000098945 | 279 |
| 139 | 3300028800 | Ga0265338_10029924 | Ga0265338_100299247 | 279 |
| 140 | 3300030760 | Ga0265762_1000635 | Ga0265762_10006353 | 279 |
| 141 | 3300031239 | Ga0265328_10023226 | Ga0265328_100232262 | 279 |
| 142 | 3300031241 | Ga0265325_10154828 | Ga0265325_101548281 | 279 |
| 143 | 3300031249 | Ga0265339_10034680 | Ga0265339_100346802 | 279 |
| 144 | 3300031344 | Ga0265316_10071120 | Ga0265316_100711203 | 279 |
| 145 | 3300046472 | Ga0495580_0284918 | Ga0495580_0284918_227_1069 | 279 |
| 146 | 3300048908 | Ga0496105_0415499 | Ga0496105_0415499_80_928 | 279 |
| 147 | 3300048913 | Ga0496110_0027838 | Ga0496110_0027838_1228_2079 | 279 |
| 148 | 3300048914 | Ga0496111_0001306 | Ga0496111_0001306_9011_9862 | 279 |
| 149 | 3300048918 | Ga0496115_0517939 | Ga0496115_0517939_27_878 | 279 |
| 150 | 3300005334 | Ga0068869_100151546 | Ga0068869_1001515462 | 280 |
| 151 | 3300005434 | Ga0070709_10035373 | Ga0070709_100353734 | 280 |
| 152 | 3300005434 | Ga0070709_10048774 | Ga0070709_100487742 | 280 |
| 153 | 3300005434 | Ga0070709_10354711 | Ga0070709_103547112 | 280 |
| 154 | 3300005435 | Ga0070714_100000047 | Ga0070714_10000004713 | 280 |
| 155 | 3300005435 | Ga0070714_100003325 | Ga0070714_10000332513 | 280 |
| 156 | 3300005435 | Ga0070714_100213503 | Ga0070714_1002135032 | 280 |
| 157 | 3300005436 | Ga0070713_100016431 | Ga0070713_1000164313 | 280 |
| 158 | 3300005436 | Ga0070713_100219240 | Ga0070713_1002192401 | 280 |
| 159 | 3300005439 | Ga0070711_100002546 | Ga0070711_1000025467 | 280 |
| 160 | 3300005439 | Ga0070711_100004478 | Ga0070711_1000044787 | 280 |
| 161 | 3300005439 | Ga0070711_100093833 | Ga0070711_1000938333 | 280 |
| 162 | 3300005445 | Ga0070708_100007462 | Ga0070708_1000074628 | 280 |
| 163 | 3300005458 | Ga0070681_10024932 | Ga0070681_100249323 | 280 |
| 164 | 3300005458 | Ga0070681_10051431 | Ga0070681_100514315 | 280 |
| 165 | 3300005467 | Ga0070706_100032684 | Ga0070706_1000326843 | 280 |
| 166 | 3300005530 | Ga0070679_100070161 | Ga0070679_1000701612 | 280 |
| 167 | 3300005539 | Ga0068853_100024047 | Ga0068853_1000240474 | 280 |
| 168 | 3300005563 | Ga0068855_100050505 | Ga0068855_1000505055 | 280 |
| 169 | 3300005614 | Ga0068856_100018179 | Ga0068856_1000181795 | 280 |
| 170 | 3300005614 | Ga0068856_100277212 | Ga0068856_1002772121 | 280 |
| 171 | 3300006028 | Ga0070717_10016809 | Ga0070717_100168092 | 280 |
| 172 | 3300006163 | Ga0070715_10066827 | Ga0070715_100668271 | 280 |
| 173 | 3300006173 | Ga0070716_100006703 | Ga0070716_1000067037 | 280 |
| 174 | 3300006173 | Ga0070716_100062535 | Ga0070716_1000625352 | 280 |
| 175 | 3300006175 | Ga0070712_100001045 | Ga0070712_1000010453 | 280 |
| 176 | 3300006175 | Ga0070712_100003020 | Ga0070712_1000030206 | 280 |
| 177 | 3300006175 | Ga0070712_100003173 | Ga0070712_1000031735 | 280 |
| 178 | 3300009093 | Ga0105240_10022103 | Ga0105240_100221036 | 280 |
| 179 | 3300009094 | Ga0111539_10676782 | Ga0111539_106767822 | 280 |
| 180 | 3300009176 | Ga0105242_10213773 | Ga0105242_102137732 | 280 |
| 181 | 3300013307 | Ga0157372_10031121 | Ga0157372_100311216 | 280 |
| 182 | 3300025905 | Ga0207685_10051162 | Ga0207685_100511622 | 280 |
| 183 | 3300025906 | Ga0207699_10037285 | Ga0207699_100372854 | 280 |
| 184 | 3300025906 | Ga0207699_10044556 | Ga0207699_100445563 | 280 |
| 185 | 3300025906 | Ga0207699_10068357 | Ga0207699_100683572 | 280 |
| 186 | 3300025910 | Ga0207684_10024057 | Ga0207684_100240572 | 280 |
| 187 | 3300025912 | Ga0207707_10030298 | Ga0207707_100302986 | 280 |
| 188 | 3300025913 | Ga0207695_10119919 | Ga0207695_101199191 | 280 |
| 189 | 3300025914 | Ga0207671_10259258 | Ga0207671_102592582 | 280 |
| 190 | 3300025915 | Ga0207693_10000038 | Ga0207693_100000387 | 280 |
| 191 | 3300025915 | Ga0207693_10008388 | Ga0207693_100083887 | 280 |
| 192 | 3300025915 | Ga0207693_10009178 | Ga0207693_100091785 | 280 |
| 193 | 3300025916 | Ga0207663_10003648 | Ga0207663_100036486 | 280 |
| 194 | 3300025916 | Ga0207663_10024132 | Ga0207663_100241322 | 280 |
| 195 | 3300025916 | Ga0207663_10128455 | Ga0207663_101284552 | 280 |
| 196 | 3300025921 | Ga0207652_10250274 | Ga0207652_102502742 | 280 |
| 197 | 3300025928 | Ga0207700_10001212 | Ga0207700_1000121213 | 280 |
| 198 | 3300025928 | Ga0207700_10002922 | Ga0207700_100029226 | 280 |
| 199 | 3300025929 | Ga0207664_10000414 | Ga0207664_1000041418 | 280 |
| 200 | 3300025929 | Ga0207664_10010642 | Ga0207664_100106424 | 280 |
| 201 | 3300025929 | Ga0207664_10163691 | Ga0207664_101636912 | 280 |
| 202 | 3300025929 | Ga0207664_10232064 | Ga0207664_102320642 | 280 |
| 203 | 3300025939 | Ga0207665_10017505 | Ga0207665_100175056 | 280 |
| 204 | 3300025939 | Ga0207665_10022780 | Ga0207665_100227802 | 280 |
| 205 | 3300025942 | Ga0207689_10029835 | Ga0207689_100298352 | 280 |
| 206 | 3300025949 | Ga0207667_10009748 | Ga0207667_100097484 | 280 |
| 207 | 3300026078 | Ga0207702_10057668 | Ga0207702_100576684 | 280 |
| 208 | 3300026116 | Ga0207674_10430183 | Ga0207674_104301831 | 280 |
| 209 | 3300028800 | Ga0265338_10015603 | Ga0265338_100156036 | 280 |
| 210 | 3300028800 | Ga0265338_10106664 | Ga0265338_101066643 | 280 |
| 211 | 3300028800 | Ga0265338_10121027 | Ga0265338_101210271 | 280 |
| 212 | 3300028800 | Ga0265338_10186053 | Ga0265338_101860531 | 280 |
| 213 | 3300031241 | Ga0265325_10003919 | Ga0265325_100039193 | 280 |
| 214 | 3300031241 | Ga0265325_10117091 | Ga0265325_101170911 | 280 |
| 215 | 3300031249 | Ga0265339_10015289 | Ga0265339_100152894 | 280 |
| 216 | 3300031249 | Ga0265339_10053455 | Ga0265339_100534553 | 280 |
| 217 | 3300031344 | Ga0265316_10041516 | Ga0265316_100415164 | 280 |
| 218 | 3300031711 | Ga0265314_10017964 | Ga0265314_100179645 | 280 |
| 219 | 3300031712 | Ga0265342_10011481 | Ga0265342_100114812 | 280 |
| 220 | 3300035083 | Ga0373926_0016904 | Ga0373926_0016904_1370_2215 | 280 |
| 221 | 3300035086 | Ga0373934_0151142 | Ga0373934_0151142_57_905 | 280 |
| 222 | 3300035089 | Ga0373944_0013304 | Ga0373944_0013304_1289_2137 | 280 |
| 223 | 3300035113 | Ga0373936_0006256 | Ga0373936_0006256_1493_2341 | 280 |
| 224 | 3300035113 | Ga0373936_0008642 | Ga0373936_0008642_2386_3243 | 280 |
| 225 | 3300035113 | Ga0373936_0101667 | Ga0373936_0101667_251_1096 | 280 |
| 226 | 3300035116 | Ga0373945_0000872 | Ga0373945_0000872_665_1522 | 280 |
| 227 | 3300035116 | Ga0373945_0020585 | Ga0373945_0020585_703_1548 | 280 |
| 228 | 3300035116 | Ga0373945_0033686 | Ga0373945_0033686_494_1342 | 280 |
| 229 | 3300035117 | Ga0373953_0157143 | Ga0373953_0157143_12_857 | 280 |
| 230 | 3300035119 | Ga0373956_0057132 | Ga0373956_0057132_117_962 | 280 |
| 231 | 3300035120 | Ga0373957_0002345 | Ga0373957_0002345_1976_2821 | 280 |
| 232 | 3300035170 | Ga0373943_0002667 | Ga0373943_0002667_6322_7179 | 280 |
| 233 | 3300035170 | Ga0373943_0005384 | Ga0373943_0005384_3944_4789 | 280 |
| 234 | 3300035170 | Ga0373943_0221142 | Ga0373943_0221142_172_1020 | 280 |
| 235 | 3300035171 | Ga0373946_0005783 | Ga0373946_0005783_1770_2627 | 280 |
| 236 | 3300035171 | Ga0373946_0026981 | Ga0373946_0026981_1384_2229 | 280 |
| 237 | 3300035171 | Ga0373946_0200923 | Ga0373946_0200923_94_939 | 280 |
| 238 | 3300035172 | Ga0373955_0006956 | Ga0373955_0006956_1099_1944 | 280 |
| 239 | 3300035410 | Ga0373924_0000033 | Ga0373924_0000033_11870_12715 | 280 |
| 240 | 3300035410 | Ga0373924_0014465 | Ga0373924_0014465_2094_2939 | 280 |
| 241 | 3300035692 | Ga0373935_0000723 | Ga0373935_0000723_5102_5959 | 280 |
| 242 | 3300035692 | Ga0373935_0009713 | Ga0373935_0009713_932_1780 | 280 |
| 243 | 3300035692 | Ga0373935_0022591 | Ga0373935_0022591_2762_3652 | 280 |
| 244 | 3300035692 | Ga0373935_0191381 | Ga0373935_0191381_251_1096 | 280 |
| 245 | 3300035695 | Ga0373927_0000297 | Ga0373927_0000297_34077_34934 | 280 |
| 246 | 3300035695 | Ga0373927_0068529 | Ga0373927_0068529_1428_2273 | 280 |
| 247 | 3300035695 | Ga0373927_0216757 | Ga0373927_0216757_106_951 | 280 |
| 248 | 3300035724 | Ga0373933_0018335 | Ga0373933_0018335_113_958 | 280 |
| 249 | 3300035724 | Ga0373933_0020408 | Ga0373933_0020408_1588_2433 | 280 |
| 250 | 3300035725 | Ga0373947_0023967 | Ga0373947_0023967_2480_3370 | 280 |
| 251 | 3300035725 | Ga0373947_0027393 | Ga0373947_0027393_1237_2085 | 280 |
| 252 | 3300035725 | Ga0373947_0141249 | Ga0373947_0141249_113_958 | 280 |
| 253 | 3300036401 | Ga0373937_0002928 | Ga0373937_0002928_6911_7756 | 280 |
| 254 | 3300036401 | Ga0373937_0010493 | Ga0373937_0010493_5032_5883 | 280 |
| 255 | 3300036401 | Ga0373937_0018616 | Ga0373937_0018616_4580_5425 | 280 |
| 256 | 3300036401 | Ga0373937_0033071 | Ga0373937_0033071_1108_1953 | 280 |
| 257 | 3300036401 | Ga0373937_0065238 | Ga0373937_0065238_114_1004 | 280 |
| 258 | 3300036401 | Ga0373937_0165664 | Ga0373937_0165664_1050_1895 | 280 |
| 259 | 3300037068 | Ga0373925_0000684 | Ga0373925_0000684_30291_31148 | 280 |
| 260 | 3300037068 | Ga0373925_0012023 | Ga0373925_0012023_1170_2018 | 280 |
| 261 | 3300037068 | Ga0373925_0013265 | Ga0373925_0013265_398_1243 | 280 |
| 262 | 3300037068 | Ga0373925_0017480 | Ga0373925_0017480_2747_3592 | 280 |
| 263 | 3300037068 | Ga0373925_0137028 | Ga0373925_0137028_696_1541 | 280 |
| 264 | 3300037068 | Ga0373925_0259602 | Ga0373925_0259602_56_904 | 280 |
| 265 | 3300044842 | Ga0466957_0007239 | Ga0466957_0007239_4062_4907 | 280 |
| 266 | 3300044842 | Ga0466957_0379528 | Ga0466957_0379528_26_871 | 280 |
| 267 | 3300046454 | Ga0495592_0185654 | Ga0495592_0185654_489_1337 | 280 |
| 268 | 3300046462 | Ga0495651_0087723 | Ga0495651_0087723_645_1490 | 280 |
| 269 | 3300046472 | Ga0495580_0004509 | Ga0495580_0004509_10613_11461 | 280 |
| 270 | 3300046472 | Ga0495580_0032970 | Ga0495580_0032970_1674_2519 | 280 |
| 271 | 3300046473 | Ga0495582_0147818 | Ga0495582_0147818_97_945 | 280 |
| 272 | 3300046477 | Ga0495664_0006322 | Ga0495664_0006322_3256_4113 | 280 |
| 273 | 3300046477 | Ga0495664_0071311 | Ga0495664_0071311_346_1194 | 280 |
| 274 | 3300046499 | Ga0495594_0010861 | Ga0495594_0010861_33_878 | 280 |
| 275 | 3300046511 | Ga0495608_0105424 | Ga0495608_0105424_51_1055 | 280 |
| 276 | 3300046517 | Ga0495630_0129587 | Ga0495630_0129587_679_1524 | 280 |
| 277 | 3300046529 | Ga0495652_0275639 | Ga0495652_0275639_236_1081 | 280 |
| 278 | 3300046678 | Ga0495599_0209399 | Ga0495599_0209399_246_1094 | 280 |
| 279 | 3300046679 | Ga0495623_0002920 | Ga0495623_0002920_3640_4485 | 280 |
| 280 | 3300046679 | Ga0495623_0164924 | Ga0495623_0164924_165_1022 | 280 |
| 281 | 3300046683 | Ga0495658_0027496 | Ga0495658_0027496_679_1527 | 280 |
| 282 | 3300047317 | Ga0495604_0070773 | Ga0495604_0070773_1000_1845 | 280 |
| 283 | 3300047319 | Ga0495674_0079170 | Ga0495674_0079170_679_1536 | 280 |
| 284 | 3300047471 | Ga0495684_0112423 | Ga0495684_0112423_592_1440 | 280 |
| 285 | 3300047673 | Ga0495593_0221467 | Ga0495593_0221467_36_881 | 280 |
| 286 | 3300048089 | Ga0495614_0027109 | Ga0495614_0027109_1494_2339 | 280 |
| 287 | 3300048905 | Ga0496102_0023530 | Ga0496102_0023530_3381_4226 | 280 |
| 288 | 3300048905 | Ga0496102_0415785 | Ga0496102_0415785_56_901 | 280 |
| 289 | 3300048906 | Ga0496103_0076671 | Ga0496103_0076671_615_1460 | 280 |
| 290 | 3300048908 | Ga0496105_0002203 | Ga0496105_0002203_6378_7223 | 280 |
| 291 | 3300048915 | Ga0496112_0032608 | Ga0496112_0032608_1667_2671 | 280 |
| 292 | 3300048916 | Ga0496113_0000145 | Ga0496113_0000145_1674_2678 | 280 |
| 293 | 3300048917 | Ga0496114_0180447 | Ga0496114_0180447_647_1498 | 280 |
| 294 | 3300049593 | Ga0501077_0347194 | Ga0501077_0347194_56_901 | 280 |
| 295 | 3300050511 | nmdc:mga08y16_744418_c1 | nmdc:mga08y16_744418_c1_20_883 | 280 |
| 296 | 3300050512 | nmdc:mga0n895_215189_c1 | nmdc:mga0n895_215189_c1_991_1836 | 280 |
| 297 | 3300005329 | Ga0070683_100049686 | Ga0070683_1000496864 | 281 |
| 298 | 3300005331 | Ga0070670_100032237 | Ga0070670_1000322372 | 281 |
| 299 | 3300005331 | Ga0070670_100100921 | Ga0070670_1001009211 | 281 |
| 300 | 3300005337 | Ga0070682_100029737 | Ga0070682_1000297372 | 281 |
| 301 | 3300005338 | Ga0068868_100002724 | Ga0068868_1000027243 | 281 |
| 302 | 3300005339 | Ga0070660_100017786 | Ga0070660_1000177867 | 281 |
| 303 | 3300005344 | Ga0070661_100012142 | Ga0070661_1000121423 | 281 |
| 304 | 3300005366 | Ga0070659_100061366 | Ga0070659_1000613664 | 281 |
| 305 | 3300005367 | Ga0070667_100237547 | Ga0070667_1002375471 | 281 |
| 306 | 3300005455 | Ga0070663_100052878 | Ga0070663_1000528781 | 281 |
| 307 | 3300005456 | Ga0070678_100272458 | Ga0070678_1002724581 | 281 |
| 308 | 3300005458 | Ga0070681_10110912 | Ga0070681_101109123 | 281 |
| 309 | 3300005530 | Ga0070679_100333753 | Ga0070679_1003337531 | 281 |
| 310 | 3300005547 | Ga0070693_100104995 | Ga0070693_1001049952 | 281 |
| 311 | 3300005547 | Ga0070693_100231424 | Ga0070693_1002314242 | 281 |
| 312 | 3300005563 | Ga0068855_100083045 | Ga0068855_1000830454 | 281 |
| 313 | 3300005577 | Ga0068857_100206883 | Ga0068857_1002068832 | 281 |
| 314 | 3300005616 | Ga0068852_100067024 | Ga0068852_1000670243 | 281 |
| 315 | 3300005618 | Ga0068864_100110438 | Ga0068864_1001104383 | 281 |
| 316 | 3300005843 | Ga0068860_100079354 | Ga0068860_1000793542 | 281 |
| 317 | 3300005844 | Ga0068862_100025221 | Ga0068862_1000252211 | 281 |
| 318 | 3300009093 | Ga0105240_10096230 | Ga0105240_100962304 | 281 |
| 319 | 3300009098 | Ga0105245_10219522 | Ga0105245_102195222 | 281 |
| 320 | 3300009174 | Ga0105241_10050454 | Ga0105241_100504542 | 281 |
| 321 | 3300009177 | Ga0105248_10073600 | Ga0105248_100736005 | 281 |
| 322 | 3300009551 | Ga0105238_10173094 | Ga0105238_101730943 | 281 |
| 323 | 3300010375 | Ga0105239_10060543 | Ga0105239_100605436 | 281 |
| 324 | 3300013100 | Ga0157373_10062406 | Ga0157373_100624063 | 281 |
| 325 | 3300013102 | Ga0157371_10238502 | Ga0157371_102385022 | 281 |
| 326 | 3300013297 | Ga0157378_10095794 | Ga0157378_100957943 | 281 |
| 327 | 3300013307 | Ga0157372_10317463 | Ga0157372_103174632 | 281 |
| 328 | 3300014325 | Ga0163163_10045846 | Ga0163163_100458464 | 281 |
| 329 | 3300014325 | Ga0163163_10231872 | Ga0163163_102318722 | 281 |
| 330 | 3300014969 | Ga0157376_10005692 | Ga0157376_100056922 | 281 |
| 331 | 3300015261 | Ga0182006_1008740 | Ga0182006_10087401 | 281 |
| 332 | 3300015265 | Ga0182005_1006704 | Ga0182005_10067045 | 281 |
| 333 | 3300022730 | Ga0224570_101524 | Ga0224570_1015241 | 281 |
| 334 | 3300024227 | Ga0228598_1007740 | Ga0228598_10077401 | 281 |
| 335 | 3300025321 | Ga0207656_10138597 | Ga0207656_101385972 | 281 |
| 336 | 3300025911 | Ga0207654_10037191 | Ga0207654_100371913 | 281 |
| 337 | 3300025917 | Ga0207660_10440099 | Ga0207660_104400991 | 281 |
| 338 | 3300025919 | Ga0207657_10011100 | Ga0207657_1001110010 | 281 |
| 339 | 3300025927 | Ga0207687_10150264 | Ga0207687_101502642 | 281 |
| 340 | 3300025939 | Ga0207665_10112561 | Ga0207665_101125612 | 281 |
| 341 | 3300025939 | Ga0207665_10123572 | Ga0207665_101235722 | 281 |
| 342 | 3300025941 | Ga0207711_10049412 | Ga0207711_100494122 | 281 |
| 343 | 3300025942 | Ga0207689_10229576 | Ga0207689_102295762 | 281 |
| 344 | 3300025949 | Ga0207667_10118490 | Ga0207667_101184902 | 281 |
| 345 | 3300025981 | Ga0207640_10272291 | Ga0207640_102722911 | 281 |
| 346 | 3300026041 | Ga0207639_10004056 | Ga0207639_100040569 | 281 |
| 347 | 3300026078 | Ga0207702_10085385 | Ga0207702_100853854 | 281 |
| 348 | 3300026095 | Ga0207676_10195183 | Ga0207676_101951832 | 281 |
| 349 | 3300028017 | Ga0265356_1000309 | Ga0265356_10003094 | 281 |
| 350 | 3300030760 | Ga0265762_1001637 | Ga0265762_10016375 | 281 |
| 351 | 3300030760 | Ga0265762_1033635 | Ga0265762_10336351 | 281 |
| 352 | 3300031090 | Ga0265760_10000193 | Ga0265760_1000019310 | 281 |
| 353 | 3300033545 | Ga0316214_1003119 | Ga0316214_10031192 | 281 |
| 354 | 3300039453 | Ga0436362_0226101 | Ga0436362_0226101_618_1466 | 281 |
| 355 | 3300045049 | Ga0466959_0041003 | Ga0466959_0041003_794_1642 | 281 |
| 356 | 3300048903 | Ga0496100_0044609 | Ga0496100_0044609_367_1215 | 281 |
| 357 | 3300048904 | Ga0496101_0225654 | Ga0496101_0225654_525_1373 | 281 |
| 358 | 3300048905 | Ga0496102_0046059 | Ga0496102_0046059_1826_2674 | 281 |
| 359 | 3300048907 | Ga0496104_0035311 | Ga0496104_0035311_342_1190 | 281 |
| 360 | 3300048910 | Ga0496107_0064753 | Ga0496107_0064753_895_1743 | 281 |
| 361 | 3300048911 | Ga0496108_0057686 | Ga0496108_0057686_792_1640 | 281 |
| 362 | 3300048912 | Ga0496109_0061060 | Ga0496109_0061060_824_1672 | 281 |
| 363 | 3300048913 | Ga0496110_0028225 | Ga0496110_0028225_3129_3977 | 281 |
| 364 | 3300048915 | Ga0496112_0027316 | Ga0496112_0027316_2159_3004 | 281 |
| 365 | 2162886012 | MBSR1b_contig_12170407 | MBSR1b_0358.00003430 | 282 |
| 366 | 2162886012 | MBSR1b_contig_831446 | MBSR1b_0497.00002290 | 282 |
| 367 | 3300001976 | JGI24752J21851_1000691 | JGI24752J21851_10006914 | 282 |
| 368 | 3300002074 | JGI24748J21848_1007843 | JGI24748J21848_10078432 | 282 |
| 369 | 3300002075 | JGI24738J21930_10024257 | JGI24738J21930_100242571 | 282 |
| 370 | 3300002239 | JGI24034J26672_10003883 | JGI24034J26672_100038832 | 282 |
| 371 | 3300002239 | JGI24034J26672_10004102 | JGI24034J26672_100041022 | 282 |
| 372 | 3300002459 | JGI24751J29686_10001089 | JGI24751J29686_100010896 | 282 |
| 373 | 3300005293 | Ga0065715_10091077 | Ga0065715_100910773 | 282 |
| 374 | 3300005327 | Ga0070658_10105845 | Ga0070658_101058453 | 282 |
| 375 | 3300005328 | Ga0070676_10000861 | Ga0070676_1000086111 | 282 |
| 376 | 3300005329 | Ga0070683_100000141 | Ga0070683_1000001415 | 282 |
| 377 | 3300005330 | Ga0070690_100008269 | Ga0070690_1000082693 | 282 |
| 378 | 3300005331 | Ga0070670_100009672 | Ga0070670_1000096726 | 282 |
| 379 | 3300005334 | Ga0068869_100007756 | Ga0068869_1000077566 | 282 |
| 380 | 3300005335 | Ga0070666_10019520 | Ga0070666_100195204 | 282 |
| 381 | 3300005337 | Ga0070682_100020375 | Ga0070682_1000203752 | 282 |
| 382 | 3300005338 | Ga0068868_100013441 | Ga0068868_1000134416 | 282 |
| 383 | 3300005339 | Ga0070660_100008269 | Ga0070660_1000082696 | 282 |
| 384 | 3300005340 | Ga0070689_100001981 | Ga0070689_10000198111 | 282 |
| 385 | 3300005343 | Ga0070687_100000859 | Ga0070687_1000008596 | 282 |
| 386 | 3300005344 | Ga0070661_100001978 | Ga0070661_10000197811 | 282 |
| 387 | 3300005347 | Ga0070668_100044255 | Ga0070668_1000442552 | 282 |
| 388 | 3300005353 | Ga0070669_100000984 | Ga0070669_1000009843 | 282 |
| 389 | 3300005354 | Ga0070675_100013076 | Ga0070675_1000130763 | 282 |
| 390 | 3300005355 | Ga0070671_100019576 | Ga0070671_1000195764 | 282 |
| 391 | 3300005356 | Ga0070674_100111497 | Ga0070674_1001114972 | 282 |
| 392 | 3300005364 | Ga0070673_100001798 | Ga0070673_10000179811 | 282 |
| 393 | 3300005365 | Ga0070688_100000404 | Ga0070688_1000004044 | 282 |
| 394 | 3300005366 | Ga0070659_100006119 | Ga0070659_1000061195 | 282 |
| 395 | 3300005367 | Ga0070667_100037279 | Ga0070667_1000372796 | 282 |
| 396 | 3300005434 | Ga0070709_10002189 | Ga0070709_100021893 | 282 |
| 397 | 3300005434 | Ga0070709_10286731 | Ga0070709_102867311 | 282 |
| 398 | 3300005435 | Ga0070714_100428218 | Ga0070714_1004282181 | 282 |
| 399 | 3300005436 | Ga0070713_100041917 | Ga0070713_1000419174 | 282 |
| 400 | 3300005436 | Ga0070713_100154838 | Ga0070713_1001548383 | 282 |
| 401 | 3300005437 | Ga0070710_10251915 | Ga0070710_102519151 | 282 |
| 402 | 3300005438 | Ga0070701_10017230 | Ga0070701_100172303 | 282 |
| 403 | 3300005439 | Ga0070711_100030337 | Ga0070711_1000303373 | 282 |
| 404 | 3300005441 | Ga0070700_100049186 | Ga0070700_1000491862 | 282 |
| 405 | 3300005445 | Ga0070708_100000435 | Ga0070708_10000043513 | 282 |
| 406 | 3300005445 | Ga0070708_100193845 | Ga0070708_1001938451 | 282 |
| 407 | 3300005445 | Ga0070708_100297116 | Ga0070708_1002971162 | 282 |
| 408 | 3300005456 | Ga0070678_100006009 | Ga0070678_1000060093 | 282 |
| 409 | 3300005457 | Ga0070662_100001110 | Ga0070662_10000111011 | 282 |
| 410 | 3300005458 | Ga0070681_10000179 | Ga0070681_1000017923 | 282 |
| 411 | 3300005459 | Ga0068867_100002720 | Ga0068867_1000027203 | 282 |
| 412 | 3300005466 | Ga0070685_10000636 | Ga0070685_1000063617 | 282 |
| 413 | 3300005467 | Ga0070706_100008394 | Ga0070706_1000083947 | 282 |
| 414 | 3300005468 | Ga0070707_100000605 | Ga0070707_10000060529 | 282 |
| 415 | 3300005468 | Ga0070707_100024260 | Ga0070707_1000242603 | 282 |
| 416 | 3300005468 | Ga0070707_100540316 | Ga0070707_1005403161 | 282 |
| 417 | 3300005471 | Ga0070698_100003037 | Ga0070698_10000303711 | 282 |
| 418 | 3300005518 | Ga0070699_100001736 | Ga0070699_10000173610 | 282 |
| 419 | 3300005518 | Ga0070699_100045766 | Ga0070699_1000457661 | 282 |
| 420 | 3300005530 | Ga0070679_100007952 | Ga0070679_1000079529 | 282 |
| 421 | 3300005535 | Ga0070684_100000935 | Ga0070684_10000093517 | 282 |
| 422 | 3300005536 | Ga0070697_100000199 | Ga0070697_10000019931 | 282 |
| 423 | 3300005539 | Ga0068853_100003141 | Ga0068853_1000031413 | 282 |
| 424 | 3300005543 | Ga0070672_100024156 | Ga0070672_1000241561 | 282 |
| 425 | 3300005544 | Ga0070686_100000598 | Ga0070686_1000005985 | 282 |
| 426 | 3300005547 | Ga0070693_100019825 | Ga0070693_1000198254 | 282 |
| 427 | 3300005563 | Ga0068855_100020807 | Ga0068855_1000208074 | 282 |
| 428 | 3300005564 | Ga0070664_100009623 | Ga0070664_1000096233 | 282 |
| 429 | 3300005577 | Ga0068857_100002528 | Ga0068857_1000025285 | 282 |
| 430 | 3300005578 | Ga0068854_100150108 | Ga0068854_1001501083 | 282 |
| 431 | 3300005614 | Ga0068856_100041109 | Ga0068856_1000411093 | 282 |
| 432 | 3300005614 | Ga0068856_100042660 | Ga0068856_1000426603 | 282 |
| 433 | 3300005615 | Ga0070702_100005603 | Ga0070702_1000056033 | 282 |
| 434 | 3300005616 | Ga0068852_100012174 | Ga0068852_1000121746 | 282 |
| 435 | 3300005617 | Ga0068859_100004950 | Ga0068859_10000495012 | 282 |
| 436 | 3300005718 | Ga0068866_10001000 | Ga0068866_100010007 | 282 |
| 437 | 3300005719 | Ga0068861_100036800 | Ga0068861_1000368004 | 282 |
| 438 | 3300005834 | Ga0068851_10011241 | Ga0068851_100112412 | 282 |
| 439 | 3300005840 | Ga0068870_10006694 | Ga0068870_100066942 | 282 |
| 440 | 3300005841 | Ga0068863_100055548 | Ga0068863_1000555484 | 282 |
| 441 | 3300005842 | Ga0068858_100007225 | Ga0068858_10000722512 | 282 |
| 442 | 3300005843 | Ga0068860_100017192 | Ga0068860_1000171923 | 282 |
| 443 | 3300005844 | Ga0068862_100003656 | Ga0068862_1000036563 | 282 |
| 444 | 3300006028 | Ga0070717_10113225 | Ga0070717_101132252 | 282 |
| 445 | 3300006028 | Ga0070717_10385091 | Ga0070717_103850912 | 282 |
| 446 | 3300006028 | Ga0070717_10423416 | Ga0070717_104234161 | 282 |
| 447 | 3300006163 | Ga0070715_10022890 | Ga0070715_100228903 | 282 |
| 448 | 3300006173 | Ga0070716_100003260 | Ga0070716_1000032606 | 282 |
| 449 | 3300006175 | Ga0070712_100002589 | Ga0070712_1000025896 | 282 |
| 450 | 3300006175 | Ga0070712_100005954 | Ga0070712_1000059546 | 282 |
| 451 | 3300006175 | Ga0070712_100089675 | Ga0070712_1000896753 | 282 |
| 452 | 3300006237 | Ga0097621_100028124 | Ga0097621_1000281244 | 282 |
| 453 | 3300006358 | Ga0068871_100068619 | Ga0068871_1000686192 | 282 |
| 454 | 3300006871 | Ga0075434_100001284 | Ga0075434_10000128418 | 282 |
| 455 | 3300006881 | Ga0068865_100007877 | Ga0068865_1000078774 | 282 |
| 456 | 3300006931 | Ga0097620_100004950 | Ga0097620_10000495012 | 282 |
| 457 | 3300009093 | Ga0105240_10289601 | Ga0105240_102896013 | 282 |
| 458 | 3300009098 | Ga0105245_10002320 | Ga0105245_100023206 | 282 |
| 459 | 3300009101 | Ga0105247_10009920 | Ga0105247_100099204 | 282 |
| 460 | 3300009174 | Ga0105241_10051379 | Ga0105241_100513793 | 282 |
| 461 | 3300009176 | Ga0105242_10016155 | Ga0105242_100161552 | 282 |
| 462 | 3300009553 | Ga0105249_10013083 | Ga0105249_100130833 | 282 |
| 463 | 3300010375 | Ga0105239_10007719 | Ga0105239_1000771911 | 282 |
| 464 | 3300011119 | Ga0105246_10001796 | Ga0105246_100017962 | 282 |
| 465 | 3300013100 | Ga0157373_10008624 | Ga0157373_100086243 | 282 |
| 466 | 3300013102 | Ga0157371_10010946 | Ga0157371_100109464 | 282 |
| 467 | 3300013104 | Ga0157370_10046235 | Ga0157370_100462351 | 282 |
| 468 | 3300013104 | Ga0157370_10054008 | Ga0157370_100540082 | 282 |
| 469 | 3300013105 | Ga0157369_10010680 | Ga0157369_100106806 | 282 |
| 470 | 3300013105 | Ga0157369_10089967 | Ga0157369_100899672 | 282 |
| 471 | 3300013105 | Ga0157369_10117275 | Ga0157369_101172753 | 282 |
| 472 | 3300013296 | Ga0157374_10018502 | Ga0157374_100185023 | 282 |
| 473 | 3300013307 | Ga0157372_10001689 | Ga0157372_100016897 | 282 |
| 474 | 3300013308 | Ga0157375_10028067 | Ga0157375_100280674 | 282 |
| 475 | 3300014325 | Ga0163163_10000850 | Ga0163163_1000085012 | 282 |
| 476 | 3300014745 | Ga0157377_10000535 | Ga0157377_100005354 | 282 |
| 477 | 3300014968 | Ga0157379_10028884 | Ga0157379_100288845 | 282 |
| 478 | 3300014969 | Ga0157376_10036676 | Ga0157376_100366762 | 282 |
| 479 | 3300017792 | Ga0163161_10001298 | Ga0163161_100012987 | 282 |
| 480 | 3300021377 | Ga0213874_10005998 | Ga0213874_100059981 | 282 |
| 481 | 3300022732 | Ga0224569_101211 | Ga0224569_1012112 | 282 |
| 482 | 3300024227 | Ga0228598_1000061 | Ga0228598_10000614 | 282 |
| 483 | 3300024227 | Ga0228598_1000687 | Ga0228598_10006874 | 282 |
| 484 | 3300025315 | Ga0207697_10007464 | Ga0207697_100074644 | 282 |
| 485 | 3300025321 | Ga0207656_10084667 | Ga0207656_100846672 | 282 |
| 486 | 3300025899 | Ga0207642_10029081 | Ga0207642_100290812 | 282 |
| 487 | 3300025900 | Ga0207710_10026910 | Ga0207710_100269102 | 282 |
| 488 | 3300025901 | Ga0207688_10001352 | Ga0207688_1000135210 | 282 |
| 489 | 3300025903 | Ga0207680_10006311 | Ga0207680_100063114 | 282 |
| 490 | 3300025904 | Ga0207647_10005760 | Ga0207647_100057604 | 282 |
| 491 | 3300025905 | Ga0207685_10009497 | Ga0207685_100094973 | 282 |
| 492 | 3300025906 | Ga0207699_10004886 | Ga0207699_100048867 | 282 |
| 493 | 3300025907 | Ga0207645_10000069 | Ga0207645_1000006950 | 282 |
| 494 | 3300025908 | Ga0207643_10005786 | Ga0207643_100057862 | 282 |
| 495 | 3300025909 | Ga0207705_10458096 | Ga0207705_104580961 | 282 |
| 496 | 3300025910 | Ga0207684_10001311 | Ga0207684_1000131115 | 282 |
| 497 | 3300025911 | Ga0207654_10031178 | Ga0207654_100311783 | 282 |
| 498 | 3300025912 | Ga0207707_10002140 | Ga0207707_1000214014 | 282 |
| 499 | 3300025915 | Ga0207693_10003133 | Ga0207693_100031338 | 282 |
| 500 | 3300025915 | Ga0207693_10005353 | Ga0207693_100053537 | 282 |
| 501 | 3300025916 | Ga0207663_10058857 | Ga0207663_100588572 | 282 |
| 502 | 3300025917 | Ga0207660_10000064 | Ga0207660_1000006455 | 282 |
| 503 | 3300025918 | Ga0207662_10008546 | Ga0207662_100085464 | 282 |
| 504 | 3300025919 | Ga0207657_10000217 | Ga0207657_1000021746 | 282 |
| 505 | 3300025920 | Ga0207649_10008473 | Ga0207649_100084731 | 282 |
| 506 | 3300025921 | Ga0207652_10002404 | Ga0207652_1000240412 | 282 |
| 507 | 3300025922 | Ga0207646_10001857 | Ga0207646_1000185716 | 282 |
| 508 | 3300025922 | Ga0207646_10060331 | Ga0207646_100603314 | 282 |
| 509 | 3300025922 | Ga0207646_10115803 | Ga0207646_101158033 | 282 |
| 510 | 3300025922 | Ga0207646_10231266 | Ga0207646_102312662 | 282 |
| 511 | 3300025923 | Ga0207681_10011657 | Ga0207681_100116572 | 282 |
| 512 | 3300025925 | Ga0207650_10000416 | Ga0207650_1000041627 | 282 |
| 513 | 3300025927 | Ga0207687_10006118 | Ga0207687_100061184 | 282 |
| 514 | 3300025928 | Ga0207700_10176573 | Ga0207700_101765732 | 282 |
| 515 | 3300025929 | Ga0207664_10186744 | Ga0207664_101867442 | 282 |
| 516 | 3300025931 | Ga0207644_10000489 | Ga0207644_1000048917 | 282 |
| 517 | 3300025932 | Ga0207690_10080881 | Ga0207690_100808812 | 282 |
| 518 | 3300025933 | Ga0207706_10007326 | Ga0207706_100073265 | 282 |
| 519 | 3300025934 | Ga0207686_10009222 | Ga0207686_100092223 | 282 |
| 520 | 3300025938 | Ga0207704_10050829 | Ga0207704_100508293 | 282 |
| 521 | 3300025939 | Ga0207665_10001393 | Ga0207665_100013939 | 282 |
| 522 | 3300025939 | Ga0207665_10283900 | Ga0207665_102839001 | 282 |
| 523 | 3300025940 | Ga0207691_10001375 | Ga0207691_100013757 | 282 |
| 524 | 3300025941 | Ga0207711_10012249 | Ga0207711_100122493 | 282 |
| 525 | 3300025942 | Ga0207689_10006810 | Ga0207689_100068106 | 282 |
| 526 | 3300025944 | Ga0207661_10010921 | Ga0207661_100109216 | 282 |
| 527 | 3300025945 | Ga0207679_10000120 | Ga0207679_100001209 | 282 |
| 528 | 3300025949 | Ga0207667_10033752 | Ga0207667_100337524 | 282 |
| 529 | 3300025960 | Ga0207651_10009101 | Ga0207651_100091015 | 282 |
| 530 | 3300025972 | Ga0207668_10034231 | Ga0207668_100342314 | 282 |
| 531 | 3300025986 | Ga0207658_10010665 | Ga0207658_100106653 | 282 |
| 532 | 3300026023 | Ga0207677_10008083 | Ga0207677_100080836 | 282 |
| 533 | 3300026035 | Ga0207703_10307768 | Ga0207703_103077682 | 282 |
| 534 | 3300026041 | Ga0207639_10010241 | Ga0207639_100102413 | 282 |
| 535 | 3300026067 | Ga0207678_10001451 | Ga0207678_100014513 | 282 |
| 536 | 3300026078 | Ga0207702_10027171 | Ga0207702_100271712 | 282 |
| 537 | 3300026078 | Ga0207702_10107505 | Ga0207702_101075052 | 282 |
| 538 | 3300026088 | Ga0207641_10000006 | Ga0207641_10000006278 | 282 |
| 539 | 3300026089 | Ga0207648_10000546 | Ga0207648_1000054612 | 282 |
| 540 | 3300026095 | Ga0207676_10000417 | Ga0207676_1000041726 | 282 |
| 541 | 3300026116 | Ga0207674_10000566 | Ga0207674_1000056617 | 282 |
| 542 | 3300026118 | Ga0207675_100047375 | Ga0207675_1000473754 | 282 |
| 543 | 3300026121 | Ga0207683_10001155 | Ga0207683_1000115516 | 282 |
| 544 | 3300026142 | Ga0207698_10018922 | Ga0207698_100189222 | 282 |
| 545 | 3300028016 | Ga0265354_1001498 | Ga0265354_10014983 | 282 |
| 546 | 3300028379 | Ga0268266_10002040 | Ga0268266_1000204016 | 282 |
| 547 | 3300028380 | Ga0268265_10002458 | Ga0268265_100024583 | 282 |
| 548 | 3300028381 | Ga0268264_10002179 | Ga0268264_100021797 | 282 |
| 549 | 3300031090 | Ga0265760_10001146 | Ga0265760_100011463 | 282 |
| 550 | 3300031247 | Ga0265340_10036097 | Ga0265340_100360971 | 282 |
| 551 | 3300031249 | Ga0265339_10107573 | Ga0265339_101075731 | 282 |
| 552 | 3300031711 | Ga0265314_10003366 | Ga0265314_100033669 | 282 |
| 553 | 3300037418 | Ga0395900_0191558 | Ga0395900_0191558_540_1394 | 282 |
| 554 | 3300038443 | Ga0395901_0289934 | Ga0395901_0289934_82_936 | 282 |
| 555 | 3300039450 | Ga0436363_0379760 | Ga0436363_0379760_2380_3294 | 282 |
| 556 | 3300045976 | Ga0466967_0009616 | Ga0466967_0009616_5266_6123 | 282 |
| 557 | 3300046455 | Ga0495603_0112811 | Ga0495603_0112811_366_1220 | 282 |
| 558 | 3300046472 | Ga0495580_0004931 | Ga0495580_0004931_7157_8011 | 282 |
| 559 | 3300046472 | Ga0495580_0018653 | Ga0495580_0018653_3945_4796 | 282 |
| 560 | 3300046472 | Ga0495580_0066761 | Ga0495580_0066761_1125_1979 | 282 |
| 561 | 3300046472 | Ga0495580_0264236 | Ga0495580_0264236_154_1023 | 282 |
| 562 | 3300046684 | Ga0495669_0032391 | Ga0495669_0032391_1339_2190 | 282 |
| 563 | 3300048905 | Ga0496102_0077167 | Ga0496102_0077167_352_1203 | 282 |
| 564 | 3300048907 | Ga0496104_0104660 | Ga0496104_0104660_619_1467 | 282 |
| 565 | 3300048909 | Ga0496106_0094029 | Ga0496106_0094029_1062_1910 | 282 |
| 566 | 3300048911 | Ga0496108_0000095 | Ga0496108_0000095_65609_66457 | 282 |
| 567 | 3300048912 | Ga0496109_0000243 | Ga0496109_0000243_14283_15131 | 282 |
| 568 | 3300048913 | Ga0496110_0010266 | Ga0496110_0010266_4262_5110 | 282 |
| 569 | 3300048914 | Ga0496111_0074205 | Ga0496111_0074205_1588_2436 | 282 |
| 570 | 3300048915 | Ga0496112_0000038 | Ga0496112_0000038_84537_85385 | 282 |
| 571 | 3300048916 | Ga0496113_0000169 | Ga0496113_0000169_23985_24833 | 282 |
| 572 | 3300048918 | Ga0496115_0011881 | Ga0496115_0011881_2224_3072 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fc7-assembly1.cif.gz_D | studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr | 0.9595 | 1 | 254 |
| 3ftp-assembly1.cif.gz_D | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution | 0.9595 | 5 | 251 |
| 3imf-assembly1.cif.gz_C | 1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' | 0.9581 | 10 | 252 |
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.9581 | 7 | 250 |
| 3imf-assembly1.cif.gz_D | 1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' | 0.9565 | 10 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ftpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9553 | 5 | 251 | 3.40.50.720 |
| af_A0A1D8PPB1_4_280_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.955 | 7 | 252 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9485 | 3 | 83 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9473 | 6 | 253 | 3.40.50.720 |
| 4trrG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9471 | 8 | 251 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A518BHZ8-F1-model_v4 | Peroxisomal trans-2-enoyl-CoA reductase (EC 1.3.1.38) | 0.9674 | 1 | 253 |
GO:0005777
GO:0006633 GO:0008670 GO:0019166 |
| AF-A0A7I8W7N6-F1-model_v4 | Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] (EC 1.3.1.124) (2,4-dienoyl-CoA reductase 2) | 0.9646 | 1 | 254 |
GO:0005777
GO:0008670 GO:0009062 |
| AF-S3JGM5-F1-model_v4 | Glucose 1-dehydrogenase 2 (EC 1.1.1.47) | 0.9645 | 7 | 168 |
GO:0047936
|
| AF-A0A7K1K8T4-F1-model_v4 | SDR family oxidoreductase | 0.9618 | 7 | 253 |
GO:0005777
GO:0008670 GO:0009062 |
| AF-A0A4R7MEK3-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.9599 | 5 | 251 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar