F465110

General Info

Members Datasets Scaffolds Average Seq Length
572 281 572 282

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0105424|Ga0495608_0105424_51_1055
Length 334
Sequence MHPKELSRKPTGAGRAHTIKWAPSQRRALAALAGSGVAVYDVSSLPIERKDKVVFEKKLLSGKKILVTGGATGLGKSMGKRFLELGAQLYICGRREEVLKQAADELQKATGGTVKTFSCDVRDNERVEAMIENIWQDGPLDALVNNAAGNFLCRTEELSIGAFEAVIGIVLMGTIHATMACGRRWIKEKRKASVLSITTTYAQWGSPYVVPSSVAKAGVLNLTRSLAVEWGKYGIRFNAIAPGPVPTEGAFSRLMPVKSLEEMAKKRNPLGRFGTHQELADLAAFLVSDQSGYVNGEQIVMDGGEQLKGASEFSHLGDLLTEEQWQMMKPKKKG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
120 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
121 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
186 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.42
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12170407 2162886012 Bacteria 1387
2 MBSR1b_contig_831446 2162886012 Bacteria 2964
3 LJNas_1000712 3300000546 Bacteria 5595
4 JGI24752J21851_1000691 3300001976 Bacteria 4508
5 JGI24748J21848_1007843 3300002074 Unclassified 1253
6 JGI24738J21930_10024257 3300002075 Unclassified 1248
7 JGI24034J26672_10003883 3300002239 Bacteria 2101
8 JGI24034J26672_10004102 3300002239 Bacteria 2054
9 JGI24751J29686_10001089 3300002459 Bacteria 5889
10 Ga0065715_10091077 3300005293 Bacteria 6144
11 Ga0070658_10105845 3300005327 Bacteria 2327
12 Ga0070676_10000861 3300005328 Bacteria 14943
13 Ga0070683_100000141 3300005329 Bacteria 46683
14 Ga0070683_100049686 3300005329 Bacteria 3880
15 Ga0070690_100008269 3300005330 Bacteria 5985
16 Ga0070670_100009672 3300005331 Bacteria 8230
17 Ga0070670_100032237 3300005331 Bacteria 4512
18 Ga0070670_100042640 3300005331 Bacteria 3901
19 Ga0070670_100100921 3300005331 Bacteria 2485
20 Ga0070677_10003474 3300005333 Bacteria 5084
21 Ga0068869_100007756 3300005334 Bacteria 6883
22 Ga0068869_100151546 3300005334 Bacteria 1799
23 Ga0070666_10019520 3300005335 Bacteria 4377
24 Ga0070666_10274844 3300005335 Bacteria 1196
25 Ga0070680_100075542 3300005336 Bacteria 2774
26 Ga0070682_100020375 3300005337 Bacteria 3900
27 Ga0070682_100029737 3300005337 Bacteria 3292
28 Ga0068868_100002724 3300005338 Bacteria 12242
29 Ga0068868_100013441 3300005338 Bacteria 6002
30 Ga0070660_100008269 3300005339 Bacteria 7271
31 Ga0070660_100017786 3300005339 Bacteria 5185
32 Ga0070689_100001981 3300005340 Bacteria 13261
33 Ga0070687_100000859 3300005343 Bacteria 10193
34 Ga0070661_100001978 3300005344 Bacteria 14167
35 Ga0070661_100012142 3300005344 Bacteria 6022
36 Ga0070668_100044255 3300005347 Bacteria 3415
37 Ga0070669_100000984 3300005353 Bacteria 20777
38 Ga0070675_100013076 3300005354 Bacteria 6521
39 Ga0070671_100019576 3300005355 Bacteria 5511
40 Ga0070674_100111497 3300005356 Bacteria 2009
41 Ga0070673_100001798 3300005364 Bacteria 12794
42 Ga0070688_100000404 3300005365 Bacteria 21870
43 Ga0070659_100006119 3300005366 Bacteria 8683
44 Ga0070659_100061366 3300005366 Bacteria 2971
45 Ga0070667_100037279 3300005367 Bacteria 4076
46 Ga0070667_100096344 3300005367 Bacteria 2552
47 Ga0070667_100237547 3300005367 Bacteria 1626
48 Ga0070709_10000339 3300005434 Bacteria 29052
49 Ga0070709_10002189 3300005434 Bacteria 10591
50 Ga0070709_10035373 3300005434 Bacteria 3035
51 Ga0070709_10048774 3300005434 Bacteria 2644
52 Ga0070709_10286731 3300005434 Bacteria 1198
53 Ga0070709_10324113 3300005434 Unclassified 1131
54 Ga0070709_10354711 3300005434 Bacteria 1085
55 Ga0070714_100000047 3300005435 Bacteria 112707
56 Ga0070714_100003325 3300005435 Bacteria 11986
57 Ga0070714_100213503 3300005435 Bacteria 1770
58 Ga0070714_100428218 3300005435 Unclassified 1254
59 Ga0070713_100000590 3300005436 Bacteria 23065
60 Ga0070713_100016431 3300005436 Bacteria 5565
61 Ga0070713_100041917 3300005436 Bacteria 3732
62 Ga0070713_100100709 3300005436 Unclassified 2502
63 Ga0070713_100154838 3300005436 Bacteria 2042
64 Ga0070713_100219240 3300005436 Bacteria 1725
65 Ga0070710_10000881 3300005437 Bacteria 14369
66 Ga0070710_10046337 3300005437 Bacteria 2421
67 Ga0070710_10251915 3300005437 Bacteria 1135
68 Ga0070701_10017230 3300005438 Bacteria 3374
69 Ga0070711_100002546 3300005439 Bacteria 10431
70 Ga0070711_100004478 3300005439 Bacteria 8255
71 Ga0070711_100022800 3300005439 Bacteria 4063
72 Ga0070711_100030337 3300005439 Bacteria 3578
73 Ga0070711_100093833 3300005439 Bacteria 2168
74 Ga0070700_100049186 3300005441 Bacteria 2616
75 Ga0070708_100000435 3300005445 Bacteria 31161
76 Ga0070708_100000898 3300005445 Bacteria 22525
77 Ga0070708_100007462 3300005445 Bacteria 8756
78 Ga0070708_100025170 3300005445 Bacteria 5085
79 Ga0070708_100193845 3300005445 Bacteria 1901
80 Ga0070708_100197058 3300005445 Bacteria 1884
81 Ga0070708_100297116 3300005445 Bacteria 1521
82 Ga0070708_100641301 3300005445 Bacteria 1001
83 Ga0070663_100052878 3300005455 Bacteria 2898
84 Ga0070678_100006009 3300005456 Bacteria 7076
85 Ga0070678_100037841 3300005456 Bacteria 3391
86 Ga0070678_100272458 3300005456 Bacteria 1428
87 Ga0070662_100001110 3300005457 Bacteria 16436
88 Ga0070662_100051482 3300005457 Bacteria 2974
89 Ga0070662_100051928 3300005457 Bacteria 2962
90 Ga0070681_10000179 3300005458 Bacteria 48474
91 Ga0070681_10024932 3300005458 Bacteria 6017
92 Ga0070681_10051431 3300005458 Bacteria 4109
93 Ga0070681_10110912 3300005458 Bacteria 2683
94 Ga0070681_10117793 3300005458 Bacteria 2592
95 Ga0068867_100002720 3300005459 Bacteria 12472
96 Ga0070685_10000636 3300005466 Bacteria 19191
97 Ga0070706_100008394 3300005467 Bacteria 9625
98 Ga0070706_100032684 3300005467 Bacteria 4800
99 Ga0070707_100000605 3300005468 Bacteria 36094
100 Ga0070707_100024260 3300005468 Bacteria 5742
101 Ga0070707_100540316 3300005468 Bacteria 1127
102 Ga0070698_100003037 3300005471 Bacteria 18494
103 Ga0070699_100001736 3300005518 Bacteria 19896
104 Ga0070699_100045766 3300005518 Bacteria 3787
105 Ga0070699_100109505 3300005518 Bacteria 2424
106 Ga0070679_100007952 3300005530 Bacteria 9953
107 Ga0070679_100070161 3300005530 Bacteria 3496
108 Ga0070679_100228259 3300005530 Bacteria 1822
109 Ga0070679_100333753 3300005530 Bacteria 1465
110 Ga0070684_100000935 3300005535 Bacteria 20763
111 Ga0070684_100005398 3300005535 Bacteria 9793
112 Ga0070697_100000199 3300005536 Bacteria 49135
113 Ga0070697_100008683 3300005536 Bacteria 7937
114 Ga0070697_100044885 3300005536 Bacteria 3580
115 Ga0068853_100003141 3300005539 Bacteria 12626
116 Ga0068853_100024047 3300005539 Bacteria 5106
117 Ga0070672_100024156 3300005543 Bacteria 4487
118 Ga0070686_100000598 3300005544 Bacteria 21308
119 Ga0070695_100003295 3300005545 Bacteria 9436
120 Ga0070693_100019825 3300005547 Bacteria 3535
121 Ga0070693_100104995 3300005547 Bacteria 1728
122 Ga0070693_100231424 3300005547 Bacteria 1216
123 Ga0070665_100009022 3300005548 Bacteria 10101
124 Ga0068855_100020807 3300005563 Bacteria 7866
125 Ga0068855_100050505 3300005563 Unclassified 4900
126 Ga0068855_100083045 3300005563 Bacteria 3711
127 Ga0070664_100009623 3300005564 Bacteria 7840
128 Ga0070664_100254223 3300005564 Bacteria 1580
129 Ga0068857_100002528 3300005577 Bacteria 14974
130 Ga0068857_100206883 3300005577 Bacteria 1790
131 Ga0068854_100150108 3300005578 Bacteria 1796
132 Ga0068856_100018179 3300005614 Bacteria 6816
133 Ga0068856_100041109 3300005614 Unclassified 4543
134 Ga0068856_100042660 3300005614 Bacteria 4463
135 Ga0068856_100277212 3300005614 Bacteria 1693
136 Ga0070702_100005603 3300005615 Bacteria 5872
137 Ga0068852_100012174 3300005616 Bacteria 6517
138 Ga0068852_100067024 3300005616 Bacteria 3138
139 Ga0068859_100004950 3300005617 Bacteria 13535
140 Ga0068859_100265693 3300005617 Bacteria 1808
141 Ga0068864_100074565 3300005618 Bacteria 2961
142 Ga0068864_100110438 3300005618 Bacteria 2449
143 Ga0068866_10001000 3300005718 Bacteria 12409
144 Ga0068861_100035178 3300005719 Bacteria 3709
145 Ga0068861_100036800 3300005719 Bacteria 3635
146 Ga0068851_10011241 3300005834 Bacteria 4194
147 Ga0068870_10006694 3300005840 Bacteria 5097
148 Ga0068863_100055548 3300005841 Bacteria 3749
149 Ga0068863_100359978 3300005841 Bacteria 1418
150 Ga0068858_100007225 3300005842 Bacteria 10768
151 Ga0068860_100017192 3300005843 Bacteria 7050
152 Ga0068860_100059040 3300005843 Bacteria 3648
153 Ga0068860_100079354 3300005843 Bacteria 3121
154 Ga0068862_100003656 3300005844 Bacteria 13153
155 Ga0068862_100025221 3300005844 Bacteria 4991
156 Ga0081455_10024699 3300005937 Bacteria 5559
157 Ga0070717_10016809 3300006028 Bacteria 5679
158 Ga0070717_10035429 3300006028 Bacteria 4040
159 Ga0070717_10044469 3300006028 Bacteria 3626
160 Ga0070717_10113225 3300006028 Bacteria 2316
161 Ga0070717_10120763 3300006028 Unclassified 2245
162 Ga0070717_10305421 3300006028 Bacteria 1415
163 Ga0070717_10385091 3300006028 Unclassified 1258
164 Ga0070717_10423416 3300006028 Unclassified 1198
165 Ga0070715_10022890 3300006163 Bacteria 2441
166 Ga0070715_10066827 3300006163 Bacteria 1595
167 Ga0070716_100003260 3300006173 Bacteria 7622
168 Ga0070716_100003551 3300006173 Bacteria 7361
169 Ga0070716_100006703 3300006173 Bacteria 5641
170 Ga0070716_100062535 3300006173 Bacteria 2158
171 Ga0070716_100180654 3300006173 Bacteria 1385
172 Ga0070712_100000340 3300006175 Bacteria 26355
173 Ga0070712_100001045 3300006175 Bacteria 16718
174 Ga0070712_100002589 3300006175 Bacteria 11179
175 Ga0070712_100003020 3300006175 Bacteria 10412
176 Ga0070712_100003173 3300006175 Bacteria 10127
177 Ga0070712_100005954 3300006175 Bacteria 7538
178 Ga0070712_100089675 3300006175 Unclassified 2250
179 Ga0097621_100028124 3300006237 Bacteria 4429
180 Ga0068871_100068619 3300006358 Bacteria 2911
181 Ga0075428_100000099 3300006844 Bacteria 72800
182 Ga0075428_100005868 3300006844 Bacteria 13646
183 Ga0075434_100001284 3300006871 Bacteria 20946
184 Ga0075434_100002596 3300006871 Bacteria 15947
185 Ga0068865_100007877 3300006881 Bacteria 6575
186 Ga0097620_100004950 3300006931 Bacteria 13535
187 Ga0097620_100265684 3300006931 Bacteria 1808
188 Ga0075435_100004417 3300007076 Bacteria 9654
189 Ga0099794_10016565 3300007265 Bacteria 3270
190 Ga0099794_10022719 3300007265 Bacteria 2861
191 Ga0105240_10022103 3300009093 Bacteria 8442
192 Ga0105240_10096230 3300009093 Bacteria 3609
193 Ga0105240_10159352 3300009093 Bacteria 2682
194 Ga0105240_10289601 3300009093 Bacteria 1878
195 Ga0111539_10676782 3300009094 Bacteria 1201
196 Ga0105245_10002320 3300009098 Bacteria 17210
197 Ga0105245_10010241 3300009098 Bacteria 8164
198 Ga0105245_10219522 3300009098 Bacteria 1834
199 Ga0105247_10009920 3300009101 Bacteria 5769
200 Ga0105241_10050454 3300009174 Bacteria 3171
201 Ga0105241_10051379 3300009174 Bacteria 3143
202 Ga0105241_10082150 3300009174 Unclassified 2525
203 Ga0105242_10016155 3300009176 Bacteria 5799
204 Ga0105242_10213773 3300009176 Bacteria 1720
205 Ga0105248_10073600 3300009177 Bacteria 3839
206 Ga0105238_10104554 3300009551 Bacteria 2813
207 Ga0105238_10173094 3300009551 Bacteria 2135
208 Ga0105249_10013083 3300009553 Bacteria 7327
209 Ga0105249_10130349 3300009553 Bacteria 2400
210 Ga0105249_10383364 3300009553 Bacteria 1432
211 Ga0105239_10007719 3300010375 Bacteria 12313
212 Ga0105239_10060543 3300010375 Bacteria 4155
213 Ga0105239_10241074 3300010375 Bacteria 2029
214 Ga0105246_10001796 3300011119 Bacteria 12836
215 Ga0157373_10008624 3300013100 Bacteria 7566
216 Ga0157373_10062406 3300013100 Bacteria 2639
217 Ga0157371_10010946 3300013102 Bacteria 7030
218 Ga0157371_10238502 3300013102 Bacteria 1308
219 Ga0157370_10046235 3300013104 Bacteria 4173
220 Ga0157370_10054008 3300013104 Unclassified 3830
221 Ga0157369_10010680 3300013105 Bacteria 10451
222 Ga0157369_10089967 3300013105 Unclassified 3277
223 Ga0157369_10117275 3300013105 Unclassified 2826
224 Ga0157374_10014371 3300013296 Bacteria 6929
225 Ga0157374_10018502 3300013296 Bacteria 6150
226 Ga0157374_10050608 3300013296 Bacteria 3863
227 Ga0157378_10075654 3300013297 Bacteria 3032
228 Ga0157378_10095794 3300013297 Bacteria 2704
229 Ga0157372_10001689 3300013307 Bacteria 23868
230 Ga0157372_10031121 3300013307 Bacteria 5843
231 Ga0157372_10317463 3300013307 Bacteria 1814
232 Ga0157375_10028067 3300013308 Bacteria 5270
233 Ga0163163_10000850 3300014325 Bacteria 25970
234 Ga0163163_10036350 3300014325 Bacteria 4784
235 Ga0163163_10045846 3300014325 Bacteria 4293
236 Ga0163163_10231872 3300014325 Bacteria 1895
237 Ga0157380_10094176 3300014326 Bacteria 2478
238 Ga0182008_10010699 3300014497 Bacteria 4905
239 Ga0157377_10000535 3300014745 Bacteria 16132
240 Ga0157379_10028884 3300014968 Bacteria 4932
241 Ga0157376_10005692 3300014969 Bacteria 8730
242 Ga0157376_10036676 3300014969 Bacteria 3973
243 Ga0182006_1008740 3300015261 Bacteria 4582
244 Ga0182006_1010280 3300015261 Bacteria 4168
245 Ga0182005_1006704 3300015265 Bacteria 3495
246 Ga0163161_10001298 3300017792 Bacteria 18632
247 Ga0213874_10005998 3300021377 Bacteria 2857
248 Ga0224570_101524 3300022730 Bacteria 1710
249 Ga0224569_101211 3300022732 Bacteria 2187
250 Ga0228598_1000061 3300024227 Bacteria 15965
251 Ga0228598_1000687 3300024227 Bacteria 7168
252 Ga0228598_1007740 3300024227 Bacteria 2181
253 Ga0207697_10007464 3300025315 Bacteria 4874
254 Ga0207656_10084667 3300025321 Bacteria 1430
255 Ga0207656_10138597 3300025321 Bacteria 1145
256 Ga0207682_10001380 3300025893 Bacteria 11215
257 Ga0207692_10079457 3300025898 Bacteria 1750
258 Ga0207642_10029081 3300025899 Bacteria 2284
259 Ga0207710_10026910 3300025900 Bacteria 2487
260 Ga0207688_10001352 3300025901 Bacteria 12744
261 Ga0207680_10006311 3300025903 Bacteria 5722
262 Ga0207647_10005760 3300025904 Bacteria 9041
263 Ga0207685_10009497 3300025905 Bacteria 2828
264 Ga0207685_10051162 3300025905 Bacteria 1595
265 Ga0207699_10001110 3300025906 Bacteria 12729
266 Ga0207699_10004886 3300025906 Bacteria 6416
267 Ga0207699_10037285 3300025906 Bacteria 2778
268 Ga0207699_10044556 3300025906 Bacteria 2583
269 Ga0207699_10068357 3300025906 Bacteria 2163
270 Ga0207699_10172077 3300025906 Unclassified 1449
271 Ga0207645_10000069 3300025907 Bacteria 75174
272 Ga0207643_10005786 3300025908 Bacteria 6607
273 Ga0207643_10009653 3300025908 Bacteria 5182
274 Ga0207705_10458096 3300025909 Unclassified 989
275 Ga0207684_10001311 3300025910 Bacteria 27341
276 Ga0207684_10024057 3300025910 Bacteria 5197
277 Ga0207654_10031178 3300025911 Bacteria 2934
278 Ga0207654_10037191 3300025911 Bacteria 2723
279 Ga0207707_10002140 3300025912 Bacteria 17887
280 Ga0207707_10030298 3300025912 Unclassified 4734
281 Ga0207695_10119919 3300025913 Unclassified 2600
282 Ga0207671_10259258 3300025914 Bacteria 1368
283 Ga0207693_10000038 3300025915 Bacteria 109225
284 Ga0207693_10000182 3300025915 Bacteria 57166
285 Ga0207693_10003133 3300025915 Bacteria 14225
286 Ga0207693_10005353 3300025915 Bacteria 10723
287 Ga0207693_10008388 3300025915 Bacteria 8455
288 Ga0207693_10009178 3300025915 Bacteria 8077
289 Ga0207663_10003648 3300025916 Bacteria 7563
290 Ga0207663_10024132 3300025916 Bacteria 3499
291 Ga0207663_10058857 3300025916 Bacteria 2428
292 Ga0207663_10128455 3300025916 Bacteria 1747
293 Ga0207660_10000064 3300025917 Bacteria 55686
294 Ga0207660_10108483 3300025917 Bacteria 2085
295 Ga0207660_10440099 3300025917 Bacteria 1053
296 Ga0207662_10008546 3300025918 Bacteria 5612
297 Ga0207657_10000217 3300025919 Bacteria 59841
298 Ga0207657_10011100 3300025919 Bacteria 8954
299 Ga0207649_10008473 3300025920 Bacteria 5607
300 Ga0207652_10002404 3300025921 Bacteria 15803
301 Ga0207652_10250274 3300025921 Bacteria 1598
302 Ga0207646_10001857 3300025922 Bacteria 25474
303 Ga0207646_10060331 3300025922 Bacteria 3387
304 Ga0207646_10115803 3300025922 Bacteria 2407
305 Ga0207646_10231266 3300025922 Bacteria 1670
306 Ga0207681_10011657 3300025923 Bacteria 5404
307 Ga0207681_10024111 3300025923 Bacteria 3901
308 Ga0207650_10000416 3300025925 Bacteria 37860
309 Ga0207650_10052316 3300025925 Bacteria 3025
310 Ga0207687_10005810 3300025927 Bacteria 8164
311 Ga0207687_10006118 3300025927 Bacteria 7966
312 Ga0207687_10150264 3300025927 Bacteria 1776
313 Ga0207700_10000217 3300025928 Bacteria 34284
314 Ga0207700_10001212 3300025928 Bacteria 14785
315 Ga0207700_10002922 3300025928 Bacteria 9852
316 Ga0207700_10015985 3300025928 Bacteria 4972
317 Ga0207700_10176573 3300025928 Bacteria 1785
318 Ga0207700_10333641 3300025928 Unclassified 1317
319 Ga0207700_10601545 3300025928 Unclassified 978
320 Ga0207664_10000414 3300025929 Bacteria 30456
321 Ga0207664_10010642 3300025929 Bacteria 6503
322 Ga0207664_10163691 3300025929 Bacteria 1899
323 Ga0207664_10186744 3300025929 Bacteria 1782
324 Ga0207664_10232064 3300025929 Bacteria 1604
325 Ga0207644_10000489 3300025931 Bacteria 25447
326 Ga0207690_10080881 3300025932 Bacteria 2269
327 Ga0207690_10144929 3300025932 Bacteria 1755
328 Ga0207706_10007326 3300025933 Bacteria 10202
329 Ga0207706_10012998 3300025933 Bacteria 7575
330 Ga0207706_10072460 3300025933 Bacteria 3030
331 Ga0207706_10234569 3300025933 Bacteria 1604
332 Ga0207686_10009222 3300025934 Bacteria 5351
333 Ga0207704_10050829 3300025938 Bacteria 2503
334 Ga0207665_10001393 3300025939 Bacteria 16271
335 Ga0207665_10007198 3300025939 Bacteria 7361
336 Ga0207665_10017505 3300025939 Bacteria 4710
337 Ga0207665_10022780 3300025939 Bacteria 4123
338 Ga0207665_10112561 3300025939 Bacteria 1914
339 Ga0207665_10123572 3300025939 Unclassified 1830
340 Ga0207665_10283900 3300025939 Bacteria 1233
341 Ga0207691_10001375 3300025940 Bacteria 24284
342 Ga0207711_10012249 3300025941 Bacteria 7130
343 Ga0207711_10049412 3300025941 Bacteria 3602
344 Ga0207689_10006810 3300025942 Bacteria 10054
345 Ga0207689_10018519 3300025942 Bacteria 5875
346 Ga0207689_10029835 3300025942 Bacteria 4548
347 Ga0207689_10229576 3300025942 Bacteria 1534
348 Ga0207661_10010921 3300025944 Bacteria 6557
349 Ga0207679_10000120 3300025945 Bacteria 63924
350 Ga0207667_10009748 3300025949 Bacteria 11294
351 Ga0207667_10033752 3300025949 Bacteria 5499
352 Ga0207667_10118490 3300025949 Bacteria 2728
353 Ga0207651_10009101 3300025960 Bacteria 5407
354 Ga0207712_10172276 3300025961 Bacteria 1693
355 Ga0207668_10034231 3300025972 Bacteria 3372
356 Ga0207640_10272291 3300025981 Bacteria 1325
357 Ga0207658_10010665 3300025986 Bacteria 6246
358 Ga0207677_10008083 3300026023 Bacteria 5856
359 Ga0207703_10307768 3300026035 Bacteria 1447
360 Ga0207639_10004056 3300026041 Bacteria 9879
361 Ga0207639_10010241 3300026041 Bacteria 6487
362 Ga0207639_10030949 3300026041 Bacteria 3930
363 Ga0207678_10001451 3300026067 Bacteria 21777
364 Ga0207708_10147310 3300026075 Bacteria 1851
365 Ga0207702_10027171 3300026078 Bacteria 4752
366 Ga0207702_10057668 3300026078 Bacteria 3302
367 Ga0207702_10085385 3300026078 Bacteria 2750
368 Ga0207702_10107505 3300026078 Bacteria 2474
369 Ga0207641_10000006 3300026088 Bacteria 442569
370 Ga0207641_10337876 3300026088 Bacteria 1432
371 Ga0207648_10000546 3300026089 Bacteria 42051
372 Ga0207648_10028022 3300026089 Bacteria 4998
373 Ga0207676_10000417 3300026095 Bacteria 36070
374 Ga0207676_10195183 3300026095 Bacteria 1785
375 Ga0207674_10000566 3300026116 Bacteria 48425
376 Ga0207674_10430183 3300026116 Bacteria 1276
377 Ga0207675_100009894 3300026118 Bacteria 8920
378 Ga0207675_100047375 3300026118 Bacteria 4013
379 Ga0207683_10001155 3300026121 Bacteria 24032
380 Ga0207683_10037223 3300026121 Bacteria 4237
381 Ga0207698_10018922 3300026142 Bacteria 4703
382 Ga0209588_1005826 3300027671 Bacteria 3549
383 Ga0265354_1001498 3300028016 Bacteria 3302
384 Ga0265356_1000309 3300028017 Bacteria 9112
385 Ga0268266_10002040 3300028379 Bacteria 22418
386 Ga0268266_10243290 3300028379 Bacteria 1661
387 Ga0268265_10002458 3300028380 Bacteria 13941
388 Ga0268264_10002179 3300028381 Bacteria 17422
389 Ga0265338_10015603 3300028800 Bacteria 8325
390 Ga0265338_10029924 3300028800 Bacteria 5384
391 Ga0265338_10106664 3300028800 Bacteria 2267
392 Ga0265338_10121027 3300028800 Bacteria 2086
393 Ga0265338_10186053 3300028800 Unclassified 1579
394 Ga0265762_1000635 3300030760 Bacteria 6176
395 Ga0265762_1001637 3300030760 Bacteria 4078
396 Ga0265762_1002224 3300030760 Unclassified 3511
397 Ga0265762_1033635 3300030760 Bacteria 982
398 Ga0265760_10000193 3300031090 Bacteria 16134
399 Ga0265760_10001146 3300031090 Bacteria 7711
400 Ga0265760_10048401 3300031090 Bacteria 1277
401 Ga0265328_10023226 3300031239 Bacteria 2355
402 Ga0265325_10003919 3300031241 Bacteria 9530
403 Ga0265325_10117091 3300031241 Bacteria 1288
404 Ga0265325_10154828 3300031241 Bacteria 1082
405 Ga0265340_10036097 3300031247 Bacteria 2452
406 Ga0265339_10015289 3300031249 Bacteria 4604
407 Ga0265339_10034680 3300031249 Bacteria 2834
408 Ga0265339_10053455 3300031249 Unclassified 2197
409 Ga0265339_10107573 3300031249 Bacteria 1446
410 Ga0265316_10041516 3300031344 Bacteria 3681
411 Ga0265316_10071120 3300031344 Bacteria 2682
412 Ga0265314_10003366 3300031711 Bacteria 15501
413 Ga0265314_10017964 3300031711 Bacteria 5534
414 Ga0265342_10011481 3300031712 Bacteria 6061
415 Ga0316214_1003119 3300033545 Bacteria 2079
416 Ga0373926_0016904 3300035083 Bacteria 2500
417 Ga0373934_0151142 3300035086 Unclassified 951
418 Ga0373944_0013304 3300035089 Bacteria 2280
419 Ga0373936_0006256 3300035113 Bacteria 4490
420 Ga0373936_0008642 3300035113 Bacteria 3834
421 Ga0373936_0101667 3300035113 Bacteria 1213
422 Ga0373945_0000872 3300035116 Bacteria 8910
423 Ga0373945_0020585 3300035116 Bacteria 2259
424 Ga0373945_0033686 3300035116 Bacteria 1822
425 Ga0373953_0157143 3300035117 Bacteria 976
426 Ga0373956_0057132 3300035119 Bacteria 1763
427 Ga0373957_0002345 3300035120 Bacteria 5383
428 Ga0373943_0002667 3300035170 Bacteria 8125
429 Ga0373943_0005384 3300035170 Bacteria 5759
430 Ga0373943_0082260 3300035170 Unclassified 1653
431 Ga0373943_0221142 3300035170 Bacteria 1055
432 Ga0373946_0005783 3300035171 Bacteria 4473
433 Ga0373946_0026981 3300035171 Bacteria 2269
434 Ga0373946_0200923 3300035171 Bacteria 955
435 Ga0373955_0006956 3300035172 Bacteria 5176
436 Ga0373955_0291370 3300035172 Bacteria 983
437 Ga0373924_0000033 3300035410 Bacteria 35461
438 Ga0373924_0014465 3300035410 Bacteria 2983
439 Ga0373924_0030333 3300035410 Bacteria 2167
440 Ga0373935_0000723 3300035692 Bacteria 17580
441 Ga0373935_0009713 3300035692 Bacteria 5761
442 Ga0373935_0022591 3300035692 Bacteria 3859
443 Ga0373935_0191381 3300035692 Bacteria 1409
444 Ga0373927_0000297 3300035695 Bacteria 39222
445 Ga0373927_0068529 3300035695 Bacteria 2296
446 Ga0373927_0216757 3300035695 Bacteria 1257
447 Ga0373933_0018335 3300035724 Bacteria 3935
448 Ga0373933_0020408 3300035724 Bacteria 3755
449 Ga0373947_0023967 3300035725 Bacteria 3553
450 Ga0373947_0027393 3300035725 Bacteria 3335
451 Ga0373947_0047580 3300035725 Unclassified 2571
452 Ga0373947_0141249 3300035725 Bacteria 1544
453 Ga0373937_0002928 3300036401 Bacteria 14276
454 Ga0373937_0010493 3300036401 Bacteria 8090
455 Ga0373937_0018616 3300036401 Bacteria 6204
456 Ga0373937_0033071 3300036401 Bacteria 4694
457 Ga0373937_0053141 3300036401 Bacteria 3716
458 Ga0373937_0065238 3300036401 Bacteria 3351
459 Ga0373937_0145838 3300036401 Bacteria 2216
460 Ga0373937_0165664 3300036401 Bacteria 2073
461 Ga0316584_0056681 3300036712 Bacteria 2933
462 Ga0316584_0116110 3300036712 Bacteria 2002
463 Ga0373925_0000684 3300037068 Bacteria 31822
464 Ga0373925_0012023 3300037068 Bacteria 6268
465 Ga0373925_0013265 3300037068 Bacteria 5964
466 Ga0373925_0017480 3300037068 Bacteria 5198
467 Ga0373925_0137028 3300037068 Bacteria 1913
468 Ga0373925_0259602 3300037068 Bacteria 1395
469 Ga0395900_0191558 3300037418 Unclassified 2074
470 Ga0395901_0289934 3300038443 Unclassified 1699
471 Ga0436363_0379760 3300039450 Bacteria 3464
472 Ga0436363_1066446 3300039450 Bacteria 1273
473 Ga0436362_0226101 3300039453 Bacteria 2658
474 Ga0436362_1103826 3300039453 Bacteria 2928
475 Ga0451577_0135601 3300042876 Bacteria 2210
476 Ga0466963_0006934 3300044694 Bacteria 6740
477 Ga0466957_0007239 3300044842 Bacteria 6272
478 Ga0466957_0130583 3300044842 Bacteria 1609
479 Ga0466957_0243859 3300044842 Bacteria 1193
480 Ga0466957_0379528 3300044842 Bacteria 964
481 Ga0466959_0041003 3300045049 Bacteria 3419
482 Ga0466967_0007320 3300045976 Bacteria 7949
483 Ga0466967_0009616 3300045976 Bacteria 7186
484 Ga0495592_0185654 3300046454 Bacteria 1413
485 Ga0495603_0092898 3300046455 Bacteria 1764
486 Ga0495603_0112811 3300046455 Bacteria 1585
487 Ga0495629_0000065 3300046459 Bacteria 93747
488 Ga0495629_0012021 3300046459 Bacteria 6275
489 Ga0495651_0087723 3300046462 Bacteria 2339
490 Ga0495580_0004509 3300046472 Bacteria 11696
491 Ga0495580_0004931 3300046472 Bacteria 11155
492 Ga0495580_0018653 3300046472 Bacteria 5163
493 Ga0495580_0032970 3300046472 Bacteria 3732
494 Ga0495580_0066761 3300046472 Bacteria 2517
495 Ga0495580_0100270 3300046472 Bacteria 2014
496 Ga0495580_0264236 3300046472 Bacteria 1176
497 Ga0495580_0284918 3300046472 Bacteria 1127
498 Ga0495582_0053997 3300046473 Bacteria 2216
499 Ga0495582_0147818 3300046473 Bacteria 1333
500 Ga0495639_0004865 3300046475 Bacteria 5763
501 Ga0495639_0101365 3300046475 Bacteria 1359
502 Ga0495664_0006322 3300046477 Bacteria 6544
503 Ga0495664_0071311 3300046477 Bacteria 2075
504 Ga0495594_0010861 3300046499 Bacteria 4729
505 Ga0495594_0040837 3300046499 Bacteria 2540
506 Ga0495608_0105424 3300046511 Bacteria 1815
507 Ga0495630_0129587 3300046517 Bacteria 1915
508 Ga0495652_0275639 3300046529 Bacteria 1234
509 Ga0495640_0023686 3300046533 Bacteria 4468
510 Ga0495645_0422154 3300046543 Bacteria 846
511 Ga0495634_0074288 3300046642 Bacteria 2234
512 Ga0495635_0002612 3300046663 Bacteria 12332
513 Ga0495599_0209399 3300046678 Unclassified 1196
514 Ga0495623_0002920 3300046679 Bacteria 11248
515 Ga0495623_0164924 3300046679 Unclassified 1299
516 Ga0495647_0060389 3300046681 Bacteria 1494
517 Ga0495658_0000013 3300046683 Bacteria 98426
518 Ga0495658_0027496 3300046683 Bacteria 3062
519 Ga0495669_0032391 3300046684 Bacteria 2298
520 Ga0495613_0001534 3300046689 Bacteria 17575
521 Ga0495581_0014954 3300047315 Bacteria 4502
522 Ga0495581_0150795 3300047315 Bacteria 1357
523 Ga0495604_0070773 3300047317 Bacteria 2641
524 Ga0495674_0079170 3300047319 Bacteria 2822
525 Ga0495674_0106278 3300047319 Bacteria 2384
526 Ga0495676_0004693 3300047321 Bacteria 12506
527 Ga0495676_0248423 3300047321 Bacteria 1214
528 Ga0495680_0000072 3300047322 Bacteria 87431
529 Ga0495680_0144556 3300047322 Bacteria 1738
530 Ga0495684_0112423 3300047471 Bacteria 2054
531 Ga0495593_0221467 3300047673 Bacteria 949
532 Ga0495614_0000906 3300048089 Bacteria 12609
533 Ga0495614_0027109 3300048089 Bacteria 2471
534 Ga0496100_0044609 3300048903 Bacteria 2841
535 Ga0496101_0225654 3300048904 Bacteria 1455
536 Ga0496102_0023530 3300048905 Bacteria 5474
537 Ga0496102_0046059 3300048905 Bacteria 3960
538 Ga0496102_0077167 3300048905 Unclassified 3066
539 Ga0496102_0415785 3300048905 Bacteria 1263
540 Ga0496103_0076671 3300048906 Bacteria 2098
541 Ga0496104_0035311 3300048907 Bacteria 4668
542 Ga0496104_0104660 3300048907 Bacteria 2712
543 Ga0496105_0002203 3300048908 Bacteria 14114
544 Ga0496105_0415499 3300048908 Unclassified 1066
545 Ga0496106_0094029 3300048909 Bacteria 2317
546 Ga0496107_0064753 3300048910 Bacteria 2650
547 Ga0496108_0000095 3300048911 Bacteria 92520
548 Ga0496108_0057686 3300048911 Bacteria 3262
549 Ga0496109_0000243 3300048912 Bacteria 52776
550 Ga0496109_0061060 3300048912 Bacteria 3445
551 Ga0496110_0010266 3300048913 Bacteria 7610
552 Ga0496110_0027838 3300048913 Bacteria 4849
553 Ga0496110_0028225 3300048913 Bacteria 4817
554 Ga0496111_0001306 3300048914 Bacteria 13976
555 Ga0496111_0068894 3300048914 Bacteria 2572
556 Ga0496111_0074205 3300048914 Bacteria 2478
557 Ga0496112_0000038 3300048915 Bacteria 94892
558 Ga0496112_0027316 3300048915 Bacteria 5503
559 Ga0496112_0032608 3300048915 Bacteria 5058
560 Ga0496113_0000145 3300048916 Bacteria 30751
561 Ga0496113_0000169 3300048916 Bacteria 28802
562 Ga0496114_0180447 3300048917 Bacteria 1844
563 Ga0496115_0011881 3300048918 Bacteria 6541
564 Ga0496115_0517939 3300048918 Bacteria 957
565 Ga0501077_0347194 3300049593 Bacteria 947
566 nmdc:mga08y16_744418_c1 3300050511 Bacteria 977
567 nmdc:mga0n895_215189_c1 3300050512 Bacteria 1951
568 nmdc:mga0n895_3333_c1 3300050512 Bacteria 12910
569 nmdc:mga0rr50_108122_c1 3300050513 Bacteria 2197
570 nmdc:mga0a205_731_c1 3300050515 Bacteria 26481
571 Ga0495595_0179441 3300053084 Bacteria 1050
572 Ga0495619_0001673 3300053085 Bacteria 14653

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0135601 Ga0451577_0135601_914_1669 237
2 3300006871 Ga0075434_100002596 Ga0075434_1000025963 242
3 3300007076 Ga0075435_100004417 Ga0075435_1000044172 242
4 3300035172 Ga0373955_0291370 Ga0373955_0291370_140_898 242
5 3300050512 nmdc:mga0n895_3333_c1 nmdc:mga0n895_3333_c1_1474_2346 242
6 3300050513 nmdc:mga0rr50_108122_c1 nmdc:mga0rr50_108122_c1_249_1121 242
7 3300050515 nmdc:mga0a205_731_c1 nmdc:mga0a205_731_c1_15836_16708 242
8 3300005457 Ga0070662_100051928 Ga0070662_1000519282 252
9 3300005545 Ga0070695_100003295 Ga0070695_1000032953 252
10 3300014326 Ga0157380_10094176 Ga0157380_100941762 252
11 3300025933 Ga0207706_10072460 Ga0207706_100724603 252
12 3300000546 LJNas_1000712 LJNas_10007124 253
13 3300046543 Ga0495645_0422154 Ga0495645_0422154_24_800 256
14 3300048914 Ga0496111_0068894 Ga0496111_0068894_23_799 257
15 3300039453 Ga0436362_1103826 Ga0436362_1103826_2116_2907 258
16 3300046455 Ga0495603_0092898 Ga0495603_0092898_786_1625 262
17 3300046459 Ga0495629_0012021 Ga0495629_0012021_2474_3313 262
18 3300046475 Ga0495639_0004865 Ga0495639_0004865_2311_3150 262
19 3300047315 Ga0495581_0014954 Ga0495581_0014954_3534_4373 262
20 3300047321 Ga0495676_0004693 Ga0495676_0004693_5836_6675 262
21 3300028379 Ga0268266_10243290 Ga0268266_102432902 263
22 3300046459 Ga0495629_0000065 Ga0495629_0000065_11352_12176 263
23 3300046473 Ga0495582_0053997 Ga0495582_0053997_286_1110 263
24 3300046475 Ga0495639_0101365 Ga0495639_0101365_426_1250 263
25 3300046499 Ga0495594_0040837 Ga0495594_0040837_1344_2168 263
26 3300046533 Ga0495640_0023686 Ga0495640_0023686_162_986 263
27 3300046642 Ga0495634_0074288 Ga0495634_0074288_979_1803 263
28 3300046663 Ga0495635_0002612 Ga0495635_0002612_8836_9660 263
29 3300046681 Ga0495647_0060389 Ga0495647_0060389_14_838 263
30 3300046683 Ga0495658_0000013 Ga0495658_0000013_29777_30601 263
31 3300046689 Ga0495613_0001534 Ga0495613_0001534_13455_14279 263
32 3300047315 Ga0495581_0150795 Ga0495581_0150795_407_1231 263
33 3300047321 Ga0495676_0248423 Ga0495676_0248423_19_843 263
34 3300047322 Ga0495680_0000072 Ga0495680_0000072_56482_57306 263
35 3300048089 Ga0495614_0000906 Ga0495614_0000906_5013_5837 263
36 3300053085 Ga0495619_0001673 Ga0495619_0001673_11417_12241 263
37 3300036401 Ga0373937_0145838 Ga0373937_0145838_133_1005 264
38 3300005333 Ga0070677_10003474 Ga0070677_100034743 266
39 3300005367 Ga0070667_100096344 Ga0070667_1000963442 266
40 3300026075 Ga0207708_10147310 Ga0207708_101473102 266
41 3300035170 Ga0373943_0082260 Ga0373943_0082260_666_1526 266
42 3300035410 Ga0373924_0030333 Ga0373924_0030333_1140_2000 266
43 3300035725 Ga0373947_0047580 Ga0373947_0047580_1080_1940 266
44 3300047322 Ga0495680_0144556 Ga0495680_0144556_33_881 266
45 3300005331 Ga0070670_100042640 Ga0070670_1000426404 267
46 3300005335 Ga0070666_10274844 Ga0070666_102748442 267
47 3300005456 Ga0070678_100037841 Ga0070678_1000378413 267
48 3300005548 Ga0070665_100009022 Ga0070665_1000090223 267
49 3300005564 Ga0070664_100254223 Ga0070664_1002542232 267
50 3300005618 Ga0068864_100074565 Ga0068864_1000745653 267
51 3300005843 Ga0068860_100059040 Ga0068860_1000590404 267
52 3300006844 Ga0075428_100000099 Ga0075428_1000000999 267
53 3300014325 Ga0163163_10036350 Ga0163163_100363502 267
54 3300025893 Ga0207682_10001380 Ga0207682_100013809 267
55 3300025925 Ga0207650_10052316 Ga0207650_100523162 267
56 3300025933 Ga0207706_10234569 Ga0207706_102345692 267
57 3300026089 Ga0207648_10028022 Ga0207648_100280225 267
58 3300026121 Ga0207683_10037223 Ga0207683_100372232 267
59 3300005841 Ga0068863_100359978 Ga0068863_1003599782 268
60 3300005937 Ga0081455_10024699 Ga0081455_100246993 268
61 3300026088 Ga0207641_10337876 Ga0207641_103378762 268
62 3300009553 Ga0105249_10383364 Ga0105249_103833642 270
63 3300025961 Ga0207712_10172276 Ga0207712_101722762 270
64 3300005445 Ga0070708_100197058 Ga0070708_1001970582 272
65 3300005536 Ga0070697_100044885 Ga0070697_1000448853 272
66 3300044842 Ga0466957_0130583 Ga0466957_0130583_381_1217 273
67 3300005445 Ga0070708_100000898 Ga0070708_10000089821 274
68 3300005518 Ga0070699_100109505 Ga0070699_1001095053 274
69 3300005530 Ga0070679_100228259 Ga0070679_1002282592 274
70 3300005536 Ga0070697_100008683 Ga0070697_1000086833 274
71 3300006173 Ga0070716_100180654 Ga0070716_1001806542 274
72 3300007265 Ga0099794_10016565 Ga0099794_100165654 274
73 3300007265 Ga0099794_10022719 Ga0099794_100227192 274
74 3300027671 Ga0209588_1005826 Ga0209588_10058263 274
75 3300053084 Ga0495595_0179441 Ga0495595_0179441_130_978 274
76 3300005617 Ga0068859_100265693 Ga0068859_1002656932 276
77 3300006931 Ga0097620_100265684 Ga0097620_1002656842 276
78 3300005434 Ga0070709_10000339 Ga0070709_100003396 277
79 3300005436 Ga0070713_100000590 Ga0070713_10000059017 277
80 3300005437 Ga0070710_10046337 Ga0070710_100463372 277
81 3300005439 Ga0070711_100022800 Ga0070711_1000228003 277
82 3300006028 Ga0070717_10044469 Ga0070717_100444695 277
83 3300006173 Ga0070716_100003551 Ga0070716_1000035518 277
84 3300006175 Ga0070712_100000340 Ga0070712_1000003402 277
85 3300006844 Ga0075428_100005868 Ga0075428_1000058685 277
86 3300013296 Ga0157374_10050608 Ga0157374_100506083 277
87 3300025898 Ga0207692_10079457 Ga0207692_100794573 277
88 3300025906 Ga0207699_10001110 Ga0207699_100011107 277
89 3300025915 Ga0207693_10000182 Ga0207693_1000018236 277
90 3300025928 Ga0207700_10000217 Ga0207700_1000021724 277
91 3300025939 Ga0207665_10007198 Ga0207665_100071984 277
92 3300030760 Ga0265762_1002224 Ga0265762_10022243 277
93 3300031090 Ga0265760_10048401 Ga0265760_100484012 277
94 3300039450 Ga0436363_1066446 Ga0436363_1066446_259_1095 277
95 3300045976 Ga0466967_0007320 Ga0466967_0007320_423_1265 277
96 3300046472 Ga0495580_0100270 Ga0495580_0100270_945_1781 277
97 3300005437 Ga0070710_10000881 Ga0070710_100008816 278
98 3300006028 Ga0070717_10035429 Ga0070717_100354292 278
99 3300006028 Ga0070717_10120763 Ga0070717_101207634 278
100 3300036401 Ga0373937_0053141 Ga0373937_0053141_291_1217 278
101 3300036712 Ga0316584_0056681 Ga0316584_0056681_924_1763 278
102 3300036712 Ga0316584_0116110 Ga0316584_0116110_373_1254 278
103 3300044694 Ga0466963_0006934 Ga0466963_0006934_3514_4359 278
104 3300044842 Ga0466957_0243859 Ga0466957_0243859_237_1082 278
105 3300047319 Ga0495674_0106278 Ga0495674_0106278_800_1726 278
106 3300005336 Ga0070680_100075542 Ga0070680_1000755423 279
107 3300005434 Ga0070709_10324113 Ga0070709_103241132 279
108 3300005436 Ga0070713_100100709 Ga0070713_1001007093 279
109 3300005445 Ga0070708_100025170 Ga0070708_1000251706 279
110 3300005445 Ga0070708_100641301 Ga0070708_1006413011 279
111 3300005457 Ga0070662_100051482 Ga0070662_1000514822 279
112 3300005458 Ga0070681_10117793 Ga0070681_101177932 279
113 3300005535 Ga0070684_100005398 Ga0070684_1000053987 279
114 3300005719 Ga0068861_100035178 Ga0068861_1000351782 279
115 3300006028 Ga0070717_10305421 Ga0070717_103054212 279
116 3300009093 Ga0105240_10159352 Ga0105240_101593521 279
117 3300009098 Ga0105245_10010241 Ga0105245_100102414 279
118 3300009174 Ga0105241_10082150 Ga0105241_100821501 279
119 3300009551 Ga0105238_10104554 Ga0105238_101045544 279
120 3300009553 Ga0105249_10130349 Ga0105249_101303492 279
121 3300010375 Ga0105239_10241074 Ga0105239_102410742 279
122 3300013296 Ga0157374_10014371 Ga0157374_100143715 279
123 3300013297 Ga0157378_10075654 Ga0157378_100756543 279
124 3300014497 Ga0182008_10010699 Ga0182008_100106995 279
125 3300015261 Ga0182006_1010280 Ga0182006_10102804 279
126 3300025906 Ga0207699_10172077 Ga0207699_101720772 279
127 3300025908 Ga0207643_10009653 Ga0207643_100096532 279
128 3300025917 Ga0207660_10108483 Ga0207660_101084831 279
129 3300025923 Ga0207681_10024111 Ga0207681_100241113 279
130 3300025927 Ga0207687_10005810 Ga0207687_100058104 279
131 3300025928 Ga0207700_10015985 Ga0207700_100159852 279
132 3300025928 Ga0207700_10333641 Ga0207700_103336411 279
133 3300025928 Ga0207700_10601545 Ga0207700_106015451 279
134 3300025932 Ga0207690_10144929 Ga0207690_101449292 279
135 3300025933 Ga0207706_10012998 Ga0207706_100129982 279
136 3300025942 Ga0207689_10018519 Ga0207689_100185195 279
137 3300026041 Ga0207639_10030949 Ga0207639_100309492 279
138 3300026118 Ga0207675_100009894 Ga0207675_1000098945 279
139 3300028800 Ga0265338_10029924 Ga0265338_100299247 279
140 3300030760 Ga0265762_1000635 Ga0265762_10006353 279
141 3300031239 Ga0265328_10023226 Ga0265328_100232262 279
142 3300031241 Ga0265325_10154828 Ga0265325_101548281 279
143 3300031249 Ga0265339_10034680 Ga0265339_100346802 279
144 3300031344 Ga0265316_10071120 Ga0265316_100711203 279
145 3300046472 Ga0495580_0284918 Ga0495580_0284918_227_1069 279
146 3300048908 Ga0496105_0415499 Ga0496105_0415499_80_928 279
147 3300048913 Ga0496110_0027838 Ga0496110_0027838_1228_2079 279
148 3300048914 Ga0496111_0001306 Ga0496111_0001306_9011_9862 279
149 3300048918 Ga0496115_0517939 Ga0496115_0517939_27_878 279
150 3300005334 Ga0068869_100151546 Ga0068869_1001515462 280
151 3300005434 Ga0070709_10035373 Ga0070709_100353734 280
152 3300005434 Ga0070709_10048774 Ga0070709_100487742 280
153 3300005434 Ga0070709_10354711 Ga0070709_103547112 280
154 3300005435 Ga0070714_100000047 Ga0070714_10000004713 280
155 3300005435 Ga0070714_100003325 Ga0070714_10000332513 280
156 3300005435 Ga0070714_100213503 Ga0070714_1002135032 280
157 3300005436 Ga0070713_100016431 Ga0070713_1000164313 280
158 3300005436 Ga0070713_100219240 Ga0070713_1002192401 280
159 3300005439 Ga0070711_100002546 Ga0070711_1000025467 280
160 3300005439 Ga0070711_100004478 Ga0070711_1000044787 280
161 3300005439 Ga0070711_100093833 Ga0070711_1000938333 280
162 3300005445 Ga0070708_100007462 Ga0070708_1000074628 280
163 3300005458 Ga0070681_10024932 Ga0070681_100249323 280
164 3300005458 Ga0070681_10051431 Ga0070681_100514315 280
165 3300005467 Ga0070706_100032684 Ga0070706_1000326843 280
166 3300005530 Ga0070679_100070161 Ga0070679_1000701612 280
167 3300005539 Ga0068853_100024047 Ga0068853_1000240474 280
168 3300005563 Ga0068855_100050505 Ga0068855_1000505055 280
169 3300005614 Ga0068856_100018179 Ga0068856_1000181795 280
170 3300005614 Ga0068856_100277212 Ga0068856_1002772121 280
171 3300006028 Ga0070717_10016809 Ga0070717_100168092 280
172 3300006163 Ga0070715_10066827 Ga0070715_100668271 280
173 3300006173 Ga0070716_100006703 Ga0070716_1000067037 280
174 3300006173 Ga0070716_100062535 Ga0070716_1000625352 280
175 3300006175 Ga0070712_100001045 Ga0070712_1000010453 280
176 3300006175 Ga0070712_100003020 Ga0070712_1000030206 280
177 3300006175 Ga0070712_100003173 Ga0070712_1000031735 280
178 3300009093 Ga0105240_10022103 Ga0105240_100221036 280
179 3300009094 Ga0111539_10676782 Ga0111539_106767822 280
180 3300009176 Ga0105242_10213773 Ga0105242_102137732 280
181 3300013307 Ga0157372_10031121 Ga0157372_100311216 280
182 3300025905 Ga0207685_10051162 Ga0207685_100511622 280
183 3300025906 Ga0207699_10037285 Ga0207699_100372854 280
184 3300025906 Ga0207699_10044556 Ga0207699_100445563 280
185 3300025906 Ga0207699_10068357 Ga0207699_100683572 280
186 3300025910 Ga0207684_10024057 Ga0207684_100240572 280
187 3300025912 Ga0207707_10030298 Ga0207707_100302986 280
188 3300025913 Ga0207695_10119919 Ga0207695_101199191 280
189 3300025914 Ga0207671_10259258 Ga0207671_102592582 280
190 3300025915 Ga0207693_10000038 Ga0207693_100000387 280
191 3300025915 Ga0207693_10008388 Ga0207693_100083887 280
192 3300025915 Ga0207693_10009178 Ga0207693_100091785 280
193 3300025916 Ga0207663_10003648 Ga0207663_100036486 280
194 3300025916 Ga0207663_10024132 Ga0207663_100241322 280
195 3300025916 Ga0207663_10128455 Ga0207663_101284552 280
196 3300025921 Ga0207652_10250274 Ga0207652_102502742 280
197 3300025928 Ga0207700_10001212 Ga0207700_1000121213 280
198 3300025928 Ga0207700_10002922 Ga0207700_100029226 280
199 3300025929 Ga0207664_10000414 Ga0207664_1000041418 280
200 3300025929 Ga0207664_10010642 Ga0207664_100106424 280
201 3300025929 Ga0207664_10163691 Ga0207664_101636912 280
202 3300025929 Ga0207664_10232064 Ga0207664_102320642 280
203 3300025939 Ga0207665_10017505 Ga0207665_100175056 280
204 3300025939 Ga0207665_10022780 Ga0207665_100227802 280
205 3300025942 Ga0207689_10029835 Ga0207689_100298352 280
206 3300025949 Ga0207667_10009748 Ga0207667_100097484 280
207 3300026078 Ga0207702_10057668 Ga0207702_100576684 280
208 3300026116 Ga0207674_10430183 Ga0207674_104301831 280
209 3300028800 Ga0265338_10015603 Ga0265338_100156036 280
210 3300028800 Ga0265338_10106664 Ga0265338_101066643 280
211 3300028800 Ga0265338_10121027 Ga0265338_101210271 280
212 3300028800 Ga0265338_10186053 Ga0265338_101860531 280
213 3300031241 Ga0265325_10003919 Ga0265325_100039193 280
214 3300031241 Ga0265325_10117091 Ga0265325_101170911 280
215 3300031249 Ga0265339_10015289 Ga0265339_100152894 280
216 3300031249 Ga0265339_10053455 Ga0265339_100534553 280
217 3300031344 Ga0265316_10041516 Ga0265316_100415164 280
218 3300031711 Ga0265314_10017964 Ga0265314_100179645 280
219 3300031712 Ga0265342_10011481 Ga0265342_100114812 280
220 3300035083 Ga0373926_0016904 Ga0373926_0016904_1370_2215 280
221 3300035086 Ga0373934_0151142 Ga0373934_0151142_57_905 280
222 3300035089 Ga0373944_0013304 Ga0373944_0013304_1289_2137 280
223 3300035113 Ga0373936_0006256 Ga0373936_0006256_1493_2341 280
224 3300035113 Ga0373936_0008642 Ga0373936_0008642_2386_3243 280
225 3300035113 Ga0373936_0101667 Ga0373936_0101667_251_1096 280
226 3300035116 Ga0373945_0000872 Ga0373945_0000872_665_1522 280
227 3300035116 Ga0373945_0020585 Ga0373945_0020585_703_1548 280
228 3300035116 Ga0373945_0033686 Ga0373945_0033686_494_1342 280
229 3300035117 Ga0373953_0157143 Ga0373953_0157143_12_857 280
230 3300035119 Ga0373956_0057132 Ga0373956_0057132_117_962 280
231 3300035120 Ga0373957_0002345 Ga0373957_0002345_1976_2821 280
232 3300035170 Ga0373943_0002667 Ga0373943_0002667_6322_7179 280
233 3300035170 Ga0373943_0005384 Ga0373943_0005384_3944_4789 280
234 3300035170 Ga0373943_0221142 Ga0373943_0221142_172_1020 280
235 3300035171 Ga0373946_0005783 Ga0373946_0005783_1770_2627 280
236 3300035171 Ga0373946_0026981 Ga0373946_0026981_1384_2229 280
237 3300035171 Ga0373946_0200923 Ga0373946_0200923_94_939 280
238 3300035172 Ga0373955_0006956 Ga0373955_0006956_1099_1944 280
239 3300035410 Ga0373924_0000033 Ga0373924_0000033_11870_12715 280
240 3300035410 Ga0373924_0014465 Ga0373924_0014465_2094_2939 280
241 3300035692 Ga0373935_0000723 Ga0373935_0000723_5102_5959 280
242 3300035692 Ga0373935_0009713 Ga0373935_0009713_932_1780 280
243 3300035692 Ga0373935_0022591 Ga0373935_0022591_2762_3652 280
244 3300035692 Ga0373935_0191381 Ga0373935_0191381_251_1096 280
245 3300035695 Ga0373927_0000297 Ga0373927_0000297_34077_34934 280
246 3300035695 Ga0373927_0068529 Ga0373927_0068529_1428_2273 280
247 3300035695 Ga0373927_0216757 Ga0373927_0216757_106_951 280
248 3300035724 Ga0373933_0018335 Ga0373933_0018335_113_958 280
249 3300035724 Ga0373933_0020408 Ga0373933_0020408_1588_2433 280
250 3300035725 Ga0373947_0023967 Ga0373947_0023967_2480_3370 280
251 3300035725 Ga0373947_0027393 Ga0373947_0027393_1237_2085 280
252 3300035725 Ga0373947_0141249 Ga0373947_0141249_113_958 280
253 3300036401 Ga0373937_0002928 Ga0373937_0002928_6911_7756 280
254 3300036401 Ga0373937_0010493 Ga0373937_0010493_5032_5883 280
255 3300036401 Ga0373937_0018616 Ga0373937_0018616_4580_5425 280
256 3300036401 Ga0373937_0033071 Ga0373937_0033071_1108_1953 280
257 3300036401 Ga0373937_0065238 Ga0373937_0065238_114_1004 280
258 3300036401 Ga0373937_0165664 Ga0373937_0165664_1050_1895 280
259 3300037068 Ga0373925_0000684 Ga0373925_0000684_30291_31148 280
260 3300037068 Ga0373925_0012023 Ga0373925_0012023_1170_2018 280
261 3300037068 Ga0373925_0013265 Ga0373925_0013265_398_1243 280
262 3300037068 Ga0373925_0017480 Ga0373925_0017480_2747_3592 280
263 3300037068 Ga0373925_0137028 Ga0373925_0137028_696_1541 280
264 3300037068 Ga0373925_0259602 Ga0373925_0259602_56_904 280
265 3300044842 Ga0466957_0007239 Ga0466957_0007239_4062_4907 280
266 3300044842 Ga0466957_0379528 Ga0466957_0379528_26_871 280
267 3300046454 Ga0495592_0185654 Ga0495592_0185654_489_1337 280
268 3300046462 Ga0495651_0087723 Ga0495651_0087723_645_1490 280
269 3300046472 Ga0495580_0004509 Ga0495580_0004509_10613_11461 280
270 3300046472 Ga0495580_0032970 Ga0495580_0032970_1674_2519 280
271 3300046473 Ga0495582_0147818 Ga0495582_0147818_97_945 280
272 3300046477 Ga0495664_0006322 Ga0495664_0006322_3256_4113 280
273 3300046477 Ga0495664_0071311 Ga0495664_0071311_346_1194 280
274 3300046499 Ga0495594_0010861 Ga0495594_0010861_33_878 280
275 3300046511 Ga0495608_0105424 Ga0495608_0105424_51_1055 280
276 3300046517 Ga0495630_0129587 Ga0495630_0129587_679_1524 280
277 3300046529 Ga0495652_0275639 Ga0495652_0275639_236_1081 280
278 3300046678 Ga0495599_0209399 Ga0495599_0209399_246_1094 280
279 3300046679 Ga0495623_0002920 Ga0495623_0002920_3640_4485 280
280 3300046679 Ga0495623_0164924 Ga0495623_0164924_165_1022 280
281 3300046683 Ga0495658_0027496 Ga0495658_0027496_679_1527 280
282 3300047317 Ga0495604_0070773 Ga0495604_0070773_1000_1845 280
283 3300047319 Ga0495674_0079170 Ga0495674_0079170_679_1536 280
284 3300047471 Ga0495684_0112423 Ga0495684_0112423_592_1440 280
285 3300047673 Ga0495593_0221467 Ga0495593_0221467_36_881 280
286 3300048089 Ga0495614_0027109 Ga0495614_0027109_1494_2339 280
287 3300048905 Ga0496102_0023530 Ga0496102_0023530_3381_4226 280
288 3300048905 Ga0496102_0415785 Ga0496102_0415785_56_901 280
289 3300048906 Ga0496103_0076671 Ga0496103_0076671_615_1460 280
290 3300048908 Ga0496105_0002203 Ga0496105_0002203_6378_7223 280
291 3300048915 Ga0496112_0032608 Ga0496112_0032608_1667_2671 280
292 3300048916 Ga0496113_0000145 Ga0496113_0000145_1674_2678 280
293 3300048917 Ga0496114_0180447 Ga0496114_0180447_647_1498 280
294 3300049593 Ga0501077_0347194 Ga0501077_0347194_56_901 280
295 3300050511 nmdc:mga08y16_744418_c1 nmdc:mga08y16_744418_c1_20_883 280
296 3300050512 nmdc:mga0n895_215189_c1 nmdc:mga0n895_215189_c1_991_1836 280
297 3300005329 Ga0070683_100049686 Ga0070683_1000496864 281
298 3300005331 Ga0070670_100032237 Ga0070670_1000322372 281
299 3300005331 Ga0070670_100100921 Ga0070670_1001009211 281
300 3300005337 Ga0070682_100029737 Ga0070682_1000297372 281
301 3300005338 Ga0068868_100002724 Ga0068868_1000027243 281
302 3300005339 Ga0070660_100017786 Ga0070660_1000177867 281
303 3300005344 Ga0070661_100012142 Ga0070661_1000121423 281
304 3300005366 Ga0070659_100061366 Ga0070659_1000613664 281
305 3300005367 Ga0070667_100237547 Ga0070667_1002375471 281
306 3300005455 Ga0070663_100052878 Ga0070663_1000528781 281
307 3300005456 Ga0070678_100272458 Ga0070678_1002724581 281
308 3300005458 Ga0070681_10110912 Ga0070681_101109123 281
309 3300005530 Ga0070679_100333753 Ga0070679_1003337531 281
310 3300005547 Ga0070693_100104995 Ga0070693_1001049952 281
311 3300005547 Ga0070693_100231424 Ga0070693_1002314242 281
312 3300005563 Ga0068855_100083045 Ga0068855_1000830454 281
313 3300005577 Ga0068857_100206883 Ga0068857_1002068832 281
314 3300005616 Ga0068852_100067024 Ga0068852_1000670243 281
315 3300005618 Ga0068864_100110438 Ga0068864_1001104383 281
316 3300005843 Ga0068860_100079354 Ga0068860_1000793542 281
317 3300005844 Ga0068862_100025221 Ga0068862_1000252211 281
318 3300009093 Ga0105240_10096230 Ga0105240_100962304 281
319 3300009098 Ga0105245_10219522 Ga0105245_102195222 281
320 3300009174 Ga0105241_10050454 Ga0105241_100504542 281
321 3300009177 Ga0105248_10073600 Ga0105248_100736005 281
322 3300009551 Ga0105238_10173094 Ga0105238_101730943 281
323 3300010375 Ga0105239_10060543 Ga0105239_100605436 281
324 3300013100 Ga0157373_10062406 Ga0157373_100624063 281
325 3300013102 Ga0157371_10238502 Ga0157371_102385022 281
326 3300013297 Ga0157378_10095794 Ga0157378_100957943 281
327 3300013307 Ga0157372_10317463 Ga0157372_103174632 281
328 3300014325 Ga0163163_10045846 Ga0163163_100458464 281
329 3300014325 Ga0163163_10231872 Ga0163163_102318722 281
330 3300014969 Ga0157376_10005692 Ga0157376_100056922 281
331 3300015261 Ga0182006_1008740 Ga0182006_10087401 281
332 3300015265 Ga0182005_1006704 Ga0182005_10067045 281
333 3300022730 Ga0224570_101524 Ga0224570_1015241 281
334 3300024227 Ga0228598_1007740 Ga0228598_10077401 281
335 3300025321 Ga0207656_10138597 Ga0207656_101385972 281
336 3300025911 Ga0207654_10037191 Ga0207654_100371913 281
337 3300025917 Ga0207660_10440099 Ga0207660_104400991 281
338 3300025919 Ga0207657_10011100 Ga0207657_1001110010 281
339 3300025927 Ga0207687_10150264 Ga0207687_101502642 281
340 3300025939 Ga0207665_10112561 Ga0207665_101125612 281
341 3300025939 Ga0207665_10123572 Ga0207665_101235722 281
342 3300025941 Ga0207711_10049412 Ga0207711_100494122 281
343 3300025942 Ga0207689_10229576 Ga0207689_102295762 281
344 3300025949 Ga0207667_10118490 Ga0207667_101184902 281
345 3300025981 Ga0207640_10272291 Ga0207640_102722911 281
346 3300026041 Ga0207639_10004056 Ga0207639_100040569 281
347 3300026078 Ga0207702_10085385 Ga0207702_100853854 281
348 3300026095 Ga0207676_10195183 Ga0207676_101951832 281
349 3300028017 Ga0265356_1000309 Ga0265356_10003094 281
350 3300030760 Ga0265762_1001637 Ga0265762_10016375 281
351 3300030760 Ga0265762_1033635 Ga0265762_10336351 281
352 3300031090 Ga0265760_10000193 Ga0265760_1000019310 281
353 3300033545 Ga0316214_1003119 Ga0316214_10031192 281
354 3300039453 Ga0436362_0226101 Ga0436362_0226101_618_1466 281
355 3300045049 Ga0466959_0041003 Ga0466959_0041003_794_1642 281
356 3300048903 Ga0496100_0044609 Ga0496100_0044609_367_1215 281
357 3300048904 Ga0496101_0225654 Ga0496101_0225654_525_1373 281
358 3300048905 Ga0496102_0046059 Ga0496102_0046059_1826_2674 281
359 3300048907 Ga0496104_0035311 Ga0496104_0035311_342_1190 281
360 3300048910 Ga0496107_0064753 Ga0496107_0064753_895_1743 281
361 3300048911 Ga0496108_0057686 Ga0496108_0057686_792_1640 281
362 3300048912 Ga0496109_0061060 Ga0496109_0061060_824_1672 281
363 3300048913 Ga0496110_0028225 Ga0496110_0028225_3129_3977 281
364 3300048915 Ga0496112_0027316 Ga0496112_0027316_2159_3004 281
365 2162886012 MBSR1b_contig_12170407 MBSR1b_0358.00003430 282
366 2162886012 MBSR1b_contig_831446 MBSR1b_0497.00002290 282
367 3300001976 JGI24752J21851_1000691 JGI24752J21851_10006914 282
368 3300002074 JGI24748J21848_1007843 JGI24748J21848_10078432 282
369 3300002075 JGI24738J21930_10024257 JGI24738J21930_100242571 282
370 3300002239 JGI24034J26672_10003883 JGI24034J26672_100038832 282
371 3300002239 JGI24034J26672_10004102 JGI24034J26672_100041022 282
372 3300002459 JGI24751J29686_10001089 JGI24751J29686_100010896 282
373 3300005293 Ga0065715_10091077 Ga0065715_100910773 282
374 3300005327 Ga0070658_10105845 Ga0070658_101058453 282
375 3300005328 Ga0070676_10000861 Ga0070676_1000086111 282
376 3300005329 Ga0070683_100000141 Ga0070683_1000001415 282
377 3300005330 Ga0070690_100008269 Ga0070690_1000082693 282
378 3300005331 Ga0070670_100009672 Ga0070670_1000096726 282
379 3300005334 Ga0068869_100007756 Ga0068869_1000077566 282
380 3300005335 Ga0070666_10019520 Ga0070666_100195204 282
381 3300005337 Ga0070682_100020375 Ga0070682_1000203752 282
382 3300005338 Ga0068868_100013441 Ga0068868_1000134416 282
383 3300005339 Ga0070660_100008269 Ga0070660_1000082696 282
384 3300005340 Ga0070689_100001981 Ga0070689_10000198111 282
385 3300005343 Ga0070687_100000859 Ga0070687_1000008596 282
386 3300005344 Ga0070661_100001978 Ga0070661_10000197811 282
387 3300005347 Ga0070668_100044255 Ga0070668_1000442552 282
388 3300005353 Ga0070669_100000984 Ga0070669_1000009843 282
389 3300005354 Ga0070675_100013076 Ga0070675_1000130763 282
390 3300005355 Ga0070671_100019576 Ga0070671_1000195764 282
391 3300005356 Ga0070674_100111497 Ga0070674_1001114972 282
392 3300005364 Ga0070673_100001798 Ga0070673_10000179811 282
393 3300005365 Ga0070688_100000404 Ga0070688_1000004044 282
394 3300005366 Ga0070659_100006119 Ga0070659_1000061195 282
395 3300005367 Ga0070667_100037279 Ga0070667_1000372796 282
396 3300005434 Ga0070709_10002189 Ga0070709_100021893 282
397 3300005434 Ga0070709_10286731 Ga0070709_102867311 282
398 3300005435 Ga0070714_100428218 Ga0070714_1004282181 282
399 3300005436 Ga0070713_100041917 Ga0070713_1000419174 282
400 3300005436 Ga0070713_100154838 Ga0070713_1001548383 282
401 3300005437 Ga0070710_10251915 Ga0070710_102519151 282
402 3300005438 Ga0070701_10017230 Ga0070701_100172303 282
403 3300005439 Ga0070711_100030337 Ga0070711_1000303373 282
404 3300005441 Ga0070700_100049186 Ga0070700_1000491862 282
405 3300005445 Ga0070708_100000435 Ga0070708_10000043513 282
406 3300005445 Ga0070708_100193845 Ga0070708_1001938451 282
407 3300005445 Ga0070708_100297116 Ga0070708_1002971162 282
408 3300005456 Ga0070678_100006009 Ga0070678_1000060093 282
409 3300005457 Ga0070662_100001110 Ga0070662_10000111011 282
410 3300005458 Ga0070681_10000179 Ga0070681_1000017923 282
411 3300005459 Ga0068867_100002720 Ga0068867_1000027203 282
412 3300005466 Ga0070685_10000636 Ga0070685_1000063617 282
413 3300005467 Ga0070706_100008394 Ga0070706_1000083947 282
414 3300005468 Ga0070707_100000605 Ga0070707_10000060529 282
415 3300005468 Ga0070707_100024260 Ga0070707_1000242603 282
416 3300005468 Ga0070707_100540316 Ga0070707_1005403161 282
417 3300005471 Ga0070698_100003037 Ga0070698_10000303711 282
418 3300005518 Ga0070699_100001736 Ga0070699_10000173610 282
419 3300005518 Ga0070699_100045766 Ga0070699_1000457661 282
420 3300005530 Ga0070679_100007952 Ga0070679_1000079529 282
421 3300005535 Ga0070684_100000935 Ga0070684_10000093517 282
422 3300005536 Ga0070697_100000199 Ga0070697_10000019931 282
423 3300005539 Ga0068853_100003141 Ga0068853_1000031413 282
424 3300005543 Ga0070672_100024156 Ga0070672_1000241561 282
425 3300005544 Ga0070686_100000598 Ga0070686_1000005985 282
426 3300005547 Ga0070693_100019825 Ga0070693_1000198254 282
427 3300005563 Ga0068855_100020807 Ga0068855_1000208074 282
428 3300005564 Ga0070664_100009623 Ga0070664_1000096233 282
429 3300005577 Ga0068857_100002528 Ga0068857_1000025285 282
430 3300005578 Ga0068854_100150108 Ga0068854_1001501083 282
431 3300005614 Ga0068856_100041109 Ga0068856_1000411093 282
432 3300005614 Ga0068856_100042660 Ga0068856_1000426603 282
433 3300005615 Ga0070702_100005603 Ga0070702_1000056033 282
434 3300005616 Ga0068852_100012174 Ga0068852_1000121746 282
435 3300005617 Ga0068859_100004950 Ga0068859_10000495012 282
436 3300005718 Ga0068866_10001000 Ga0068866_100010007 282
437 3300005719 Ga0068861_100036800 Ga0068861_1000368004 282
438 3300005834 Ga0068851_10011241 Ga0068851_100112412 282
439 3300005840 Ga0068870_10006694 Ga0068870_100066942 282
440 3300005841 Ga0068863_100055548 Ga0068863_1000555484 282
441 3300005842 Ga0068858_100007225 Ga0068858_10000722512 282
442 3300005843 Ga0068860_100017192 Ga0068860_1000171923 282
443 3300005844 Ga0068862_100003656 Ga0068862_1000036563 282
444 3300006028 Ga0070717_10113225 Ga0070717_101132252 282
445 3300006028 Ga0070717_10385091 Ga0070717_103850912 282
446 3300006028 Ga0070717_10423416 Ga0070717_104234161 282
447 3300006163 Ga0070715_10022890 Ga0070715_100228903 282
448 3300006173 Ga0070716_100003260 Ga0070716_1000032606 282
449 3300006175 Ga0070712_100002589 Ga0070712_1000025896 282
450 3300006175 Ga0070712_100005954 Ga0070712_1000059546 282
451 3300006175 Ga0070712_100089675 Ga0070712_1000896753 282
452 3300006237 Ga0097621_100028124 Ga0097621_1000281244 282
453 3300006358 Ga0068871_100068619 Ga0068871_1000686192 282
454 3300006871 Ga0075434_100001284 Ga0075434_10000128418 282
455 3300006881 Ga0068865_100007877 Ga0068865_1000078774 282
456 3300006931 Ga0097620_100004950 Ga0097620_10000495012 282
457 3300009093 Ga0105240_10289601 Ga0105240_102896013 282
458 3300009098 Ga0105245_10002320 Ga0105245_100023206 282
459 3300009101 Ga0105247_10009920 Ga0105247_100099204 282
460 3300009174 Ga0105241_10051379 Ga0105241_100513793 282
461 3300009176 Ga0105242_10016155 Ga0105242_100161552 282
462 3300009553 Ga0105249_10013083 Ga0105249_100130833 282
463 3300010375 Ga0105239_10007719 Ga0105239_1000771911 282
464 3300011119 Ga0105246_10001796 Ga0105246_100017962 282
465 3300013100 Ga0157373_10008624 Ga0157373_100086243 282
466 3300013102 Ga0157371_10010946 Ga0157371_100109464 282
467 3300013104 Ga0157370_10046235 Ga0157370_100462351 282
468 3300013104 Ga0157370_10054008 Ga0157370_100540082 282
469 3300013105 Ga0157369_10010680 Ga0157369_100106806 282
470 3300013105 Ga0157369_10089967 Ga0157369_100899672 282
471 3300013105 Ga0157369_10117275 Ga0157369_101172753 282
472 3300013296 Ga0157374_10018502 Ga0157374_100185023 282
473 3300013307 Ga0157372_10001689 Ga0157372_100016897 282
474 3300013308 Ga0157375_10028067 Ga0157375_100280674 282
475 3300014325 Ga0163163_10000850 Ga0163163_1000085012 282
476 3300014745 Ga0157377_10000535 Ga0157377_100005354 282
477 3300014968 Ga0157379_10028884 Ga0157379_100288845 282
478 3300014969 Ga0157376_10036676 Ga0157376_100366762 282
479 3300017792 Ga0163161_10001298 Ga0163161_100012987 282
480 3300021377 Ga0213874_10005998 Ga0213874_100059981 282
481 3300022732 Ga0224569_101211 Ga0224569_1012112 282
482 3300024227 Ga0228598_1000061 Ga0228598_10000614 282
483 3300024227 Ga0228598_1000687 Ga0228598_10006874 282
484 3300025315 Ga0207697_10007464 Ga0207697_100074644 282
485 3300025321 Ga0207656_10084667 Ga0207656_100846672 282
486 3300025899 Ga0207642_10029081 Ga0207642_100290812 282
487 3300025900 Ga0207710_10026910 Ga0207710_100269102 282
488 3300025901 Ga0207688_10001352 Ga0207688_1000135210 282
489 3300025903 Ga0207680_10006311 Ga0207680_100063114 282
490 3300025904 Ga0207647_10005760 Ga0207647_100057604 282
491 3300025905 Ga0207685_10009497 Ga0207685_100094973 282
492 3300025906 Ga0207699_10004886 Ga0207699_100048867 282
493 3300025907 Ga0207645_10000069 Ga0207645_1000006950 282
494 3300025908 Ga0207643_10005786 Ga0207643_100057862 282
495 3300025909 Ga0207705_10458096 Ga0207705_104580961 282
496 3300025910 Ga0207684_10001311 Ga0207684_1000131115 282
497 3300025911 Ga0207654_10031178 Ga0207654_100311783 282
498 3300025912 Ga0207707_10002140 Ga0207707_1000214014 282
499 3300025915 Ga0207693_10003133 Ga0207693_100031338 282
500 3300025915 Ga0207693_10005353 Ga0207693_100053537 282
501 3300025916 Ga0207663_10058857 Ga0207663_100588572 282
502 3300025917 Ga0207660_10000064 Ga0207660_1000006455 282
503 3300025918 Ga0207662_10008546 Ga0207662_100085464 282
504 3300025919 Ga0207657_10000217 Ga0207657_1000021746 282
505 3300025920 Ga0207649_10008473 Ga0207649_100084731 282
506 3300025921 Ga0207652_10002404 Ga0207652_1000240412 282
507 3300025922 Ga0207646_10001857 Ga0207646_1000185716 282
508 3300025922 Ga0207646_10060331 Ga0207646_100603314 282
509 3300025922 Ga0207646_10115803 Ga0207646_101158033 282
510 3300025922 Ga0207646_10231266 Ga0207646_102312662 282
511 3300025923 Ga0207681_10011657 Ga0207681_100116572 282
512 3300025925 Ga0207650_10000416 Ga0207650_1000041627 282
513 3300025927 Ga0207687_10006118 Ga0207687_100061184 282
514 3300025928 Ga0207700_10176573 Ga0207700_101765732 282
515 3300025929 Ga0207664_10186744 Ga0207664_101867442 282
516 3300025931 Ga0207644_10000489 Ga0207644_1000048917 282
517 3300025932 Ga0207690_10080881 Ga0207690_100808812 282
518 3300025933 Ga0207706_10007326 Ga0207706_100073265 282
519 3300025934 Ga0207686_10009222 Ga0207686_100092223 282
520 3300025938 Ga0207704_10050829 Ga0207704_100508293 282
521 3300025939 Ga0207665_10001393 Ga0207665_100013939 282
522 3300025939 Ga0207665_10283900 Ga0207665_102839001 282
523 3300025940 Ga0207691_10001375 Ga0207691_100013757 282
524 3300025941 Ga0207711_10012249 Ga0207711_100122493 282
525 3300025942 Ga0207689_10006810 Ga0207689_100068106 282
526 3300025944 Ga0207661_10010921 Ga0207661_100109216 282
527 3300025945 Ga0207679_10000120 Ga0207679_100001209 282
528 3300025949 Ga0207667_10033752 Ga0207667_100337524 282
529 3300025960 Ga0207651_10009101 Ga0207651_100091015 282
530 3300025972 Ga0207668_10034231 Ga0207668_100342314 282
531 3300025986 Ga0207658_10010665 Ga0207658_100106653 282
532 3300026023 Ga0207677_10008083 Ga0207677_100080836 282
533 3300026035 Ga0207703_10307768 Ga0207703_103077682 282
534 3300026041 Ga0207639_10010241 Ga0207639_100102413 282
535 3300026067 Ga0207678_10001451 Ga0207678_100014513 282
536 3300026078 Ga0207702_10027171 Ga0207702_100271712 282
537 3300026078 Ga0207702_10107505 Ga0207702_101075052 282
538 3300026088 Ga0207641_10000006 Ga0207641_10000006278 282
539 3300026089 Ga0207648_10000546 Ga0207648_1000054612 282
540 3300026095 Ga0207676_10000417 Ga0207676_1000041726 282
541 3300026116 Ga0207674_10000566 Ga0207674_1000056617 282
542 3300026118 Ga0207675_100047375 Ga0207675_1000473754 282
543 3300026121 Ga0207683_10001155 Ga0207683_1000115516 282
544 3300026142 Ga0207698_10018922 Ga0207698_100189222 282
545 3300028016 Ga0265354_1001498 Ga0265354_10014983 282
546 3300028379 Ga0268266_10002040 Ga0268266_1000204016 282
547 3300028380 Ga0268265_10002458 Ga0268265_100024583 282
548 3300028381 Ga0268264_10002179 Ga0268264_100021797 282
549 3300031090 Ga0265760_10001146 Ga0265760_100011463 282
550 3300031247 Ga0265340_10036097 Ga0265340_100360971 282
551 3300031249 Ga0265339_10107573 Ga0265339_101075731 282
552 3300031711 Ga0265314_10003366 Ga0265314_100033669 282
553 3300037418 Ga0395900_0191558 Ga0395900_0191558_540_1394 282
554 3300038443 Ga0395901_0289934 Ga0395901_0289934_82_936 282
555 3300039450 Ga0436363_0379760 Ga0436363_0379760_2380_3294 282
556 3300045976 Ga0466967_0009616 Ga0466967_0009616_5266_6123 282
557 3300046455 Ga0495603_0112811 Ga0495603_0112811_366_1220 282
558 3300046472 Ga0495580_0004931 Ga0495580_0004931_7157_8011 282
559 3300046472 Ga0495580_0018653 Ga0495580_0018653_3945_4796 282
560 3300046472 Ga0495580_0066761 Ga0495580_0066761_1125_1979 282
561 3300046472 Ga0495580_0264236 Ga0495580_0264236_154_1023 282
562 3300046684 Ga0495669_0032391 Ga0495669_0032391_1339_2190 282
563 3300048905 Ga0496102_0077167 Ga0496102_0077167_352_1203 282
564 3300048907 Ga0496104_0104660 Ga0496104_0104660_619_1467 282
565 3300048909 Ga0496106_0094029 Ga0496106_0094029_1062_1910 282
566 3300048911 Ga0496108_0000095 Ga0496108_0000095_65609_66457 282
567 3300048912 Ga0496109_0000243 Ga0496109_0000243_14283_15131 282
568 3300048913 Ga0496110_0010266 Ga0496110_0010266_4262_5110 282
569 3300048914 Ga0496111_0074205 Ga0496111_0074205_1588_2436 282
570 3300048915 Ga0496112_0000038 Ga0496112_0000038_84537_85385 282
571 3300048916 Ga0496113_0000169 Ga0496113_0000169_23985_24833 282
572 3300048918 Ga0496115_0011881 Ga0496115_0011881_2224_3072 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

63

253

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

69

306

0.95

PF08659

KR

KR domain

64

166

0.87

PF23441

56

308

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fc7-assembly1.cif.gz_D studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr 0.9595 1 254
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9595 5 251
3imf-assembly1.cif.gz_C 1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' 0.9581 10 252
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9581 7 250
3imf-assembly1.cif.gz_D 1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' 0.9565 10 252
ID Description Score Start End Superfamily
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 5 251 3.40.50.720
af_A0A1D8PPB1_4_280_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 7 252 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9485 3 83 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9473 6 253 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 8 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A518BHZ8-F1-model_v4 Peroxisomal trans-2-enoyl-CoA reductase (EC 1.3.1.38) 0.9674 1 253 GO:0005777
GO:0006633
GO:0008670
GO:0019166
AF-A0A7I8W7N6-F1-model_v4 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] (EC 1.3.1.124) (2,4-dienoyl-CoA reductase 2) 0.9646 1 254 GO:0005777
GO:0008670
GO:0009062
AF-S3JGM5-F1-model_v4 Glucose 1-dehydrogenase 2 (EC 1.1.1.47) 0.9645 7 168 GO:0047936
AF-A0A7K1K8T4-F1-model_v4 SDR family oxidoreductase 0.9618 7 253 GO:0005777
GO:0008670
GO:0009062
AF-A0A4R7MEK3-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9599 5 251 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.08 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map