F465129

General Info

Members Datasets Scaffolds Average Seq Length
572 315 1144 318

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_27643_c1|nmdc:mga0qj67_27643_c1_859_1938
Length 359
Sequence MNSPLPLPRVAGAESVRYYSIEDYNVLVRHRQLHTGGKMFVRILACAALALCVATPSWSQTYPTKPIRLIVGYAAGGSVDTTARIFAPKLSADLGQQVIVENRAGAASNIAADYVAKAPPDGYTLFWSSGTGLGTNLAFYQKMTYNPLKDFAPIALLMYQSNGLVVNPTVPATTTKELIALAKARPGQLNYGTAGTGTSQHMTAELFSKMTGIRXXXXAYKGGAPALVDLVGGHVDLVFSPLPEVIPYVRANRLRAIAVSGAKRTPAMSNVPTVGETVPGFAFEGFLGVVSPAGVSPDVVARINAVANKALQDPDVKNRLVDLGLGIAGSTPEQLGAHMREQSALMIRIAKDAGIKPLD

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
206 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
210 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
216 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
217 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
310 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
311 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
312 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
313 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
314 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
315 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 0.52
Rhizoplane 2.45
Rhizosphere 88.29
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_27643_c1 3300050509 Bacteria 4398
2 Ga0055534_1002254 3300003784 Bacteria 6817
3 Ga0055540_1019252 3300003792 Bacteria 1842
4 Ga0065707_10083489 3300005295 Bacteria 8984
5 Ga0065707_10103539 3300005295 Bacteria 2743
6 Ga0070676_10036355 3300005328 Bacteria 2837
7 Ga0070676_10185380 3300005328 Bacteria 1355
8 Ga0070683_100000347 3300005329 Bacteria 31865
9 Ga0070683_100004990 3300005329 Bacteria 11016
10 Ga0070683_100280767 3300005329 Bacteria 1584
11 Ga0070690_100005081 3300005330 Bacteria 7375
12 Ga0070670_100000309 3300005331 Bacteria 41915
13 Ga0070670_100029278 3300005331 Bacteria 4739
14 Ga0070670_100199003 3300005331 Bacteria 1740
15 Ga0070670_100263249 3300005331 Bacteria 1503
16 Ga0070670_100371982 3300005331 Bacteria 1258
17 Ga0070677_10004019 3300005333 Bacteria 4776
18 Ga0070677_10054342 3300005333 Bacteria 1631
19 Ga0070677_10105483 3300005333 Bacteria 1250
20 Ga0068869_100001859 3300005334 Bacteria 12697
21 Ga0068869_100045994 3300005334 Bacteria 3145
22 Ga0070666_10002081 3300005335 Bacteria 12159
23 Ga0070666_10179699 3300005335 Bacteria 1484
24 Ga0070680_100092263 3300005336 Bacteria 2508
25 Ga0070682_100034514 3300005337 Bacteria 3081
26 Ga0068868_100000930 3300005338 Bacteria 19942
27 Ga0068868_100005400 3300005338 Bacteria 8982
28 Ga0068868_100012111 3300005338 Bacteria 6298
29 Ga0068868_100323962 3300005338 Bacteria 1313
30 Ga0070689_100000939 3300005340 Bacteria 18114
31 Ga0070689_100032710 3300005340 Bacteria 3957
32 Ga0070687_100000199 3300005343 Bacteria 20848
33 Ga0070661_100001422 3300005344 Bacteria 16639
34 Ga0070661_100217906 3300005344 Bacteria 1463
35 Ga0070661_100272912 3300005344 Bacteria 1310
36 Ga0070668_100033964 3300005347 Bacteria 3887
37 Ga0070668_100063383 3300005347 Bacteria 2865
38 Ga0070668_100151436 3300005347 Bacteria 1876
39 Ga0070669_100041925 3300005353 Bacteria 3330
40 Ga0070669_100306416 3300005353 Bacteria 1279
41 Ga0070675_100000049 3300005354 Bacteria 72492
42 Ga0070675_100000926 3300005354 Bacteria 20887
43 Ga0070675_100175869 3300005354 Bacteria 1848
44 Ga0070671_100000137 3300005355 Bacteria 47124
45 Ga0070671_100119494 3300005355 Bacteria 2217
46 Ga0070674_100171049 3300005356 Bacteria 1656
47 Ga0070673_100000394 3300005364 Bacteria 23087
48 Ga0070673_100078227 3300005364 Bacteria 2675
49 Ga0070673_100127486 3300005364 Bacteria 2131
50 Ga0070673_100146302 3300005364 Bacteria 1998
51 Ga0070688_100018238 3300005365 Bacteria 4046
52 Ga0070688_100140427 3300005365 Bacteria 1640
53 Ga0070659_100062258 3300005366 Bacteria 2949
54 Ga0070659_100315456 3300005366 Bacteria 1306
55 Ga0070667_100013715 3300005367 Bacteria 6698
56 Ga0070667_100132100 3300005367 Bacteria 2180
57 Ga0070667_100175560 3300005367 Bacteria 1893
58 Ga0070667_100245849 3300005367 Bacteria 1598
59 Ga0070714_100261069 3300005435 Bacteria 1604
60 Ga0070714_100408266 3300005435 Bacteria 1285
61 Ga0070713_100114554 3300005436 Bacteria 2356
62 Ga0070701_10011085 3300005438 Bacteria 4012
63 Ga0070705_100003046 3300005440 Bacteria 8258
64 Ga0070700_100021308 3300005441 Bacteria 3766
65 Ga0070700_100302532 3300005441 Bacteria 1168
66 Ga0070694_100095420 3300005444 Bacteria 2094
67 Ga0070678_100000771 3300005456 Bacteria 16065
68 Ga0070678_100073303 3300005456 Bacteria 2569
69 Ga0070678_100141993 3300005456 Bacteria 1923
70 Ga0070662_100056003 3300005457 Bacteria 2862
71 Ga0070662_100131172 3300005457 Bacteria 1932
72 Ga0070681_10039992 3300005458 Bacteria 4701
73 Ga0070681_10167301 3300005458 Bacteria 2121
74 Ga0068867_100000824 3300005459 Bacteria 20865
75 Ga0068867_100004978 3300005459 Bacteria 9361
76 Ga0068867_100016771 3300005459 Bacteria 5204
77 Ga0070685_10026991 3300005466 Bacteria 3170
78 Ga0070679_100009445 3300005530 Bacteria 9224
79 Ga0070679_100023923 3300005530 Bacteria 5985
80 Ga0070679_100250482 3300005530 Bacteria 1728
81 Ga0070679_100285377 3300005530 Bacteria 1603
82 Ga0070684_100089855 3300005535 Bacteria 2730
83 Ga0070672_100207665 3300005543 Bacteria 1639
84 Ga0070686_100011913 3300005544 Bacteria 4944
85 Ga0070695_100000728 3300005545 Bacteria 17589
86 Ga0070696_100006658 3300005546 Bacteria 7718
87 Ga0070693_100000072 3300005547 Bacteria 41480
88 Ga0070693_100108500 3300005547 Bacteria 1703
89 Ga0070693_100171358 3300005547 Bacteria 1390
90 Ga0070665_100002809 3300005548 Bacteria 18859
91 Ga0070665_100069685 3300005548 Bacteria 3525
92 Ga0070665_100095868 3300005548 Bacteria 2972
93 Ga0070665_100308262 3300005548 Bacteria 1586
94 Ga0070704_100003550 3300005549 Bacteria 8965
95 Ga0068855_100011949 3300005563 Bacteria 10497
96 Ga0068855_100125900 3300005563 Bacteria 2929
97 Ga0070664_100000054 3300005564 Bacteria 69166
98 Ga0068857_100032236 3300005577 Bacteria 4633
99 Ga0068857_100395650 3300005577 Bacteria 1285
100 Ga0068854_100000714 3300005578 Bacteria 19666
101 Ga0068854_100032767 3300005578 Bacteria 3617
102 Ga0068856_100059045 3300005614 Bacteria 3788
103 Ga0068856_100448281 3300005614 Bacteria 1311
104 Ga0070702_100000084 3300005615 Bacteria 27525
105 Ga0070702_100202335 3300005615 Bacteria 1315
106 Ga0068852_100000065 3300005616 Bacteria 72149
107 Ga0068852_100000654 3300005616 Bacteria 22706
108 Ga0068852_100034748 3300005616 Bacteria 4198
109 Ga0068859_100005387 3300005617 Bacteria 13012
110 Ga0068859_100018280 3300005617 Bacteria 7048
111 Ga0068859_100119947 3300005617 Bacteria 2697
112 Ga0068859_100363258 3300005617 Bacteria 1543
113 Ga0068864_100001420 3300005618 Bacteria 19796
114 Ga0068864_100003720 3300005618 Bacteria 12594
115 Ga0068864_100166232 3300005618 Bacteria 2009
116 Ga0068864_100212908 3300005618 Bacteria 1780
117 Ga0068866_10002137 3300005718 Bacteria 8225
118 Ga0068866_10082629 3300005718 Bacteria 1729
119 Ga0068861_100004429 3300005719 Bacteria 9421
120 Ga0068861_100050276 3300005719 Bacteria 3160
121 Ga0068861_100356137 3300005719 Bacteria 1285
122 Ga0068851_10001105 3300005834 Bacteria 11693
123 Ga0068863_100024030 3300005841 Bacteria 5816
124 Ga0068863_100087722 3300005841 Bacteria 2948
125 Ga0068863_100193985 3300005841 Bacteria 1952
126 Ga0068863_100369378 3300005841 Bacteria 1400
127 Ga0068863_100465044 3300005841 Bacteria 1242
128 Ga0068858_100001292 3300005842 Bacteria 25859
129 Ga0068858_100004784 3300005842 Bacteria 13258
130 Ga0068858_100064072 3300005842 Bacteria 3401
131 Ga0068858_100078513 3300005842 Bacteria 3067
132 Ga0068858_100105678 3300005842 Bacteria 2627
133 Ga0068858_100345172 3300005842 Bacteria 1425
134 Ga0068858_100373794 3300005842 Bacteria 1367
135 Ga0068860_100017811 3300005843 Bacteria 6920
136 Ga0068860_100020854 3300005843 Bacteria 6349
137 Ga0068860_100049428 3300005843 Bacteria 4005
138 Ga0068860_100133462 3300005843 Bacteria 2383
139 Ga0068860_100269120 3300005843 Bacteria 1663
140 Ga0068860_100379177 3300005843 Bacteria 1396
141 Ga0068860_100417519 3300005843 Bacteria 1329
142 Ga0068862_100009057 3300005844 Bacteria 8242
143 Ga0068862_100033323 3300005844 Bacteria 4353
144 Ga0068862_100044081 3300005844 Bacteria 3805
145 Ga0068862_100123210 3300005844 Bacteria 2287
146 Ga0068862_100128818 3300005844 Bacteria 2237
147 Ga0068862_100149038 3300005844 Bacteria 2081
148 Ga0068862_100180781 3300005844 Bacteria 1893
149 Ga0081540_1024715 3300005983 Bacteria 3479
150 Ga0075363_100035363 3300006048 Bacteria 2614
151 Ga0075364_10017505 3300006051 Bacteria 4478
152 Ga0070716_100066260 3300006173 Bacteria 2106
153 Ga0070712_100114065 3300006175 Bacteria 2022
154 Ga0075362_10009787 3300006177 Bacteria 3719
155 Ga0075369_10049988 3300006186 Bacteria 1807
156 Ga0075366_10004370 3300006195 Bacteria 7581
157 Ga0097621_100000051 3300006237 Bacteria 60495
158 Ga0097621_100000794 3300006237 Bacteria 22198
159 Ga0097621_100037041 3300006237 Bacteria 3905
160 Ga0097621_100072303 3300006237 Bacteria 2852
161 Ga0097621_100156113 3300006237 Bacteria 1959
162 Ga0075370_10073897 3300006353 Bacteria 1953
163 Ga0068871_100001133 3300006358 Bacteria 17866
164 Ga0068871_100037263 3300006358 Bacteria 3877
165 Ga0068871_100040416 3300006358 Bacteria 3736
166 Ga0068871_100145647 3300006358 Bacteria 2016
167 Ga0068871_100365659 3300006358 Bacteria 1278
168 Ga0075428_100015214 3300006844 Bacteria 8536
169 Ga0075430_100031263 3300006846 Bacteria 4518
170 Ga0075431_100004522 3300006847 Bacteria 13657
171 Ga0075433_10054907 3300006852 Bacteria 3476
172 Ga0075434_100000073 3300006871 Bacteria 52987
173 Ga0068865_100008183 3300006881 Bacteria 6456
174 Ga0068865_100054894 3300006881 Bacteria 2771
175 Ga0068865_100180687 3300006881 Bacteria 1624
176 Ga0068865_100436918 3300006881 Bacteria 1079
177 Ga0075436_100232184 3300006914 Bacteria 1311
178 Ga0097620_100005387 3300006931 Bacteria 13012
179 Ga0097620_100018280 3300006931 Bacteria 7048
180 Ga0097620_100119945 3300006931 Bacteria 2697
181 Ga0097620_100363303 3300006931 Bacteria 1543
182 Ga0075435_100028335 3300007076 Bacteria 4392
183 Ga0105250_10045733 3300009092 Bacteria 1755
184 Ga0105240_10007799 3300009093 Bacteria 15467
185 Ga0105240_10033241 3300009093 Bacteria 6667
186 Ga0105240_10116687 3300009093 Bacteria 3220
187 Ga0111539_10000288 3300009094 Bacteria 60623
188 Ga0111539_10530474 3300009094 Bacteria 1371
189 Ga0111539_10738483 3300009094 Bacteria 1146
190 Ga0105245_10001603 3300009098 Bacteria 20580
191 Ga0105245_10315345 3300009098 Bacteria 1539
192 Ga0105243_10001817 3300009148 Bacteria 18269
193 Ga0105243_10162006 3300009148 Bacteria 1930
194 Ga0105243_10345805 3300009148 Bacteria 1364
195 Ga0105242_10001017 3300009176 Bacteria 22032
196 Ga0105242_10003543 3300009176 Bacteria 12137
197 Ga0105242_10124752 3300009176 Bacteria 2215
198 Ga0105242_10215605 3300009176 Bacteria 1713
199 Ga0105248_10063971 3300009177 Bacteria 4130
200 Ga0105248_10064605 3300009177 Bacteria 4109
201 Ga0105248_10095368 3300009177 Bacteria 3350
202 Ga0105248_10142497 3300009177 Bacteria 2704
203 Ga0105248_10170421 3300009177 Bacteria 2453
204 Ga0105248_10442281 3300009177 Bacteria 1465
205 Ga0105238_10061117 3300009551 Bacteria 3771
206 Ga0105238_10070239 3300009551 Bacteria 3501
207 Ga0105249_10202557 3300009553 Bacteria 1943
208 Ga0105249_10250572 3300009553 Bacteria 1756
209 Ga0105249_10306750 3300009553 Bacteria 1594
210 Ga0105239_10028862 3300010375 Bacteria 6099
211 Ga0157371_10116250 3300013102 Bacteria 1900
212 Ga0157369_10002100 3300013105 Bacteria 24031
213 Ga0157374_10000144 3300013296 Bacteria 64667
214 Ga0157374_10064400 3300013296 Bacteria 3440
215 Ga0157374_10343763 3300013296 Bacteria 1481
216 Ga0157378_10004938 3300013297 Bacteria 11690
217 Ga0157378_10333690 3300013297 Bacteria 1476
218 Ga0163162_10043379 3300013306 Bacteria 4503
219 Ga0163162_10155654 3300013306 Bacteria 2405
220 Ga0163162_10164463 3300013306 Bacteria 2342
221 Ga0157372_10019363 3300013307 Bacteria 7334
222 Ga0157375_10000528 3300013308 Bacteria 34322
223 Ga0157375_10048662 3300013308 Bacteria 4148
224 Ga0157375_10809002 3300013308 Bacteria 1085
225 Ga0163163_10002538 3300014325 Bacteria 15454
226 Ga0163163_10041003 3300014325 Bacteria 4525
227 Ga0157380_10055946 3300014326 Bacteria 3135
228 Ga0157380_10059030 3300014326 Bacteria 3060
229 Ga0157380_10096950 3300014326 Bacteria 2446
230 Ga0157380_10488867 3300014326 Bacteria 1192
231 Ga0182008_10047877 3300014497 Bacteria 2124
232 Ga0157377_10018832 3300014745 Bacteria 3595
233 Ga0157377_10094913 3300014745 Bacteria 1767
234 Ga0157379_10014302 3300014968 Bacteria 6962
235 Ga0157379_10078851 3300014968 Bacteria 2950
236 Ga0157379_10176331 3300014968 Bacteria 1930
237 Ga0157376_10018401 3300014969 Bacteria 5356
238 Ga0157376_10021252 3300014969 Bacteria 5040
239 Ga0157376_10093792 3300014969 Bacteria 2607
240 Ga0157376_10181537 3300014969 Bacteria 1924
241 Ga0182007_10000741 3300015262 Bacteria 18460
242 Ga0182005_1025689 3300015265 Bacteria 1607
243 Ga0163161_10049347 3300017792 Bacteria 3041
244 Ga0163161_10061439 3300017792 Bacteria 2735
245 Ga0163161_10130729 3300017792 Bacteria 1894
246 Ga0163161_10264596 3300017792 Bacteria 1344
247 Ga0209675_1008603 3300025291 Bacteria 3724
248 Ga0209676_1008732 3300025292 Bacteria 4470
249 Ga0209564_1033405 3300025295 Bacteria 1530
250 Ga0209050_1018234 3300025298 Bacteria 2738
251 Ga0209051_1006725 3300025303 Bacteria 6418
252 Ga0209257_1009876 3300025304 Bacteria 4982
253 Ga0207656_10002656 3300025321 Bacteria 6055
254 Ga0207682_10069293 3300025893 Bacteria 1491
255 Ga0207682_10095739 3300025893 Bacteria 1293
256 Ga0207682_10103052 3300025893 Bacteria 1249
257 Ga0207642_10000462 3300025899 Bacteria 12434
258 Ga0207642_10042146 3300025899 Bacteria 2004
259 Ga0207688_10038310 3300025901 Bacteria 2660
260 Ga0207680_10022089 3300025903 Bacteria 3455
261 Ga0207647_10139997 3300025904 Bacteria 1418
262 Ga0207685_10038767 3300025905 Bacteria 1764
263 Ga0207707_10114125 3300025912 Bacteria 2361
264 Ga0207707_10157789 3300025912 Bacteria 1984
265 Ga0207695_10116254 3300025913 Bacteria 2649
266 Ga0207695_10401103 3300025913 Bacteria 1256
267 Ga0207693_10002296 3300025915 Bacteria 16616
268 Ga0207660_10002278 3300025917 Bacteria 12642
269 Ga0207662_10015491 3300025918 Bacteria 4289
270 Ga0207649_10002872 3300025920 Bacteria 9482
271 Ga0207649_10190348 3300025920 Bacteria 1443
272 Ga0207652_10031211 3300025921 Bacteria 4473
273 Ga0207652_10453835 3300025921 Bacteria 1155
274 Ga0207681_10027388 3300025923 Bacteria 3684
275 Ga0207681_10075524 3300025923 Bacteria 2364
276 Ga0207681_10087612 3300025923 Bacteria 2215
277 Ga0207681_10184165 3300025923 Bacteria 1593
278 Ga0207681_10274913 3300025923 Bacteria 1324
279 Ga0207694_10114919 3300025924 Bacteria 2144
280 Ga0207694_10137323 3300025924 Bacteria 1964
281 Ga0207650_10000339 3300025925 Bacteria 45234
282 Ga0207659_10001257 3300025926 Bacteria 15167
283 Ga0207659_10042224 3300025926 Bacteria 3196
284 Ga0207659_10423723 3300025926 Bacteria 1117
285 Ga0207687_10022407 3300025927 Bacteria 4204
286 Ga0207687_10401561 3300025927 Bacteria 1127
287 Ga0207664_10091168 3300025929 Bacteria 2499
288 Ga0207664_10131007 3300025929 Bacteria 2111
289 Ga0207644_10001499 3300025931 Bacteria 15042
290 Ga0207644_10058637 3300025931 Bacteria 2783
291 Ga0207706_10160664 3300025933 Bacteria 1975
292 Ga0207706_10268642 3300025933 Bacteria 1488
293 Ga0207686_10002549 3300025934 Bacteria 9896
294 Ga0207686_10005522 3300025934 Bacteria 6781
295 Ga0207686_10061029 3300025934 Bacteria 2389
296 Ga0207686_10081165 3300025934 Bacteria 2116
297 Ga0207670_10011269 3300025936 Bacteria 5182
298 Ga0207670_10012105 3300025936 Bacteria 5034
299 Ga0207670_10291573 3300025936 Bacteria 1275
300 Ga0207669_10013095 3300025937 Bacteria 4106
301 Ga0207704_10001219 3300025938 Bacteria 11456
302 Ga0207704_10037862 3300025938 Bacteria 2791
303 Ga0207704_10110312 3300025938 Bacteria 1858
304 Ga0207691_10000147 3300025940 Bacteria 65176
305 Ga0207691_10073763 3300025940 Bacteria 3078
306 Ga0207691_10084386 3300025940 Bacteria 2851
307 Ga0207691_10167488 3300025940 Bacteria 1925
308 Ga0207711_10050737 3300025941 Bacteria 3552
309 Ga0207711_10089291 3300025941 Bacteria 2707
310 Ga0207711_10351868 3300025941 Bacteria 1364
311 Ga0207689_10002203 3300025942 Bacteria 18272
312 Ga0207689_10041096 3300025942 Bacteria 3827
313 Ga0207689_10102265 3300025942 Bacteria 2354
314 Ga0207661_10001065 3300025944 Bacteria 18247
315 Ga0207661_10114188 3300025944 Bacteria 2290
316 Ga0207661_10234363 3300025944 Bacteria 1627
317 Ga0207679_10000307 3300025945 Bacteria 36847
318 Ga0207651_10000364 3300025960 Bacteria 19183
319 Ga0207651_10002644 3300025960 Bacteria 8565
320 Ga0207651_10152611 3300025960 Bacteria 1800
321 Ga0207651_10390920 3300025960 Bacteria 1181
322 Ga0207712_10047904 3300025961 Bacteria 2970
323 Ga0207668_10012084 3300025972 Bacteria 5273
324 Ga0207640_10000771 3300025981 Bacteria 18312
325 Ga0207658_10002924 3300025986 Bacteria 12231
326 Ga0207658_10009514 3300025986 Bacteria 6598
327 Ga0207658_10106479 3300025986 Bacteria 2208
328 Ga0207658_10112737 3300025986 Bacteria 2153
329 Ga0207677_10000130 3300026023 Bacteria 61813
330 Ga0207677_10011733 3300026023 Bacteria 5006
331 Ga0207703_10001647 3300026035 Bacteria 20096
332 Ga0207703_10004567 3300026035 Bacteria 11350
333 Ga0207703_10107768 3300026035 Bacteria 2372
334 Ga0207703_10114252 3300026035 Bacteria 2308
335 Ga0207703_10297838 3300026035 Bacteria 1470
336 Ga0207639_10029204 3300026041 Bacteria 4035
337 Ga0207678_10122250 3300026067 Bacteria 2221
338 Ga0207708_10000164 3300026075 Bacteria 52172
339 Ga0207641_10002593 3300026088 Bacteria 16611
340 Ga0207641_10029675 3300026088 Bacteria 4524
341 Ga0207641_10091210 3300026088 Bacteria 2666
342 Ga0207648_10002874 3300026089 Bacteria 18229
343 Ga0207648_10006920 3300026089 Bacteria 11238
344 Ga0207648_10098095 3300026089 Bacteria 2565
345 Ga0207648_10209768 3300026089 Bacteria 1729
346 Ga0207676_10001498 3300026095 Bacteria 17239
347 Ga0207676_10014132 3300026095 Bacteria 5735
348 Ga0207676_10023435 3300026095 Bacteria 4555
349 Ga0207676_10264522 3300026095 Bacteria 1554
350 Ga0207674_10009798 3300026116 Bacteria 10911
351 Ga0207675_100001661 3300026118 Bacteria 22258
352 Ga0207675_100100994 3300026118 Bacteria 2717
353 Ga0207675_100133276 3300026118 Bacteria 2356
354 Ga0207675_100440755 3300026118 Bacteria 1289
355 Ga0207683_10001384 3300026121 Bacteria 21858
356 Ga0207683_10025214 3300026121 Bacteria 5127
357 Ga0207683_10041084 3300026121 Bacteria 4037
358 Ga0207683_10082720 3300026121 Bacteria 2852
359 Ga0207698_10000135 3300026142 Bacteria 46357
360 Ga0207698_10018613 3300026142 Bacteria 4738
361 Ga0207698_10041202 3300026142 Bacteria 3439
362 Ga0207698_10062748 3300026142 Bacteria 2904
363 Ga0207698_10258721 3300026142 Bacteria 1598
364 Ga0209995_1001717 3300027471 Bacteria 3408
365 Ga0209983_1008336 3300027665 Bacteria 2119
366 Ga0209974_10003726 3300027876 Bacteria 5469
367 Ga0207428_10001183 3300027907 Bacteria 28096
368 Ga0268266_10053080 3300028379 Bacteria 3482
369 Ga0268266_10116379 3300028379 Bacteria 2374
370 Ga0268266_10268920 3300028379 Bacteria 1582
371 Ga0268266_10303491 3300028379 Bacteria 1490
372 Ga0268265_10002260 3300028380 Bacteria 14728
373 Ga0268265_10072023 3300028380 Bacteria 2694
374 Ga0268265_10139537 3300028380 Bacteria 2027
375 Ga0268265_10265392 3300028380 Bacteria 1529
376 Ga0268265_10338018 3300028380 Bacteria 1370
377 Ga0268264_10001897 3300028381 Bacteria 18963
378 Ga0268264_10016306 3300028381 Bacteria 6084
379 Ga0268264_10033693 3300028381 Bacteria 4211
380 Ga0307515_10001078 3300028794 Bacteria 62511
381 Ga0307515_10001329 3300028794 Bacteria 56020
382 Ga0307515_10190055 3300028794 Bacteria 1967
383 Ga0307515_10333826 3300028794 Bacteria 1173
384 Ga0265338_10117760 3300028800 Bacteria 2124
385 Ga0265325_10009273 3300031241 Bacteria 5752
386 Ga0265339_10000064 3300031249 Bacteria 92992
387 Ga0307513_10155353 3300031456 Bacteria 2189
388 Ga0265313_10000020 3300031595 Bacteria 145873
389 Ga0307514_10000810 3300031649 Bacteria 50948
390 Ga0307516_10000398 3300031730 Bacteria 56825
391 Ga0373930_0002261 3300034816 Bacteria 2968
392 Ga0373930_0010068 3300034816 Bacteria 1682
393 Ga0373950_0005017 3300034818 Bacteria 1960
394 Ga0373929_0002234 3300035085 Bacteria 3581
395 Ga0373949_0009306 3300035090 Bacteria 2152
396 Ga0373951_0007362 3300035091 Bacteria 2500
397 Ga0373923_0032981 3300035111 Bacteria 2095
398 Ga0373932_0002181 3300035112 Bacteria 5054
399 Ga0373936_0024620 3300035113 Bacteria 2351
400 Ga0373939_0003147 3300035114 Bacteria 3881
401 Ga0373945_0008852 3300035116 Bacteria 3288
402 Ga0373945_0071085 3300035116 Bacteria 1317
403 Ga0373943_0001338 3300035170 Bacteria 11099
404 Ga0373946_0001949 3300035171 Bacteria 7222
405 Ga0373955_0020180 3300035172 Bacteria 3346
406 Ga0373942_0030553 3300035207 Bacteria 1420
407 Ga0373942_0078606 3300035207 Bacteria 975
408 Ga0373931_0000219 3300035691 Bacteria 24390
409 Ga0373931_0016561 3300035691 Bacteria 3631
410 Ga0373931_0059134 3300035691 Bacteria 2061
411 Ga0373931_0090972 3300035691 Bacteria 1700
412 Ga0373931_0117627 3300035691 Bacteria 1515
413 Ga0373935_0021907 3300035692 Bacteria 3913
414 Ga0373935_0099756 3300035692 Bacteria 1912
415 Ga0373927_0000243 3300035695 Bacteria 42834
416 Ga0373927_0013298 3300035695 Bacteria 5472
417 Ga0373927_0015370 3300035695 Bacteria 5058
418 Ga0373947_0000613 3300035725 Bacteria 21037
419 Ga0373937_0333981 3300036401 Bacteria 1435
420 Ga0373925_0002340 3300037068 Bacteria 15243
421 Ga0373925_0054752 3300037068 Bacteria 2984
422 Ga0373925_0096138 3300037068 Bacteria 2270
423 Ga0373925_0115963 3300037068 Bacteria 2074
424 Ga0395899_0008464 3300037312 Bacteria 7926
425 Ga0395900_0060255 3300037418 Bacteria 3906
426 Ga0395900_0072373 3300037418 Bacteria 3544
427 Ga0395900_0125803 3300037418 Bacteria 2629
428 Ga0395898_0016461 3300037466 Bacteria 7567
429 Ga0395905_0002866 3300037471 Bacteria 18828
430 Ga0395905_0062752 3300037471 Bacteria 3475
431 Ga0395905_0228468 3300037471 Bacteria 1740
432 Ga0395901_0067500 3300038443 Bacteria 3724
433 Ga0395901_0195006 3300038443 Unclassified 2124
434 Ga0436363_1379029 3300039450 Bacteria 1417
435 Ga0439436_0008426 3300041404 Bacteria 3169
436 Ga0439436_0020543 3300041404 Bacteria 1966
437 Ga0439438_015880 3300041405 Bacteria 2202
438 Ga0439447_012370 3300041407 Bacteria 2454
439 Ga0439447_021533 3300041407 Bacteria 1697
440 Ga0451807_0485629 3300041486 Bacteria 2144
441 Ga0451853_0685456 3300041512 Bacteria 1691
442 Ga0451853_1556115 3300041512 Bacteria 1726
443 Ga0439433_0024380 3300041999 Bacteria 1362
444 Ga0439442_005001 3300042002 Bacteria 2646
445 Ga0439432_004431 3300042006 Bacteria 5129
446 Ga0439449_0006207 3300042007 Bacteria 4566
447 Ga0439449_0020184 3300042007 Bacteria 2496
448 Ga0439450_021813 3300042008 Bacteria 1378
449 Ga0439452_000966 3300042010 Bacteria 12916
450 Ga0450897_002057 3300042128 Bacteria 1463
451 Ga0439446_0000468 3300042156 Bacteria 7992
452 Ga0450909_002696 3300042185 Bacteria 2520
453 Ga0439434_0003711 3300042435 Bacteria 4468
454 Ga0439460_0006330 3300042461 Bacteria 2933
455 Ga0466968_0121105 3300044735 Bacteria 1184
456 Ga0451576_0000326 3300045051 Bacteria 115294
457 Ga0451576_0027529 3300045051 Bacteria 6104
458 Ga0451576_0030696 3300045051 Bacteria 5740
459 Ga0466958_0046506 3300045836 Bacteria 2619
460 Ga0466967_0012686 3300045976 Bacteria 6466
461 Ga0495592_0155941 3300046454 Bacteria 1575
462 Ga0495629_0024150 3300046459 Bacteria 4329
463 Ga0495629_0170093 3300046459 Bacteria 1512
464 Ga0495580_0041874 3300046472 Bacteria 3264
465 Ga0495662_0013109 3300046476 Bacteria 4037
466 Ga0495662_0052314 3300046476 Bacteria 1971
467 Ga0495664_0000473 3300046477 Bacteria 19941
468 Ga0495664_0131124 3300046477 Bacteria 1518
469 Ga0495618_0068172 3300046514 Bacteria 2262
470 Ga0495630_0002253 3300046517 Bacteria 13430
471 Ga0495630_0128784 3300046517 Bacteria 1921
472 Ga0495643_0064099 3300046522 Bacteria 1942
473 Ga0495652_0065783 3300046529 Bacteria 3045
474 Ga0495652_0121797 3300046529 Bacteria 2078
475 Ga0495665_0066777 3300046531 Unclassified 1897
476 Ga0495640_0071586 3300046533 Bacteria 2326
477 Ga0495586_0063207 3300046535 Bacteria 2016
478 Ga0495587_0009425 3300046536 Bacteria 6258
479 Ga0495621_0004590 3300046539 Bacteria 3901
480 Ga0495645_0013255 3300046543 Bacteria 5826
481 Ga0495667_0021767 3300046559 Bacteria 4325
482 Ga0495656_0151071 3300046615 Bacteria 1122
483 Ga0495634_0002152 3300046642 Bacteria 16576
484 Ga0495634_0003099 3300046642 Bacteria 13511
485 Ga0495634_0074386 3300046642 Bacteria 2232
486 Ga0495635_0000375 3300046663 Bacteria 28276
487 Ga0495657_0058695 3300046675 Bacteria 2554
488 Ga0495599_0017511 3300046678 Bacteria 4454
489 Ga0495623_0042262 3300046679 Bacteria 2904
490 Ga0495647_0041418 3300046681 Bacteria 1754
491 Ga0495658_0069550 3300046683 Bacteria 2041
492 Ga0495624_0013647 3300046690 Bacteria 5534
493 Ga0495624_0031067 3300046690 Bacteria 3476
494 Ga0495581_0009688 3300047315 Bacteria 5576
495 Ga0495604_0190945 3300047317 Bacteria 1427
496 Ga0495636_0017371 3300047318 Bacteria 2880
497 Ga0495674_0002065 3300047319 Bacteria 19693
498 Ga0495684_0002177 3300047471 Bacteria 15689
499 Ga0495684_0012832 3300047471 Bacteria 6466
500 Ga0495684_0020663 3300047471 Bacteria 5073
501 Ga0495593_0006727 3300047673 Bacteria 6730
502 Ga0496100_0199232 3300048903 Bacteria 1458
503 Ga0496101_0256982 3300048904 Bacteria 1362
504 Ga0496104_0009568 3300048907 Bacteria 8628
505 Ga0496105_0024505 3300048908 Bacteria 4903
506 Ga0496108_0014657 3300048911 Bacteria 6400
507 Ga0496108_0031269 3300048911 Bacteria 4416
508 Ga0496109_0000996 3300048912 Bacteria 23382
509 Ga0496109_0297687 3300048912 Bacteria 1521
510 Ga0496110_0000396 3300048913 Bacteria 29470
511 Ga0496111_0020711 3300048914 Bacteria 4583
512 Ga0496111_0100667 3300048914 Bacteria 2123
513 Ga0496112_0000240 3300048915 Bacteria 35240
514 Ga0496114_0246678 3300048917 Bacteria 1571
515 Ga0501036_0096587 3300049572 Bacteria 2498
516 Ga0501037_0010018 3300049573 Bacteria 6952
517 Ga0501038_0199990 3300049574 Bacteria 1604
518 Ga0501039_0052069 3300049575 Bacteria 3168
519 Ga0501040_0021383 3300049576 Bacteria 4320
520 Ga0501041_0218703 3300049577 Bacteria 1195
521 Ga0501043_0064707 3300049579 Bacteria 2872
522 Ga0501046_0362199 3300049580 Bacteria 1051
523 Ga0501075_0331119 3300049591 Bacteria 1160
524 Ga0501076_0000731 3300049592 Bacteria 21260
525 Ga0501079_0007561 3300049741 Bacteria 8225
526 Ga0501080_0003285 3300049742 Bacteria 14289
527 Ga0501081_0000115 3300049743 Bacteria 34620
528 nmdc:mga03683_2590_c2 3300050489 Bacteria 4151
529 nmdc:mga03n38_13587_c1 3300050490 Bacteria 3098
530 nmdc:mga00v17_177919_c1 3300050491 Bacteria 1372
531 nmdc:mga0k408_13046_c1 3300050493 Bacteria 4550
532 nmdc:mga0k408_21732_c1 3300050493 Bacteria 3607
533 nmdc:mga0k408_44802_c1 3300050493 Bacteria 2551
534 nmdc:mga06z11_151292_c1 3300050494 Bacteria 1319
535 nmdc:mga07m45_5833_c1 3300050496 Bacteria 6177
536 nmdc:mga06r32_13036_c1 3300050510 Bacteria 7522
537 nmdc:mga08y16_103198_c1 3300050511 Bacteria 2969
538 nmdc:mga08y16_752_c1 3300050511 Bacteria 30835
539 nmdc:mga0n895_15164_c1 3300050512 Bacteria 7023
540 nmdc:mga0rr50_955_c1 3300050513 Bacteria 15665
541 nmdc:mga0a205_179808_c1 3300050515 Bacteria 2009
542 nmdc:mga0a205_68785_c1 3300050515 Bacteria 3419
543 nmdc:mga0sz30_78107_c1 3300050516 Bacteria 1430
544 Ga0495601_0093158 3300053077 Bacteria 1940
545 Ga0495612_0000652 3300053078 Bacteria 13953
546 Ga0500610_0123732 3300053079 Bacteria 1320
547 Ga0495619_0009712 3300053085 Bacteria 6066
548 Ga0495619_0074994 3300053085 Unclassified 2269
549 Ga0500644_0000485 3300053088 Bacteria 17515
550 Ga0500651_0030627 3300053093 Bacteria 3386
551 Ga0500566_0019839 3300053094 Bacteria 3947
552 Ga0500641_0070089 3300053096 Bacteria 1474
553 Ga0500562_020518 3300053108 Bacteria 1715
554 Ga0500593_000105 3300053117 Bacteria 32307
555 Ga0500593_142099 3300053117 Bacteria 943
556 Ga0500595_000003 3300053119 Bacteria 419332
557 Ga0500652_002017 3300053131 Bacteria 6117
558 Ga0500568_0005169 3300053139 Bacteria 6804
559 Ga0500590_001662 3300053148 Bacteria 9305
560 Ga0500616_0000002 3300053153 Bacteria 1611257
561 Ga0500616_0046389 3300053153 Bacteria 2310
562 Ga0500619_000096 3300053154 Bacteria 23864
563 Ga0500645_000078 3300053730 Bacteria 76931
564 Ga0501084_0167016 3300054114 Bacteria 1857
565 Ga0501082_0008698 3300060353 Bacteria 8756
566 Ga0466962_0053207 3300061719 Bacteria 1935
567 2644301195 2643221654 Bacteria 5273570
568 2841914553 2841911363 Bacteria 6173697
569 2841920282 2841917233 Bacteria 6173500
570 2885193742 2885192300 Bacteria 5882526
571 2894238115 2894232714 Bacteria 8834183
572 2926760124 2926754445 Bacteria 5964435
573 nmdc:mga0qj67_27643_c1
574 Ga0055534_1002254
575 Ga0055540_1019252
576 Ga0065707_10083489
577 Ga0065707_10103539
578 Ga0070676_10036355
579 Ga0070676_10185380
580 Ga0070683_100000347
581 Ga0070683_100004990
582 Ga0070683_100280767
583 Ga0070690_100005081
584 Ga0070670_100000309
585 Ga0070670_100029278
586 Ga0070670_100199003
587 Ga0070670_100263249
588 Ga0070670_100371982
589 Ga0070677_10004019
590 Ga0070677_10054342
591 Ga0070677_10105483
592 Ga0068869_100001859
593 Ga0068869_100045994
594 Ga0070666_10002081
595 Ga0070666_10179699
596 Ga0070680_100092263
597 Ga0070682_100034514
598 Ga0068868_100000930
599 Ga0068868_100005400
600 Ga0068868_100012111
601 Ga0068868_100323962
602 Ga0070689_100000939
603 Ga0070689_100032710
604 Ga0070687_100000199
605 Ga0070661_100001422
606 Ga0070661_100217906
607 Ga0070661_100272912
608 Ga0070668_100033964
609 Ga0070668_100063383
610 Ga0070668_100151436
611 Ga0070669_100041925
612 Ga0070669_100306416
613 Ga0070675_100000049
614 Ga0070675_100000926
615 Ga0070675_100175869
616 Ga0070671_100000137
617 Ga0070671_100119494
618 Ga0070674_100171049
619 Ga0070673_100000394
620 Ga0070673_100078227
621 Ga0070673_100127486
622 Ga0070673_100146302
623 Ga0070688_100018238
624 Ga0070688_100140427
625 Ga0070659_100062258
626 Ga0070659_100315456
627 Ga0070667_100013715
628 Ga0070667_100132100
629 Ga0070667_100175560
630 Ga0070667_100245849
631 Ga0070714_100261069
632 Ga0070714_100408266
633 Ga0070713_100114554
634 Ga0070701_10011085
635 Ga0070705_100003046
636 Ga0070700_100021308
637 Ga0070700_100302532
638 Ga0070694_100095420
639 Ga0070678_100000771
640 Ga0070678_100073303
641 Ga0070678_100141993
642 Ga0070662_100056003
643 Ga0070662_100131172
644 Ga0070681_10039992
645 Ga0070681_10167301
646 Ga0068867_100000824
647 Ga0068867_100004978
648 Ga0068867_100016771
649 Ga0070685_10026991
650 Ga0070679_100009445
651 Ga0070679_100023923
652 Ga0070679_100250482
653 Ga0070679_100285377
654 Ga0070684_100089855
655 Ga0070672_100207665
656 Ga0070686_100011913
657 Ga0070695_100000728
658 Ga0070696_100006658
659 Ga0070693_100000072
660 Ga0070693_100108500
661 Ga0070693_100171358
662 Ga0070665_100002809
663 Ga0070665_100069685
664 Ga0070665_100095868
665 Ga0070665_100308262
666 Ga0070704_100003550
667 Ga0068855_100011949
668 Ga0068855_100125900
669 Ga0070664_100000054
670 Ga0068857_100032236
671 Ga0068857_100395650
672 Ga0068854_100000714
673 Ga0068854_100032767
674 Ga0068856_100059045
675 Ga0068856_100448281
676 Ga0070702_100000084
677 Ga0070702_100202335
678 Ga0068852_100000065
679 Ga0068852_100000654
680 Ga0068852_100034748
681 Ga0068859_100005387
682 Ga0068859_100018280
683 Ga0068859_100119947
684 Ga0068859_100363258
685 Ga0068864_100001420
686 Ga0068864_100003720
687 Ga0068864_100166232
688 Ga0068864_100212908
689 Ga0068866_10002137
690 Ga0068866_10082629
691 Ga0068861_100004429
692 Ga0068861_100050276
693 Ga0068861_100356137
694 Ga0068851_10001105
695 Ga0068863_100024030
696 Ga0068863_100087722
697 Ga0068863_100193985
698 Ga0068863_100369378
699 Ga0068863_100465044
700 Ga0068858_100001292
701 Ga0068858_100004784
702 Ga0068858_100064072
703 Ga0068858_100078513
704 Ga0068858_100105678
705 Ga0068858_100345172
706 Ga0068858_100373794
707 Ga0068860_100017811
708 Ga0068860_100020854
709 Ga0068860_100049428
710 Ga0068860_100133462
711 Ga0068860_100269120
712 Ga0068860_100379177
713 Ga0068860_100417519
714 Ga0068862_100009057
715 Ga0068862_100033323
716 Ga0068862_100044081
717 Ga0068862_100123210
718 Ga0068862_100128818
719 Ga0068862_100149038
720 Ga0068862_100180781
721 Ga0081540_1024715
722 Ga0075363_100035363
723 Ga0075364_10017505
724 Ga0070716_100066260
725 Ga0070712_100114065
726 Ga0075362_10009787
727 Ga0075369_10049988
728 Ga0075366_10004370
729 Ga0097621_100000051
730 Ga0097621_100000794
731 Ga0097621_100037041
732 Ga0097621_100072303
733 Ga0097621_100156113
734 Ga0075370_10073897
735 Ga0068871_100001133
736 Ga0068871_100037263
737 Ga0068871_100040416
738 Ga0068871_100145647
739 Ga0068871_100365659
740 Ga0075428_100015214
741 Ga0075430_100031263
742 Ga0075431_100004522
743 Ga0075433_10054907
744 Ga0075434_100000073
745 Ga0068865_100008183
746 Ga0068865_100054894
747 Ga0068865_100180687
748 Ga0068865_100436918
749 Ga0075436_100232184
750 Ga0097620_100005387
751 Ga0097620_100018280
752 Ga0097620_100119945
753 Ga0097620_100363303
754 Ga0075435_100028335
755 Ga0105250_10045733
756 Ga0105240_10007799
757 Ga0105240_10033241
758 Ga0105240_10116687
759 Ga0111539_10000288
760 Ga0111539_10530474
761 Ga0111539_10738483
762 Ga0105245_10001603
763 Ga0105245_10315345
764 Ga0105243_10001817
765 Ga0105243_10162006
766 Ga0105243_10345805
767 Ga0105242_10001017
768 Ga0105242_10003543
769 Ga0105242_10124752
770 Ga0105242_10215605
771 Ga0105248_10063971
772 Ga0105248_10064605
773 Ga0105248_10095368
774 Ga0105248_10142497
775 Ga0105248_10170421
776 Ga0105248_10442281
777 Ga0105238_10061117
778 Ga0105238_10070239
779 Ga0105249_10202557
780 Ga0105249_10250572
781 Ga0105249_10306750
782 Ga0105239_10028862
783 Ga0157371_10116250
784 Ga0157369_10002100
785 Ga0157374_10000144
786 Ga0157374_10064400
787 Ga0157374_10343763
788 Ga0157378_10004938
789 Ga0157378_10333690
790 Ga0163162_10043379
791 Ga0163162_10155654
792 Ga0163162_10164463
793 Ga0157372_10019363
794 Ga0157375_10000528
795 Ga0157375_10048662
796 Ga0157375_10809002
797 Ga0163163_10002538
798 Ga0163163_10041003
799 Ga0157380_10055946
800 Ga0157380_10059030
801 Ga0157380_10096950
802 Ga0157380_10488867
803 Ga0182008_10047877
804 Ga0157377_10018832
805 Ga0157377_10094913
806 Ga0157379_10014302
807 Ga0157379_10078851
808 Ga0157379_10176331
809 Ga0157376_10018401
810 Ga0157376_10021252
811 Ga0157376_10093792
812 Ga0157376_10181537
813 Ga0182007_10000741
814 Ga0182005_1025689
815 Ga0163161_10049347
816 Ga0163161_10061439
817 Ga0163161_10130729
818 Ga0163161_10264596
819 Ga0209675_1008603
820 Ga0209676_1008732
821 Ga0209564_1033405
822 Ga0209050_1018234
823 Ga0209051_1006725
824 Ga0209257_1009876
825 Ga0207656_10002656
826 Ga0207682_10069293
827 Ga0207682_10095739
828 Ga0207682_10103052
829 Ga0207642_10000462
830 Ga0207642_10042146
831 Ga0207688_10038310
832 Ga0207680_10022089
833 Ga0207647_10139997
834 Ga0207685_10038767
835 Ga0207707_10114125
836 Ga0207707_10157789
837 Ga0207695_10116254
838 Ga0207695_10401103
839 Ga0207693_10002296
840 Ga0207660_10002278
841 Ga0207662_10015491
842 Ga0207649_10002872
843 Ga0207649_10190348
844 Ga0207652_10031211
845 Ga0207652_10453835
846 Ga0207681_10027388
847 Ga0207681_10075524
848 Ga0207681_10087612
849 Ga0207681_10184165
850 Ga0207681_10274913
851 Ga0207694_10114919
852 Ga0207694_10137323
853 Ga0207650_10000339
854 Ga0207659_10001257
855 Ga0207659_10042224
856 Ga0207659_10423723
857 Ga0207687_10022407
858 Ga0207687_10401561
859 Ga0207664_10091168
860 Ga0207664_10131007
861 Ga0207644_10001499
862 Ga0207644_10058637
863 Ga0207706_10160664
864 Ga0207706_10268642
865 Ga0207686_10002549
866 Ga0207686_10005522
867 Ga0207686_10061029
868 Ga0207686_10081165
869 Ga0207670_10011269
870 Ga0207670_10012105
871 Ga0207670_10291573
872 Ga0207669_10013095
873 Ga0207704_10001219
874 Ga0207704_10037862
875 Ga0207704_10110312
876 Ga0207691_10000147
877 Ga0207691_10073763
878 Ga0207691_10084386
879 Ga0207691_10167488
880 Ga0207711_10050737
881 Ga0207711_10089291
882 Ga0207711_10351868
883 Ga0207689_10002203
884 Ga0207689_10041096
885 Ga0207689_10102265
886 Ga0207661_10001065
887 Ga0207661_10114188
888 Ga0207661_10234363
889 Ga0207679_10000307
890 Ga0207651_10000364
891 Ga0207651_10002644
892 Ga0207651_10152611
893 Ga0207651_10390920
894 Ga0207712_10047904
895 Ga0207668_10012084
896 Ga0207640_10000771
897 Ga0207658_10002924
898 Ga0207658_10009514
899 Ga0207658_10106479
900 Ga0207658_10112737
901 Ga0207677_10000130
902 Ga0207677_10011733
903 Ga0207703_10001647
904 Ga0207703_10004567
905 Ga0207703_10107768
906 Ga0207703_10114252
907 Ga0207703_10297838
908 Ga0207639_10029204
909 Ga0207678_10122250
910 Ga0207708_10000164
911 Ga0207641_10002593
912 Ga0207641_10029675
913 Ga0207641_10091210
914 Ga0207648_10002874
915 Ga0207648_10006920
916 Ga0207648_10098095
917 Ga0207648_10209768
918 Ga0207676_10001498
919 Ga0207676_10014132
920 Ga0207676_10023435
921 Ga0207676_10264522
922 Ga0207674_10009798
923 Ga0207675_100001661
924 Ga0207675_100100994
925 Ga0207675_100133276
926 Ga0207675_100440755
927 Ga0207683_10001384
928 Ga0207683_10025214
929 Ga0207683_10041084
930 Ga0207683_10082720
931 Ga0207698_10000135
932 Ga0207698_10018613
933 Ga0207698_10041202
934 Ga0207698_10062748
935 Ga0207698_10258721
936 Ga0209995_1001717
937 Ga0209983_1008336
938 Ga0209974_10003726
939 Ga0207428_10001183
940 Ga0268266_10053080
941 Ga0268266_10116379
942 Ga0268266_10268920
943 Ga0268266_10303491
944 Ga0268265_10002260
945 Ga0268265_10072023
946 Ga0268265_10139537
947 Ga0268265_10265392
948 Ga0268265_10338018
949 Ga0268264_10001897
950 Ga0268264_10016306
951 Ga0268264_10033693
952 Ga0307515_10001078
953 Ga0307515_10001329
954 Ga0307515_10190055
955 Ga0307515_10333826
956 Ga0265338_10117760
957 Ga0265325_10009273
958 Ga0265339_10000064
959 Ga0307513_10155353
960 Ga0265313_10000020
961 Ga0307514_10000810
962 Ga0307516_10000398
963 Ga0373930_0002261
964 Ga0373930_0010068
965 Ga0373950_0005017
966 Ga0373929_0002234
967 Ga0373949_0009306
968 Ga0373951_0007362
969 Ga0373923_0032981
970 Ga0373932_0002181
971 Ga0373936_0024620
972 Ga0373939_0003147
973 Ga0373945_0008852
974 Ga0373945_0071085
975 Ga0373943_0001338
976 Ga0373946_0001949
977 Ga0373955_0020180
978 Ga0373942_0030553
979 Ga0373942_0078606
980 Ga0373931_0000219
981 Ga0373931_0016561
982 Ga0373931_0059134
983 Ga0373931_0090972
984 Ga0373931_0117627
985 Ga0373935_0021907
986 Ga0373935_0099756
987 Ga0373927_0000243
988 Ga0373927_0013298
989 Ga0373927_0015370
990 Ga0373947_0000613
991 Ga0373937_0333981
992 Ga0373925_0002340
993 Ga0373925_0054752
994 Ga0373925_0096138
995 Ga0373925_0115963
996 Ga0395899_0008464
997 Ga0395900_0060255
998 Ga0395900_0072373
999 Ga0395900_0125803
1000 Ga0395898_0016461
1001 Ga0395905_0002866
1002 Ga0395905_0062752
1003 Ga0395905_0228468
1004 Ga0395901_0067500
1005 Ga0395901_0195006
1006 Ga0436363_1379029
1007 Ga0439436_0008426
1008 Ga0439436_0020543
1009 Ga0439438_015880
1010 Ga0439447_012370
1011 Ga0439447_021533
1012 Ga0451807_0485629
1013 Ga0451853_0685456
1014 Ga0451853_1556115
1015 Ga0439433_0024380
1016 Ga0439442_005001
1017 Ga0439432_004431
1018 Ga0439449_0006207
1019 Ga0439449_0020184
1020 Ga0439450_021813
1021 Ga0439452_000966
1022 Ga0450897_002057
1023 Ga0439446_0000468
1024 Ga0450909_002696
1025 Ga0439434_0003711
1026 Ga0439460_0006330
1027 Ga0466968_0121105
1028 Ga0451576_0000326
1029 Ga0451576_0027529
1030 Ga0451576_0030696
1031 Ga0466958_0046506
1032 Ga0466967_0012686
1033 Ga0495592_0155941
1034 Ga0495629_0024150
1035 Ga0495629_0170093
1036 Ga0495580_0041874
1037 Ga0495662_0013109
1038 Ga0495662_0052314
1039 Ga0495664_0000473
1040 Ga0495664_0131124
1041 Ga0495618_0068172
1042 Ga0495630_0002253
1043 Ga0495630_0128784
1044 Ga0495643_0064099
1045 Ga0495652_0065783
1046 Ga0495652_0121797
1047 Ga0495665_0066777
1048 Ga0495640_0071586
1049 Ga0495586_0063207
1050 Ga0495587_0009425
1051 Ga0495621_0004590
1052 Ga0495645_0013255
1053 Ga0495667_0021767
1054 Ga0495656_0151071
1055 Ga0495634_0002152
1056 Ga0495634_0003099
1057 Ga0495634_0074386
1058 Ga0495635_0000375
1059 Ga0495657_0058695
1060 Ga0495599_0017511
1061 Ga0495623_0042262
1062 Ga0495647_0041418
1063 Ga0495658_0069550
1064 Ga0495624_0013647
1065 Ga0495624_0031067
1066 Ga0495581_0009688
1067 Ga0495604_0190945
1068 Ga0495636_0017371
1069 Ga0495674_0002065
1070 Ga0495684_0002177
1071 Ga0495684_0012832
1072 Ga0495684_0020663
1073 Ga0495593_0006727
1074 Ga0496100_0199232
1075 Ga0496101_0256982
1076 Ga0496104_0009568
1077 Ga0496105_0024505
1078 Ga0496108_0014657
1079 Ga0496108_0031269
1080 Ga0496109_0000996
1081 Ga0496109_0297687
1082 Ga0496110_0000396
1083 Ga0496111_0020711
1084 Ga0496111_0100667
1085 Ga0496112_0000240
1086 Ga0496114_0246678
1087 Ga0501036_0096587
1088 Ga0501037_0010018
1089 Ga0501038_0199990
1090 Ga0501039_0052069
1091 Ga0501040_0021383
1092 Ga0501041_0218703
1093 Ga0501043_0064707
1094 Ga0501046_0362199
1095 Ga0501075_0331119
1096 Ga0501076_0000731
1097 Ga0501079_0007561
1098 Ga0501080_0003285
1099 Ga0501081_0000115
1100 nmdc:mga03683_2590_c2
1101 nmdc:mga03n38_13587_c1
1102 nmdc:mga00v17_177919_c1
1103 nmdc:mga0k408_13046_c1
1104 nmdc:mga0k408_21732_c1
1105 nmdc:mga0k408_44802_c1
1106 nmdc:mga06z11_151292_c1
1107 nmdc:mga07m45_5833_c1
1108 nmdc:mga06r32_13036_c1
1109 nmdc:mga08y16_103198_c1
1110 nmdc:mga08y16_752_c1
1111 nmdc:mga0n895_15164_c1
1112 nmdc:mga0rr50_955_c1
1113 nmdc:mga0a205_179808_c1
1114 nmdc:mga0a205_68785_c1
1115 nmdc:mga0sz30_78107_c1
1116 Ga0495601_0093158
1117 Ga0495612_0000652
1118 Ga0500610_0123732
1119 Ga0495619_0009712
1120 Ga0495619_0074994
1121 Ga0500644_0000485
1122 Ga0500651_0030627
1123 Ga0500566_0019839
1124 Ga0500641_0070089
1125 Ga0500562_020518
1126 Ga0500593_000105
1127 Ga0500593_142099
1128 Ga0500595_000003
1129 Ga0500652_002017
1130 Ga0500568_0005169
1131 Ga0500590_001662
1132 Ga0500616_0000002
1133 Ga0500616_0046389
1134 Ga0500619_000096
1135 Ga0500645_000078
1136 Ga0501084_0167016
1137 Ga0501082_0008698
1138 Ga0466962_0053207
1139 2644301195
1140 2841914553
1141 2841920282
1142 2885193742
1143 2894238115
1144 2926760124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

82

355

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9458 44 344
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9427 44 344
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9376 43 344
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9368 47 344
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9345 43 344
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9591 143 265 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9471 143 269 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9409 144 269 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.933 43 344 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9325 143 269 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6P3Z6M4-F1-model_v4 Uncharacterized protein LOC107407903 0.97 72 344
AF-A0A536XT46-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9693 72 344
AF-A0A1F4DIF3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9665 138 344
AF-H0BVV3-F1-model_v4 Uncharacterized protein 0.9657 40 344
AF-A0A536XGM1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9634 44 344

Map