F465151

General Info

Members Datasets Scaffolds Average Seq Length
573 274 1144 327

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10017334|Ga0070676_100173343
Length 349
Sequence MGSGWRFAANRPFGRITSQEVNLETRKLGQGLEVSAMGLGCMGMSDFYGGRDDDEALATIHRAVELGITLFDTADMYGSGRNEELVGRALRGQRDKVKVATKFGNVRNPDGTFKGVNGKPEYVRQCCEGSLKRLGVDVIDLYYQHRVDPETPIEDTVGAMADLVREGKVRWLGLSEAAPATLRRAHAVHPIAALQTEYSLWSRGPEDEILRTVRELGIGFVPYSPLGRGFLTGQIRSIEDLEPDDYRRNSPRFQGENFQKNTLLVQEIEAIADEKGCTSSQLALAWVLSQGDDIVPIPGTKRRKYLEENVRALDVELTPAELARIDQVIPSGAASGERYAPLALRAVNR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
254 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
255 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
262 2508501050 Microvirga lupini Lut6 Isolate Nodule
263 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
264 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
265 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
266 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
267 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
268 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
269 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
270 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
271 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
272 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
273 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
274 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.21
Metatranscriptomes 0.52
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0.7
Rhizoplane 5.06
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10017334 3300005328 Bacteria 3987
2 JGI24736J21556_1000279 3300001904 Bacteria 9356
3 JGI24735J21928_10023728 3300002067 Bacteria 1859
4 Ga0065712_10090974 3300005290 Bacteria 2397
5 Ga0070658_10001042 3300005327 Bacteria 23741
6 Ga0070658_10012945 3300005327 Bacteria 6697
7 Ga0070658_10053234 3300005327 Bacteria 3284
8 Ga0070658_10081292 3300005327 Bacteria 2661
9 Ga0070658_10091352 3300005327 Bacteria 2509
10 Ga0070658_10150313 3300005327 Bacteria 1949
11 Ga0070658_10189668 3300005327 Bacteria 1732
12 Ga0070683_100010290 3300005329 Bacteria 8042
13 Ga0070683_100037538 3300005329 Bacteria 4435
14 Ga0070683_100046233 3300005329 Bacteria 4020
15 Ga0070683_100488749 3300005329 Bacteria 1175
16 Ga0070670_100025200 3300005331 Bacteria 5119
17 Ga0070670_100030671 3300005331 Bacteria 4630
18 Ga0070670_100076391 3300005331 Unclassified 2878
19 Ga0070670_100182126 3300005331 Bacteria 1824
20 Ga0068869_100282570 3300005334 Bacteria 1335
21 Ga0070666_10000649 3300005335 Bacteria 20972
22 Ga0070666_10037051 3300005335 Unclassified 3241
23 Ga0070666_10225650 3300005335 Bacteria 1322
24 Ga0070680_100003554 3300005336 Bacteria 11627
25 Ga0070680_100010197 3300005336 Bacteria 7246
26 Ga0070680_100020880 3300005336 Bacteria 5199
27 Ga0070680_100071346 3300005336 Bacteria 2854
28 Ga0070680_100137789 3300005336 Bacteria 2045
29 Ga0070680_100242587 3300005336 Bacteria 1523
30 Ga0070680_100282145 3300005336 Bacteria 1407
31 Ga0068868_100012312 3300005338 Bacteria 6250
32 Ga0070660_100000853 3300005339 Bacteria 20293
33 Ga0070660_100025035 3300005339 Bacteria 4433
34 Ga0070660_100042156 3300005339 Bacteria 3483
35 Ga0070660_100049519 3300005339 Bacteria 3230
36 Ga0070661_100018088 3300005344 Bacteria 5007
37 Ga0070661_100045915 3300005344 Bacteria 3194
38 Ga0070661_100302318 3300005344 Bacteria 1246
39 Ga0070669_100154898 3300005353 Bacteria 1776
40 Ga0070675_100009650 3300005354 Bacteria 7513
41 Ga0070675_100034084 3300005354 Bacteria 4130
42 Ga0070675_100082710 3300005354 Bacteria 2679
43 Ga0070671_100000784 3300005355 Bacteria 22894
44 Ga0070671_100003742 3300005355 Bacteria 11942
45 Ga0070671_100007039 3300005355 Bacteria 9009
46 Ga0070671_100008932 3300005355 Bacteria 8042
47 Ga0070671_100024859 3300005355 Bacteria 4908
48 Ga0070671_100048248 3300005355 Bacteria 3541
49 Ga0070674_100002702 3300005356 Bacteria 9806
50 Ga0070674_100004451 3300005356 Bacteria 7992
51 Ga0070673_100000680 3300005364 Bacteria 18748
52 Ga0070673_100354725 3300005364 Bacteria 1302
53 Ga0070673_100542644 3300005364 Bacteria 1055
54 Ga0070659_100001250 3300005366 Bacteria 18454
55 Ga0070659_100005417 3300005366 Bacteria 9164
56 Ga0070659_100069052 3300005366 Bacteria 2805
57 Ga0070659_100069957 3300005366 Bacteria 2787
58 Ga0070659_100307571 3300005366 Bacteria 1323
59 Ga0070667_100002348 3300005367 Bacteria 16582
60 Ga0070667_100004770 3300005367 Bacteria 11353
61 Ga0070667_100015853 3300005367 Bacteria 6235
62 Ga0070667_100323510 3300005367 Bacteria 1392
63 Ga0070714_100022769 3300005435 Bacteria 5140
64 Ga0070714_100084984 3300005435 Bacteria 2763
65 Ga0070714_100124486 3300005435 Bacteria 2296
66 Ga0070713_100078404 3300005436 Bacteria 2812
67 Ga0070713_100129490 3300005436 Bacteria 2224
68 Ga0070701_10244463 3300005438 Bacteria 1081
69 Ga0070708_100025867 3300005445 Bacteria 5019
70 Ga0070663_100004077 3300005455 Bacteria 8535
71 Ga0070663_100011542 3300005455 Bacteria 5551
72 Ga0070663_100014439 3300005455 Bacteria 5069
73 Ga0070663_100015099 3300005455 Bacteria 4973
74 Ga0070663_100025259 3300005455 Bacteria 4009
75 Ga0070663_100117556 3300005455 Bacteria 2005
76 Ga0070678_100043496 3300005456 Unclassified 3200
77 Ga0070662_100003775 3300005457 Bacteria 9476
78 Ga0070662_100004550 3300005457 Bacteria 8782
79 Ga0070662_100188297 3300005457 Bacteria 1630
80 Ga0070681_10003495 3300005458 Bacteria 14713
81 Ga0070681_10015563 3300005458 Bacteria 7575
82 Ga0068867_100003830 3300005459 Bacteria 10571
83 Ga0068867_100077920 3300005459 Bacteria 2492
84 Ga0070706_100023207 3300005467 Bacteria 5714
85 Ga0070707_100065791 3300005468 Bacteria 3483
86 Ga0070679_100038156 3300005530 Bacteria 4775
87 Ga0070679_100057672 3300005530 Bacteria 3871
88 Ga0070679_100280185 3300005530 Bacteria 1620
89 Ga0070684_100000649 3300005535 Bacteria 23943
90 Ga0068853_100000075 3300005539 Bacteria 68972
91 Ga0068853_100007441 3300005539 Bacteria 8762
92 Ga0068853_100024622 3300005539 Bacteria 5049
93 Ga0070672_100002477 3300005543 Bacteria 11736
94 Ga0070665_100000053 3300005548 Bacteria 244523
95 Ga0070665_100003133 3300005548 Bacteria 17806
96 Ga0070665_100012148 3300005548 Bacteria 8684
97 Ga0070665_100015381 3300005548 Bacteria 7684
98 Ga0070665_100042126 3300005548 Bacteria 4589
99 Ga0070665_100129211 3300005548 Bacteria 2529
100 Ga0068855_100000596 3300005563 Bacteria 44278
101 Ga0068855_100000844 3300005563 Bacteria 37972
102 Ga0068855_100040677 3300005563 Bacteria 5516
103 Ga0068855_100053781 3300005563 Bacteria 4736
104 Ga0068855_100120381 3300005563 Bacteria 3004
105 Ga0068855_100144512 3300005563 Bacteria 2709
106 Ga0068855_100206516 3300005563 Bacteria 2209
107 Ga0068855_100208337 3300005563 Bacteria 2198
108 Ga0070664_100000211 3300005564 Bacteria 41615
109 Ga0070664_100004256 3300005564 Bacteria 11513
110 Ga0070664_100007799 3300005564 Bacteria 8645
111 Ga0070664_100033590 3300005564 Bacteria 4298
112 Ga0070664_100056661 3300005564 Bacteria 3330
113 Ga0070664_100120041 3300005564 Bacteria 2301
114 Ga0070664_100257555 3300005564 Bacteria 1569
115 Ga0068857_100100024 3300005577 Bacteria 2601
116 Ga0068857_100138289 3300005577 Bacteria 2200
117 Ga0068854_100055791 3300005578 Bacteria 2846
118 Ga0068854_100058608 3300005578 Bacteria 2780
119 Ga0068856_100000194 3300005614 Bacteria 64170
120 Ga0068856_100000267 3300005614 Bacteria 56822
121 Ga0068856_100000880 3300005614 Bacteria 32137
122 Ga0068856_100281587 3300005614 Bacteria 1679
123 Ga0068856_100359175 3300005614 Bacteria 1475
124 Ga0068852_100001163 3300005616 Bacteria 17413
125 Ga0068852_100005589 3300005616 Bacteria 9011
126 Ga0068859_100020691 3300005617 Bacteria 6603
127 Ga0068859_100179310 3300005617 Bacteria 2201
128 Ga0068864_100000982 3300005618 Bacteria 23872
129 Ga0068864_100020168 3300005618 Bacteria 5576
130 Ga0068864_100053121 3300005618 Bacteria 3494
131 Ga0068861_100163693 3300005719 Bacteria 1837
132 Ga0068851_10001553 3300005834 Bacteria 10061
133 Ga0068851_10003564 3300005834 Bacteria 6933
134 Ga0068851_10026955 3300005834 Bacteria 2828
135 Ga0068870_10019997 3300005840 Bacteria 3254
136 Ga0068863_100010319 3300005841 Bacteria 9076
137 Ga0068863_100010833 3300005841 Bacteria 8841
138 Ga0068863_100420489 3300005841 Bacteria 1309
139 Ga0068858_100555030 3300005842 Bacteria 1112
140 Ga0068860_100076202 3300005843 Bacteria 3190
141 Ga0068862_100084433 3300005844 Bacteria 2759
142 Ga0081538_10003771 3300005981 Bacteria 14185
143 Ga0097621_100000352 3300006237 Bacteria 31757
144 Ga0097621_100047270 3300006237 Bacteria 3487
145 Ga0068871_100030967 3300006358 Bacteria 4216
146 Ga0068871_100270317 3300006358 Bacteria 1485
147 Ga0075428_100409196 3300006844 Bacteria 1453
148 Ga0075431_100006520 3300006847 Bacteria 11589
149 Ga0075431_100182002 3300006847 Bacteria 2156
150 Ga0068865_100138322 3300006881 Unclassified 1833
151 Ga0097620_100020692 3300006931 Bacteria 6603
152 Ga0097620_100179305 3300006931 Bacteria 2201
153 Ga0075435_100169259 3300007076 Bacteria 1843
154 Ga0105240_10020233 3300009093 Bacteria 8883
155 Ga0105240_10085116 3300009093 Bacteria 3875
156 Ga0111539_10089792 3300009094 Bacteria 3611
157 Ga0111539_10211520 3300009094 Bacteria 2259
158 Ga0114129_10013522 3300009147 Bacteria 11630
159 Ga0105248_10019891 3300009177 Bacteria 7434
160 Ga0105248_10074608 3300009177 Bacteria 3812
161 Ga0105248_10105196 3300009177 Bacteria 3182
162 Ga0105248_10309046 3300009177 Bacteria 1780
163 Ga0105237_10037922 3300009545 Bacteria 4869
164 Ga0105239_10262749 3300010375 Bacteria 1940
165 Ga0157373_10001644 3300013100 Bacteria 17070
166 Ga0157373_10013781 3300013100 Bacteria 5926
167 Ga0157373_10226138 3300013100 Bacteria 1321
168 Ga0157373_10252623 3300013100 Bacteria 1247
169 Ga0157371_10001047 3300013102 Bacteria 30349
170 Ga0157371_10012085 3300013102 Bacteria 6614
171 Ga0157371_10041379 3300013102 Bacteria 3289
172 Ga0157370_10326945 3300013104 Bacteria 1414
173 Ga0157369_10102883 3300013105 Bacteria 3042
174 Ga0157369_10131616 3300013105 Bacteria 2650
175 Ga0157369_10150824 3300013105 Bacteria 2456
176 Ga0157369_10328226 3300013105 Bacteria 1590
177 Ga0157374_10006781 3300013296 Bacteria 9737
178 Ga0157378_10002818 3300013297 Bacteria 15507
179 Ga0157378_10015717 3300013297 Bacteria 6628
180 Ga0163162_10000237 3300013306 Bacteria 50279
181 Ga0163162_10002053 3300013306 Bacteria 18911
182 Ga0163162_10026987 3300013306 Bacteria 5678
183 Ga0163162_10100275 3300013306 Bacteria 2987
184 Ga0157372_10001680 3300013307 Bacteria 23934
185 Ga0157372_10003409 3300013307 Bacteria 17153
186 Ga0157372_10014482 3300013307 Bacteria 8439
187 Ga0157372_10083935 3300013307 Bacteria 3609
188 Ga0157375_10000599 3300013308 Bacteria 31988
189 Ga0157375_10005819 3300013308 Bacteria 10729
190 Ga0157375_10018386 3300013308 Bacteria 6338
191 Ga0157375_10245432 3300013308 Bacteria 1951
192 Ga0157375_10315996 3300013308 Bacteria 1726
193 Ga0163163_10000703 3300014325 Bacteria 28430
194 Ga0163163_10009778 3300014325 Bacteria 8592
195 Ga0163163_10013548 3300014325 Bacteria 7470
196 Ga0163163_10453623 3300014325 Bacteria 1342
197 Ga0157380_10104587 3300014326 Bacteria 2365
198 Ga0157380_10546740 3300014326 Bacteria 1135
199 Ga0157379_10107742 3300014968 Bacteria 2501
200 Ga0157376_10002711 3300014969 Bacteria 12063
201 Ga0157376_10583939 3300014969 Bacteria 1110
202 Ga0182005_1000635 3300015265 Bacteria 16723
203 Ga0163161_10015722 3300017792 Bacteria 5277
204 Ga0163161_10121683 3300017792 Bacteria 1962
205 Ga0197907_10533111 3300020069 Bacteria 1506
206 Ga0206353_10072566 3300020082 Bacteria 1685
207 Ga0213873_10052625 3300021358 Bacteria 1082
208 Ga0213874_10009790 3300021377 Bacteria 2382
209 Ga0213876_10014540 3300021384 Bacteria 4171
210 Ga0213876_10053992 3300021384 Bacteria 2122
211 Ga0213876_10061722 3300021384 Bacteria 1978
212 Ga0213875_10001475 3300021388 Bacteria 15186
213 Ga0224712_10077694 3300022467 Bacteria 1363
214 Ga0209436_101738 3300025208 Bacteria 7157
215 Ga0207656_10001106 3300025321 Bacteria 8853
216 Ga0207682_10001861 3300025893 Bacteria 9605
217 Ga0207688_10058085 3300025901 Bacteria 2177
218 Ga0207680_10007168 3300025903 Bacteria 5420
219 Ga0207680_10049740 3300025903 Bacteria 2497
220 Ga0207647_10002313 3300025904 Bacteria 14511
221 Ga0207645_10011147 3300025907 Bacteria 6150
222 Ga0207645_10173004 3300025907 Bacteria 1416
223 Ga0207643_10038521 3300025908 Bacteria 2685
224 Ga0207705_10002221 3300025909 Bacteria 14985
225 Ga0207705_10026426 3300025909 Bacteria 4139
226 Ga0207705_10047778 3300025909 Bacteria 3078
227 Ga0207705_10090924 3300025909 Bacteria 2235
228 Ga0207705_10120999 3300025909 Bacteria 1942
229 Ga0207705_10280893 3300025909 Bacteria 1274
230 Ga0207654_10066171 3300025911 Bacteria 2131
231 Ga0207707_10025122 3300025912 Bacteria 5210
232 Ga0207707_10074823 3300025912 Bacteria 2954
233 Ga0207707_10076135 3300025912 Bacteria 2928
234 Ga0207707_10201633 3300025912 Bacteria 1735
235 Ga0207695_10211624 3300025913 Bacteria 1849
236 Ga0207695_10298183 3300025913 Bacteria 1503
237 Ga0207660_10001577 3300025917 Bacteria 15293
238 Ga0207660_10002299 3300025917 Bacteria 12589
239 Ga0207660_10027321 3300025917 Bacteria 3892
240 Ga0207660_10056099 3300025917 Bacteria 2818
241 Ga0207660_10338851 3300025917 Bacteria 1203
242 Ga0207657_10000302 3300025919 Bacteria 52284
243 Ga0207657_10001180 3300025919 Bacteria 27737
244 Ga0207657_10001248 3300025919 Bacteria 27180
245 Ga0207657_10028271 3300025919 Bacteria 5118
246 Ga0207657_10077425 3300025919 Bacteria 2803
247 Ga0207649_10042269 3300025920 Bacteria 2780
248 Ga0207649_10174233 3300025920 Bacteria 1501
249 Ga0207652_10006598 3300025921 Bacteria 9353
250 Ga0207652_10006980 3300025921 Bacteria 9099
251 Ga0207652_10110685 3300025921 Bacteria 2435
252 Ga0207652_10232296 3300025921 Bacteria 1662
253 Ga0207646_10053967 3300025922 Bacteria 3595
254 Ga0207646_10161281 3300025922 Bacteria 2023
255 Ga0207681_10099670 3300025923 Bacteria 2093
256 Ga0207694_10015696 3300025924 Bacteria 5713
257 Ga0207694_10274140 3300025924 Bacteria 1384
258 Ga0207650_10047717 3300025925 Bacteria 3156
259 Ga0207650_10058955 3300025925 Unclassified 2859
260 Ga0207650_10138234 3300025925 Bacteria 1913
261 Ga0207659_10008605 3300025926 Bacteria 6347
262 Ga0207659_10109388 3300025926 Bacteria 2098
263 Ga0207700_10081666 3300025928 Bacteria 2525
264 Ga0207700_10105382 3300025928 Bacteria 2258
265 Ga0207664_10062680 3300025929 Bacteria 2970
266 Ga0207664_10116858 3300025929 Bacteria 2226
267 Ga0207644_10000181 3300025931 Bacteria 45051
268 Ga0207644_10006287 3300025931 Bacteria 7737
269 Ga0207644_10008868 3300025931 Bacteria 6587
270 Ga0207644_10022159 3300025931 Bacteria 4337
271 Ga0207644_10159124 3300025931 Bacteria 1754
272 Ga0207690_10000937 3300025932 Bacteria 18676
273 Ga0207690_10031162 3300025932 Bacteria 3410
274 Ga0207690_10190652 3300025932 Bacteria 1550
275 Ga0207706_10000144 3300025933 Bacteria 76997
276 Ga0207706_10007683 3300025933 Bacteria 9957
277 Ga0207706_10010098 3300025933 Bacteria 8646
278 Ga0207706_10026892 3300025933 Bacteria 5150
279 Ga0207706_10163236 3300025933 Bacteria 1958
280 Ga0207670_10221097 3300025936 Bacteria 1450
281 Ga0207669_10031982 3300025937 Bacteria 2948
282 Ga0207669_10041855 3300025937 Bacteria 2670
283 Ga0207704_10111167 3300025938 Unclassified 1853
284 Ga0207704_10329211 3300025938 Bacteria 1181
285 Ga0207691_10000384 3300025940 Bacteria 44354
286 Ga0207691_10026376 3300025940 Bacteria 5452
287 Ga0207711_10015244 3300025941 Bacteria 6380
288 Ga0207711_10027487 3300025941 Bacteria 4778
289 Ga0207711_10092656 3300025941 Bacteria 2660
290 Ga0207661_10000429 3300025944 Bacteria 27131
291 Ga0207661_10068457 3300025944 Bacteria 2891
292 Ga0207661_10259884 3300025944 Bacteria 1546
293 Ga0207679_10003032 3300025945 Bacteria 10402
294 Ga0207679_10009299 3300025945 Bacteria 6289
295 Ga0207679_10041134 3300025945 Bacteria 3313
296 Ga0207679_10085425 3300025945 Bacteria 2424
297 Ga0207667_10001020 3300025949 Bacteria 35702
298 Ga0207667_10001692 3300025949 Bacteria 27757
299 Ga0207667_10008148 3300025949 Bacteria 12477
300 Ga0207667_10017050 3300025949 Bacteria 8192
301 Ga0207667_10073615 3300025949 Bacteria 3549
302 Ga0207667_10222566 3300025949 Bacteria 1933
303 Ga0207651_10006757 3300025960 Bacteria 6044
304 Ga0207651_10024540 3300025960 Bacteria 3732
305 Ga0207668_10022843 3300025972 Bacteria 4009
306 Ga0207640_10144035 3300025981 Bacteria 1741
307 Ga0207640_10186868 3300025981 Bacteria 1559
308 Ga0207658_10002480 3300025986 Bacteria 13457
309 Ga0207658_10011563 3300025986 Bacteria 6009
310 Ga0207658_10066934 3300025986 Bacteria 2704
311 Ga0207677_10007715 3300026023 Bacteria 5973
312 Ga0207703_10142517 3300026035 Bacteria 2081
313 Ga0207703_10363789 3300026035 Bacteria 1335
314 Ga0207703_10466902 3300026035 Bacteria 1181
315 Ga0207639_10000012 3300026041 Bacteria 344067
316 Ga0207639_10016221 3300026041 Bacteria 5265
317 Ga0207639_10151185 3300026041 Bacteria 1944
318 Ga0207639_10175578 3300026041 Bacteria 1818
319 Ga0207678_10017824 3300026067 Bacteria 6235
320 Ga0207678_10023120 3300026067 Bacteria 5440
321 Ga0207678_10023980 3300026067 Bacteria 5333
322 Ga0207678_10028574 3300026067 Bacteria 4867
323 Ga0207678_10086288 3300026067 Bacteria 2682
324 Ga0207678_10107361 3300026067 Bacteria 2381
325 Ga0207702_10002214 3300026078 Bacteria 18628
326 Ga0207702_10007484 3300026078 Bacteria 9313
327 Ga0207702_10010745 3300026078 Bacteria 7645
328 Ga0207702_10265959 3300026078 Bacteria 1616
329 Ga0207641_10037635 3300026088 Bacteria 4042
330 Ga0207648_10004895 3300026089 Bacteria 13651
331 Ga0207648_10107044 3300026089 Bacteria 2454
332 Ga0207676_10003014 3300026095 Bacteria 12011
333 Ga0207676_10052381 3300026095 Bacteria 3190
334 Ga0207674_10000251 3300026116 Bacteria 66996
335 Ga0207674_10024012 3300026116 Bacteria 6520
336 Ga0207674_10049652 3300026116 Bacteria 4289
337 Ga0207674_10087928 3300026116 Bacteria 3100
338 Ga0207674_10119532 3300026116 Bacteria 2604
339 Ga0207674_10275345 3300026116 Bacteria 1631
340 Ga0207674_10381855 3300026116 Bacteria 1362
341 Ga0207675_100200000 3300026118 Bacteria 1919
342 Ga0207675_100236154 3300026118 Bacteria 1765
343 Ga0207683_10000306 3300026121 Bacteria 44304
344 Ga0207683_10042484 3300026121 Unclassified 3971
345 Ga0207683_10079910 3300026121 Unclassified 2900
346 Ga0207683_10350603 3300026121 Bacteria 1355
347 Ga0207698_10024638 3300026142 Bacteria 4227
348 Ga0207698_10055710 3300026142 Bacteria 3049
349 Ga0207698_10083116 3300026142 Bacteria 2591
350 Ga0209371_1001592 3300027312 Bacteria 14789
351 Ga0209971_1010319 3300027682 Bacteria 2212
352 Ga0268266_10000001 3300028379 Bacteria 4040580
353 Ga0268266_10007004 3300028379 Bacteria 10239
354 Ga0268266_10013691 3300028379 Bacteria 6985
355 Ga0268266_10095567 3300028379 Bacteria 2610
356 Ga0268265_10079289 3300028380 Bacteria 2586
357 Ga0268265_10282164 3300028380 Bacteria 1487
358 Ga0268264_10198302 3300028381 Bacteria 1834
359 Ga0265323_10004413 3300028653 Bacteria 6067
360 Ga0268256_1001375 3300030500 Bacteria 14789
361 Ga0316183_1105030 3300030742 Bacteria 10903
362 Ga0265339_10006549 3300031249 Bacteria 7633
363 Ga0265331_10006374 3300031250 Bacteria 6985
364 Ga0265331_10063586 3300031250 Bacteria 1738
365 Ga0265316_10275517 3300031344 Bacteria 1230
366 Ga0307513_10089885 3300031456 Bacteria 3134
367 Ga0307509_10034082 3300031507 Bacteria 5598
368 Ga0307509_10075149 3300031507 Bacteria 3510
369 Ga0307408_100037986 3300031548 Bacteria 3395
370 Ga0307408_100063760 3300031548 Bacteria 2697
371 Ga0307408_100241168 3300031548 Bacteria 1486
372 Ga0265313_10000325 3300031595 Bacteria 51942
373 Ga0265314_10055490 3300031711 Bacteria 2734
374 Ga0316576_10160076 3300031727 Bacteria 1698
375 Ga0307413_10010918 3300031824 Bacteria 4435
376 Ga0307410_10011114 3300031852 Bacteria 5135
377 Ga0307410_10033359 3300031852 Bacteria 3323
378 Ga0307410_10098258 3300031852 Bacteria 2093
379 Ga0307406_10107722 3300031901 Bacteria 1911
380 Ga0307407_10002242 3300031903 Bacteria 7471
381 Ga0307409_100004885 3300031995 Bacteria 7623
382 Ga0307409_100026205 3300031995 Bacteria 4107
383 Ga0307416_100002682 3300032002 Bacteria 10302
384 Ga0307416_100047963 3300032002 Bacteria 3385
385 Ga0307416_100408439 3300032002 Bacteria 1398
386 Ga0307414_10074008 3300032004 Bacteria 2466
387 Ga0307411_10000643 3300032005 Bacteria 12701
388 Ga0307411_10052546 3300032005 Bacteria 2664
389 Ga0307415_100042287 3300032126 Bacteria 3032
390 Ga0307507_10128156 3300033179 Bacteria 1998
391 Ga0373926_0034014 3300035083 Bacteria 1803
392 Ga0373954_0039250 3300035118 Bacteria 2204
393 Ga0373935_0077960 3300035692 Bacteria 2148
394 Ga0373947_0252065 3300035725 Bacteria 1167
395 Ga0373937_0183538 3300036401 Bacteria 1965
396 Ga0373937_0491503 3300036401 Bacteria 1166
397 Ga0316584_0035484 3300036712 Bacteria 3700
398 Ga0373925_0063040 3300037068 Bacteria 2788
399 Ga0395899_0046543 3300037312 Bacteria 3231
400 Ga0395900_0093217 3300037418 Bacteria 3094
401 Ga0395898_0031246 3300037466 Bacteria 5322
402 Ga0395905_0083973 3300037471 Bacteria 2983
403 Ga0436364_1147227 3300037853 Bacteria 15254
404 Ga0395901_0147037 3300038443 Bacteria 2477
405 Ga0395901_0235969 3300038443 Bacteria 1908
406 Ga0395901_0365199 3300038443 Bacteria 1488
407 Ga0400483_096861 3300039062 Bacteria 11837
408 Ga0400483_125468 3300039062 Bacteria 2320
409 Ga0400483_179808 3300039062 Bacteria 7405
410 Ga0400483_190110 3300039062 Bacteria 3353
411 Ga0436365_1377443 3300039437 Bacteria 2337
412 Ga0436365_1460570 3300039437 Bacteria 1251
413 Ga0436360_1004058 3300039438 Bacteria 2533
414 Ga0436363_0284479 3300039450 Bacteria 7963
415 Ga0436363_1203817 3300039450 Bacteria 1922
416 Ga0436362_1036474 3300039453 Bacteria 1275
417 Ga0451577_0064314 3300042876 Bacteria 3272
418 Ga0453683_0007217 3300044673 Bacteria 7574
419 Ga0466966_0075059 3300044684 Bacteria 2113
420 Ga0466961_0181974 3300044693 Bacteria 1305
421 Ga0466963_0152573 3300044694 Bacteria 1605
422 Ga0466963_0238552 3300044694 Bacteria 1275
423 Ga0453684_0000034 3300044712 Bacteria 728457
424 Ga0466971_0041032 3300044719 Bacteria 2079
425 Ga0466960_0154061 3300044901 Bacteria 1230
426 Ga0466959_0116579 3300045049 Bacteria 1902
427 Ga0451576_0112159 3300045051 Bacteria 2838
428 Ga0451576_0172774 3300045051 Bacteria 2256
429 Ga0451576_0459633 3300045051 Bacteria 1337
430 Ga0466967_0189709 3300045976 Bacteria 1942
431 Ga0466967_0190446 3300045976 Bacteria 1938
432 Ga0495603_0117333 3300046455 Bacteria 1551
433 Ga0495638_0031311 3300046460 Bacteria 3420
434 Ga0495641_0017322 3300046461 Bacteria 3757
435 Ga0495580_0123540 3300046472 Bacteria 1797
436 Ga0495594_0109952 3300046499 Bacteria 1554
437 Ga0495635_0085254 3300046663 Bacteria 2161
438 Ga0495672_0045227 3300047320 Bacteria 2636
439 Ga0495672_0079653 3300047320 Bacteria 1829
440 Ga0495684_0052610 3300047471 Bacteria 3108
441 Ga0496100_0069165 3300048903 Bacteria 2350
442 Ga0496100_0178622 3300048903 Bacteria 1534
443 Ga0496101_0079759 3300048904 Bacteria 2417
444 Ga0496103_0052121 3300048906 Bacteria 2534
445 Ga0496104_0529591 3300048907 Bacteria 1089
446 Ga0496105_0109898 3300048908 Bacteria 2275
447 Ga0496105_0123945 3300048908 Bacteria 2130
448 Ga0496105_0313878 3300048908 Bacteria 1258
449 Ga0496106_0002831 3300048909 Bacteria 12867
450 Ga0496106_0067458 3300048909 Bacteria 2727
451 Ga0496106_0171508 3300048909 Bacteria 1720
452 Ga0496106_0182353 3300048909 Bacteria 1667
453 Ga0496107_0011812 3300048910 Bacteria 6097
454 Ga0496109_0001241 3300048912 Bacteria 21153
455 Ga0496109_0067985 3300048912 Bacteria 3265
456 Ga0496109_0084196 3300048912 Bacteria 2933
457 Ga0496109_0123646 3300048912 Bacteria 2412
458 Ga0496110_0000066 3300048913 Bacteria 52504
459 Ga0496110_0102830 3300048913 Bacteria 2562
460 Ga0496110_0672140 3300048913 Bacteria 936
461 Ga0496111_0002543 3300048914 Bacteria 11021
462 Ga0496112_0006363 3300048915 Bacteria 10365
463 Ga0496112_0012946 3300048915 Bacteria 7686
464 Ga0496112_0094429 3300048915 Bacteria 2961
465 Ga0496113_0090658 3300048916 Bacteria 2355
466 Ga0496114_0036253 3300048917 Unclassified 4076
467 Ga0496114_0100345 3300048917 Bacteria 2470
468 Ga0496114_0573721 3300048917 Bacteria 996
469 Ga0496115_0006554 3300048918 Bacteria 8533
470 Ga0496119_0153456 3300048922 Bacteria 1232
471 Ga0501031_0013579 3300049568 Bacteria 5307
472 Ga0501031_0146983 3300049568 Bacteria 1540
473 Ga0501033_0043148 3300049570 Bacteria 3359
474 Ga0501033_0105228 3300049570 Bacteria 2057
475 Ga0501036_0006081 3300049572 Bacteria 9793
476 Ga0501037_0032221 3300049573 Bacteria 3869
477 Ga0501038_0060805 3300049574 Bacteria 3232
478 Ga0501038_0207594 3300049574 Bacteria 1569
479 Ga0501038_0311842 3300049574 Bacteria 1232
480 Ga0501039_0007490 3300049575 Bacteria 8335
481 Ga0501039_0039185 3300049575 Bacteria 3660
482 Ga0501039_0314234 3300049575 Bacteria 1232
483 Ga0501039_0417359 3300049575 Bacteria 1054
484 Ga0501040_0016627 3300049576 Bacteria 4875
485 Ga0501040_0024006 3300049576 Bacteria 4091
486 Ga0501041_0022721 3300049577 Bacteria 3757
487 Ga0501041_0158776 3300049577 Bacteria 1413
488 Ga0501042_0056610 3300049578 Bacteria 2798
489 Ga0501042_0130591 3300049578 Bacteria 1810
490 Ga0501043_0236464 3300049579 Bacteria 1410
491 Ga0501046_0015405 3300049580 Bacteria 6425
492 Ga0501046_0024869 3300049580 Bacteria 4906
493 Ga0501046_0090576 3300049580 Bacteria 2353
494 Ga0501047_0189043 3300049581 Bacteria 1923
495 Ga0501048_0014882 3300049582 Bacteria 5753
496 Ga0501048_0063701 3300049582 Bacteria 2607
497 Ga0501048_0078705 3300049582 Bacteria 2327
498 Ga0501048_0141576 3300049582 Bacteria 1701
499 Ga0501067_0019176 3300049583 Bacteria 3786
500 Ga0501068_0165836 3300049584 Bacteria 1393
501 Ga0501069_0007081 3300049585 Bacteria 5872
502 Ga0501070_0050044 3300049586 Bacteria 3469
503 Ga0501070_0257192 3300049586 Bacteria 1428
504 Ga0501071_0005657 3300049587 Bacteria 8059
505 Ga0501071_0070802 3300049587 Bacteria 2541
506 Ga0501072_0053888 3300049588 Bacteria 3168
507 Ga0501072_0073924 3300049588 Bacteria 2695
508 Ga0501072_0405333 3300049588 Bacteria 1081
509 Ga0501073_0173982 3300049589 Bacteria 1490
510 Ga0501074_0022782 3300049590 Bacteria 4553
511 Ga0501074_0082400 3300049590 Bacteria 2307
512 Ga0501074_0102107 3300049590 Bacteria 2053
513 Ga0501075_0007661 3300049591 Bacteria 7493
514 Ga0501075_0085679 3300049591 Bacteria 2387
515 Ga0501076_0002745 3300049592 Bacteria 12197
516 Ga0501076_0015131 3300049592 Bacteria 5825
517 Ga0501076_0210990 3300049592 Bacteria 1587
518 Ga0501077_0049758 3300049593 Bacteria 2663
519 Ga0501079_0054011 3300049741 Bacteria 3099
520 Ga0501080_0010135 3300049742 Bacteria 8620
521 Ga0501080_0054127 3300049742 Bacteria 3738
522 Ga0501080_0071040 3300049742 Bacteria 3238
523 Ga0501080_0289736 3300049742 Bacteria 1487
524 Ga0501081_0013315 3300049743 Bacteria 5410
525 Ga0501081_0028166 3300049743 Bacteria 3790
526 Ga0501081_0047001 3300049743 Bacteria 2968
527 Ga0501081_0126217 3300049743 Bacteria 1825
528 Ga0501081_0347730 3300049743 Bacteria 1092
529 Ga0501035_0142692 3300049822 Bacteria 2081
530 Ga0501035_0274575 3300049822 Bacteria 1426
531 Ga0501044_0026895 3300049823 Bacteria 6088
532 Ga0501044_0114778 3300049823 Bacteria 2699
533 Ga0501045_0030846 3300049824 Bacteria 3881
534 Ga0501045_0114867 3300049824 Bacteria 1997
535 Ga0501045_0173103 3300049824 Bacteria 1608
536 Ga0501045_0405428 3300049824 Bacteria 1015
537 nmdc:mga05p37_135263_c1 3300050507 Bacteria 3023
538 nmdc:mga05p37_225432_c1 3300050507 Bacteria 2260
539 nmdc:mga06r32_110846_c1 3300050510 Bacteria 2700
540 nmdc:mga06r32_6266_c1 3300050510 Bacteria 10679
541 nmdc:mga08y16_400943_c1 3300050511 Bacteria 1404
542 nmdc:mga0rr50_318579_c1 3300050513 Bacteria 1303
543 Ga0500647_0105044 3300053091 Bacteria 1347
544 Ga0500566_0013764 3300053094 Bacteria 4759
545 Ga0500640_001729 3300053095 Bacteria 6818
546 Ga0500554_000423 3300053102 Bacteria 8887
547 Ga0500572_001285 3300053111 Bacteria 7022
548 Ga0500595_000116 3300053119 Bacteria 53428
549 Ga0500595_021955 3300053119 Bacteria 2270
550 Ga0500559_0004013 3300053136 Bacteria 7072
551 Ga0500616_0020696 3300053153 Bacteria 3695
552 Ga0501084_0046959 3300054114 Bacteria 3617
553 Ga0501082_0060343 3300060353 Bacteria 3266
554 Ga0501082_0064364 3300060353 Bacteria 3158
555 Ga0501082_0186619 3300060353 Bacteria 1804
556 Ga0501082_0210404 3300060353 Bacteria 1692
557 Ga0501082_0352335 3300060353 Bacteria 1283
558 Ga0530510_0038062 3300061734 Bacteria 3472
559 Ga0530510_0080529 3300061734 Bacteria 2370
560 2508733619 2508501050 Bacteria 9633614
561 2509079666 2508501114 Bacteria 7082538
562 2776261792 2775506901 Bacteria 9631051
563 2819577010 2818991442 Bacteria 8318214
564 2821142775 2821136567 Bacteria 8080116
565 2835314344 2835312727 Bacteria 7413381
566 2867350218 2867346516 Bacteria 7608576
567 2882456991 2882456835 Bacteria 6863978
568 2894025832 2894023352 Bacteria 5167372
569 2895429327 2895427314 Bacteria 13147766
570 2904473654 2904467357 Bacteria 8057758
571 3006323778 3006321560 Bacteria 8247479
572 8054283054 8054280661 Bacteria 4232245
573 Ga0070676_10017334
574 JGI24736J21556_1000279
575 JGI24735J21928_10023728
576 Ga0065712_10090974
577 Ga0070658_10001042
578 Ga0070658_10012945
579 Ga0070658_10053234
580 Ga0070658_10081292
581 Ga0070658_10091352
582 Ga0070658_10150313
583 Ga0070658_10189668
584 Ga0070683_100010290
585 Ga0070683_100037538
586 Ga0070683_100046233
587 Ga0070683_100488749
588 Ga0070670_100025200
589 Ga0070670_100030671
590 Ga0070670_100076391
591 Ga0070670_100182126
592 Ga0068869_100282570
593 Ga0070666_10000649
594 Ga0070666_10037051
595 Ga0070666_10225650
596 Ga0070680_100003554
597 Ga0070680_100010197
598 Ga0070680_100020880
599 Ga0070680_100071346
600 Ga0070680_100137789
601 Ga0070680_100242587
602 Ga0070680_100282145
603 Ga0068868_100012312
604 Ga0070660_100000853
605 Ga0070660_100025035
606 Ga0070660_100042156
607 Ga0070660_100049519
608 Ga0070661_100018088
609 Ga0070661_100045915
610 Ga0070661_100302318
611 Ga0070669_100154898
612 Ga0070675_100009650
613 Ga0070675_100034084
614 Ga0070675_100082710
615 Ga0070671_100000784
616 Ga0070671_100003742
617 Ga0070671_100007039
618 Ga0070671_100008932
619 Ga0070671_100024859
620 Ga0070671_100048248
621 Ga0070674_100002702
622 Ga0070674_100004451
623 Ga0070673_100000680
624 Ga0070673_100354725
625 Ga0070673_100542644
626 Ga0070659_100001250
627 Ga0070659_100005417
628 Ga0070659_100069052
629 Ga0070659_100069957
630 Ga0070659_100307571
631 Ga0070667_100002348
632 Ga0070667_100004770
633 Ga0070667_100015853
634 Ga0070667_100323510
635 Ga0070714_100022769
636 Ga0070714_100084984
637 Ga0070714_100124486
638 Ga0070713_100078404
639 Ga0070713_100129490
640 Ga0070701_10244463
641 Ga0070708_100025867
642 Ga0070663_100004077
643 Ga0070663_100011542
644 Ga0070663_100014439
645 Ga0070663_100015099
646 Ga0070663_100025259
647 Ga0070663_100117556
648 Ga0070678_100043496
649 Ga0070662_100003775
650 Ga0070662_100004550
651 Ga0070662_100188297
652 Ga0070681_10003495
653 Ga0070681_10015563
654 Ga0068867_100003830
655 Ga0068867_100077920
656 Ga0070706_100023207
657 Ga0070707_100065791
658 Ga0070679_100038156
659 Ga0070679_100057672
660 Ga0070679_100280185
661 Ga0070684_100000649
662 Ga0068853_100000075
663 Ga0068853_100007441
664 Ga0068853_100024622
665 Ga0070672_100002477
666 Ga0070665_100000053
667 Ga0070665_100003133
668 Ga0070665_100012148
669 Ga0070665_100015381
670 Ga0070665_100042126
671 Ga0070665_100129211
672 Ga0068855_100000596
673 Ga0068855_100000844
674 Ga0068855_100040677
675 Ga0068855_100053781
676 Ga0068855_100120381
677 Ga0068855_100144512
678 Ga0068855_100206516
679 Ga0068855_100208337
680 Ga0070664_100000211
681 Ga0070664_100004256
682 Ga0070664_100007799
683 Ga0070664_100033590
684 Ga0070664_100056661
685 Ga0070664_100120041
686 Ga0070664_100257555
687 Ga0068857_100100024
688 Ga0068857_100138289
689 Ga0068854_100055791
690 Ga0068854_100058608
691 Ga0068856_100000194
692 Ga0068856_100000267
693 Ga0068856_100000880
694 Ga0068856_100281587
695 Ga0068856_100359175
696 Ga0068852_100001163
697 Ga0068852_100005589
698 Ga0068859_100020691
699 Ga0068859_100179310
700 Ga0068864_100000982
701 Ga0068864_100020168
702 Ga0068864_100053121
703 Ga0068861_100163693
704 Ga0068851_10001553
705 Ga0068851_10003564
706 Ga0068851_10026955
707 Ga0068870_10019997
708 Ga0068863_100010319
709 Ga0068863_100010833
710 Ga0068863_100420489
711 Ga0068858_100555030
712 Ga0068860_100076202
713 Ga0068862_100084433
714 Ga0081538_10003771
715 Ga0097621_100000352
716 Ga0097621_100047270
717 Ga0068871_100030967
718 Ga0068871_100270317
719 Ga0075428_100409196
720 Ga0075431_100006520
721 Ga0075431_100182002
722 Ga0068865_100138322
723 Ga0097620_100020692
724 Ga0097620_100179305
725 Ga0075435_100169259
726 Ga0105240_10020233
727 Ga0105240_10085116
728 Ga0111539_10089792
729 Ga0111539_10211520
730 Ga0114129_10013522
731 Ga0105248_10019891
732 Ga0105248_10074608
733 Ga0105248_10105196
734 Ga0105248_10309046
735 Ga0105237_10037922
736 Ga0105239_10262749
737 Ga0157373_10001644
738 Ga0157373_10013781
739 Ga0157373_10226138
740 Ga0157373_10252623
741 Ga0157371_10001047
742 Ga0157371_10012085
743 Ga0157371_10041379
744 Ga0157370_10326945
745 Ga0157369_10102883
746 Ga0157369_10131616
747 Ga0157369_10150824
748 Ga0157369_10328226
749 Ga0157374_10006781
750 Ga0157378_10002818
751 Ga0157378_10015717
752 Ga0163162_10000237
753 Ga0163162_10002053
754 Ga0163162_10026987
755 Ga0163162_10100275
756 Ga0157372_10001680
757 Ga0157372_10003409
758 Ga0157372_10014482
759 Ga0157372_10083935
760 Ga0157375_10000599
761 Ga0157375_10005819
762 Ga0157375_10018386
763 Ga0157375_10245432
764 Ga0157375_10315996
765 Ga0163163_10000703
766 Ga0163163_10009778
767 Ga0163163_10013548
768 Ga0163163_10453623
769 Ga0157380_10104587
770 Ga0157380_10546740
771 Ga0157379_10107742
772 Ga0157376_10002711
773 Ga0157376_10583939
774 Ga0182005_1000635
775 Ga0163161_10015722
776 Ga0163161_10121683
777 Ga0197907_10533111
778 Ga0206353_10072566
779 Ga0213873_10052625
780 Ga0213874_10009790
781 Ga0213876_10014540
782 Ga0213876_10053992
783 Ga0213876_10061722
784 Ga0213875_10001475
785 Ga0224712_10077694
786 Ga0209436_101738
787 Ga0207656_10001106
788 Ga0207682_10001861
789 Ga0207688_10058085
790 Ga0207680_10007168
791 Ga0207680_10049740
792 Ga0207647_10002313
793 Ga0207645_10011147
794 Ga0207645_10173004
795 Ga0207643_10038521
796 Ga0207705_10002221
797 Ga0207705_10026426
798 Ga0207705_10047778
799 Ga0207705_10090924
800 Ga0207705_10120999
801 Ga0207705_10280893
802 Ga0207654_10066171
803 Ga0207707_10025122
804 Ga0207707_10074823
805 Ga0207707_10076135
806 Ga0207707_10201633
807 Ga0207695_10211624
808 Ga0207695_10298183
809 Ga0207660_10001577
810 Ga0207660_10002299
811 Ga0207660_10027321
812 Ga0207660_10056099
813 Ga0207660_10338851
814 Ga0207657_10000302
815 Ga0207657_10001180
816 Ga0207657_10001248
817 Ga0207657_10028271
818 Ga0207657_10077425
819 Ga0207649_10042269
820 Ga0207649_10174233
821 Ga0207652_10006598
822 Ga0207652_10006980
823 Ga0207652_10110685
824 Ga0207652_10232296
825 Ga0207646_10053967
826 Ga0207646_10161281
827 Ga0207681_10099670
828 Ga0207694_10015696
829 Ga0207694_10274140
830 Ga0207650_10047717
831 Ga0207650_10058955
832 Ga0207650_10138234
833 Ga0207659_10008605
834 Ga0207659_10109388
835 Ga0207700_10081666
836 Ga0207700_10105382
837 Ga0207664_10062680
838 Ga0207664_10116858
839 Ga0207644_10000181
840 Ga0207644_10006287
841 Ga0207644_10008868
842 Ga0207644_10022159
843 Ga0207644_10159124
844 Ga0207690_10000937
845 Ga0207690_10031162
846 Ga0207690_10190652
847 Ga0207706_10000144
848 Ga0207706_10007683
849 Ga0207706_10010098
850 Ga0207706_10026892
851 Ga0207706_10163236
852 Ga0207670_10221097
853 Ga0207669_10031982
854 Ga0207669_10041855
855 Ga0207704_10111167
856 Ga0207704_10329211
857 Ga0207691_10000384
858 Ga0207691_10026376
859 Ga0207711_10015244
860 Ga0207711_10027487
861 Ga0207711_10092656
862 Ga0207661_10000429
863 Ga0207661_10068457
864 Ga0207661_10259884
865 Ga0207679_10003032
866 Ga0207679_10009299
867 Ga0207679_10041134
868 Ga0207679_10085425
869 Ga0207667_10001020
870 Ga0207667_10001692
871 Ga0207667_10008148
872 Ga0207667_10017050
873 Ga0207667_10073615
874 Ga0207667_10222566
875 Ga0207651_10006757
876 Ga0207651_10024540
877 Ga0207668_10022843
878 Ga0207640_10144035
879 Ga0207640_10186868
880 Ga0207658_10002480
881 Ga0207658_10011563
882 Ga0207658_10066934
883 Ga0207677_10007715
884 Ga0207703_10142517
885 Ga0207703_10363789
886 Ga0207703_10466902
887 Ga0207639_10000012
888 Ga0207639_10016221
889 Ga0207639_10151185
890 Ga0207639_10175578
891 Ga0207678_10017824
892 Ga0207678_10023120
893 Ga0207678_10023980
894 Ga0207678_10028574
895 Ga0207678_10086288
896 Ga0207678_10107361
897 Ga0207702_10002214
898 Ga0207702_10007484
899 Ga0207702_10010745
900 Ga0207702_10265959
901 Ga0207641_10037635
902 Ga0207648_10004895
903 Ga0207648_10107044
904 Ga0207676_10003014
905 Ga0207676_10052381
906 Ga0207674_10000251
907 Ga0207674_10024012
908 Ga0207674_10049652
909 Ga0207674_10087928
910 Ga0207674_10119532
911 Ga0207674_10275345
912 Ga0207674_10381855
913 Ga0207675_100200000
914 Ga0207675_100236154
915 Ga0207683_10000306
916 Ga0207683_10042484
917 Ga0207683_10079910
918 Ga0207683_10350603
919 Ga0207698_10024638
920 Ga0207698_10055710
921 Ga0207698_10083116
922 Ga0209371_1001592
923 Ga0209971_1010319
924 Ga0268266_10000001
925 Ga0268266_10007004
926 Ga0268266_10013691
927 Ga0268266_10095567
928 Ga0268265_10079289
929 Ga0268265_10282164
930 Ga0268264_10198302
931 Ga0265323_10004413
932 Ga0268256_1001375
933 Ga0316183_1105030
934 Ga0265339_10006549
935 Ga0265331_10006374
936 Ga0265331_10063586
937 Ga0265316_10275517
938 Ga0307513_10089885
939 Ga0307509_10034082
940 Ga0307509_10075149
941 Ga0307408_100037986
942 Ga0307408_100063760
943 Ga0307408_100241168
944 Ga0265313_10000325
945 Ga0265314_10055490
946 Ga0316576_10160076
947 Ga0307413_10010918
948 Ga0307410_10011114
949 Ga0307410_10033359
950 Ga0307410_10098258
951 Ga0307406_10107722
952 Ga0307407_10002242
953 Ga0307409_100004885
954 Ga0307409_100026205
955 Ga0307416_100002682
956 Ga0307416_100047963
957 Ga0307416_100408439
958 Ga0307414_10074008
959 Ga0307411_10000643
960 Ga0307411_10052546
961 Ga0307415_100042287
962 Ga0307507_10128156
963 Ga0373926_0034014
964 Ga0373954_0039250
965 Ga0373935_0077960
966 Ga0373947_0252065
967 Ga0373937_0183538
968 Ga0373937_0491503
969 Ga0316584_0035484
970 Ga0373925_0063040
971 Ga0395899_0046543
972 Ga0395900_0093217
973 Ga0395898_0031246
974 Ga0395905_0083973
975 Ga0436364_1147227
976 Ga0395901_0147037
977 Ga0395901_0235969
978 Ga0395901_0365199
979 Ga0400483_096861
980 Ga0400483_125468
981 Ga0400483_179808
982 Ga0400483_190110
983 Ga0436365_1377443
984 Ga0436365_1460570
985 Ga0436360_1004058
986 Ga0436363_0284479
987 Ga0436363_1203817
988 Ga0436362_1036474
989 Ga0451577_0064314
990 Ga0453683_0007217
991 Ga0466966_0075059
992 Ga0466961_0181974
993 Ga0466963_0152573
994 Ga0466963_0238552
995 Ga0453684_0000034
996 Ga0466971_0041032
997 Ga0466960_0154061
998 Ga0466959_0116579
999 Ga0451576_0112159
1000 Ga0451576_0172774
1001 Ga0451576_0459633
1002 Ga0466967_0189709
1003 Ga0466967_0190446
1004 Ga0495603_0117333
1005 Ga0495638_0031311
1006 Ga0495641_0017322
1007 Ga0495580_0123540
1008 Ga0495594_0109952
1009 Ga0495635_0085254
1010 Ga0495672_0045227
1011 Ga0495672_0079653
1012 Ga0495684_0052610
1013 Ga0496100_0069165
1014 Ga0496100_0178622
1015 Ga0496101_0079759
1016 Ga0496103_0052121
1017 Ga0496104_0529591
1018 Ga0496105_0109898
1019 Ga0496105_0123945
1020 Ga0496105_0313878
1021 Ga0496106_0002831
1022 Ga0496106_0067458
1023 Ga0496106_0171508
1024 Ga0496106_0182353
1025 Ga0496107_0011812
1026 Ga0496109_0001241
1027 Ga0496109_0067985
1028 Ga0496109_0084196
1029 Ga0496109_0123646
1030 Ga0496110_0000066
1031 Ga0496110_0102830
1032 Ga0496110_0672140
1033 Ga0496111_0002543
1034 Ga0496112_0006363
1035 Ga0496112_0012946
1036 Ga0496112_0094429
1037 Ga0496113_0090658
1038 Ga0496114_0036253
1039 Ga0496114_0100345
1040 Ga0496114_0573721
1041 Ga0496115_0006554
1042 Ga0496119_0153456
1043 Ga0501031_0013579
1044 Ga0501031_0146983
1045 Ga0501033_0043148
1046 Ga0501033_0105228
1047 Ga0501036_0006081
1048 Ga0501037_0032221
1049 Ga0501038_0060805
1050 Ga0501038_0207594
1051 Ga0501038_0311842
1052 Ga0501039_0007490
1053 Ga0501039_0039185
1054 Ga0501039_0314234
1055 Ga0501039_0417359
1056 Ga0501040_0016627
1057 Ga0501040_0024006
1058 Ga0501041_0022721
1059 Ga0501041_0158776
1060 Ga0501042_0056610
1061 Ga0501042_0130591
1062 Ga0501043_0236464
1063 Ga0501046_0015405
1064 Ga0501046_0024869
1065 Ga0501046_0090576
1066 Ga0501047_0189043
1067 Ga0501048_0014882
1068 Ga0501048_0063701
1069 Ga0501048_0078705
1070 Ga0501048_0141576
1071 Ga0501067_0019176
1072 Ga0501068_0165836
1073 Ga0501069_0007081
1074 Ga0501070_0050044
1075 Ga0501070_0257192
1076 Ga0501071_0005657
1077 Ga0501071_0070802
1078 Ga0501072_0053888
1079 Ga0501072_0073924
1080 Ga0501072_0405333
1081 Ga0501073_0173982
1082 Ga0501074_0022782
1083 Ga0501074_0082400
1084 Ga0501074_0102107
1085 Ga0501075_0007661
1086 Ga0501075_0085679
1087 Ga0501076_0002745
1088 Ga0501076_0015131
1089 Ga0501076_0210990
1090 Ga0501077_0049758
1091 Ga0501079_0054011
1092 Ga0501080_0010135
1093 Ga0501080_0054127
1094 Ga0501080_0071040
1095 Ga0501080_0289736
1096 Ga0501081_0013315
1097 Ga0501081_0028166
1098 Ga0501081_0047001
1099 Ga0501081_0126217
1100 Ga0501081_0347730
1101 Ga0501035_0142692
1102 Ga0501035_0274575
1103 Ga0501044_0026895
1104 Ga0501044_0114778
1105 Ga0501045_0030846
1106 Ga0501045_0114867
1107 Ga0501045_0173103
1108 Ga0501045_0405428
1109 nmdc:mga05p37_135263_c1
1110 nmdc:mga05p37_225432_c1
1111 nmdc:mga06r32_110846_c1
1112 nmdc:mga06r32_6266_c1
1113 nmdc:mga08y16_400943_c1
1114 nmdc:mga0rr50_318579_c1
1115 Ga0500647_0105044
1116 Ga0500566_0013764
1117 Ga0500640_001729
1118 Ga0500554_000423
1119 Ga0500572_001285
1120 Ga0500595_000116
1121 Ga0500595_021955
1122 Ga0500559_0004013
1123 Ga0500616_0020696
1124 Ga0501084_0046959
1125 Ga0501082_0060343
1126 Ga0501082_0064364
1127 Ga0501082_0186619
1128 Ga0501082_0210404
1129 Ga0501082_0352335
1130 Ga0530510_0038062
1131 Ga0530510_0080529
1132 2508733619
1133 2509079666
1134 2776261792
1135 2819577010
1136 2821142775
1137 2835314344
1138 2867350218
1139 2882456991
1140 2894025832
1141 2895429327
1142 2904473654
1143 3006323778
1144 8054283054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

36

330

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9323 3 304
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9288 3 302
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9274 1 305
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9267 1 306
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9227 2 308
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9528 1 317 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.944 4 324 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9432 1 216 3.20.20.100
3n2tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9323 3 304 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9299 4 324 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9983 122 205 GO:0004033
GO:0005737
AF-Q0JE28-F1-model_v4 Os04g0338100 protein 0.9928 106 190
AF-J9FJ99-F1-model_v4 Oxidoreductase, aldo/keto reductase family 0.9723 74 208 GO:0004033
GO:0005737
AF-A0A3M6GJV6-F1-model_v4 Aldo/keto reductase family oxidoreductase 0.9681 2 258 GO:0004033
GO:0005737
AF-A0A2S7K5Z4-F1-model_v4 Aldo/keto reductase 0.9654 1 325 GO:0004033
GO:0005737

Map