F465176

General Info

Members Datasets Scaffolds Average Seq Length
573 372 514 553

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10034057|Ga0105244_100340572
Length 598
Sequence MAMISRLSWPVSSSLEGSFERGRPKMHGVRTAERFLVGYIDVSGISYSLADGRPLLDDVSFRVGEGSVSALIGANGAGKSTLLRIIRGDLKPDSGSIGIDGGLGVMDQFVGHVRDERTVRDLLVSVAPTAVRAAAEGLTAAEDAILERDELDTQLAYATALGEYADAGGYDHEVVWDHCTIAALGVPFERAQYRGLRSLSGGEQKRLALEALLRGPEQVLLLDEPDNYLDVPAKRWLEAELRATPKTXXXVSHDRELLANAADRIITLELGAAGNTVWTHGGGFGGYQQARDDRMARLEELRRRWDEEHAKLKALVLRMWEKAKYNSDVAPAYRAAQTRLAKFEEAGPPQLRPREQNVSMRLTGARTGRRVVECFSLELSGLMRPFDSEIWFGERIAVLGSNGSGKSHFLRLLAAGGTDPDPSAGHLASADQVGTPVAHTGVAKLGARVVPGLFAQAHEHPELIGRTLLEILHRGDDFRTGLPRDAASRVLDRYGLAGSSEQTFESLSGGQQARLQILLLELSGATLLLLDEPTDNLDLVSAEALEEGLRGFEGTVIAVTHDRWFARGFDRFLVFGSDGTVYESDTAVWDESRVTRSR

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221613 Oerskovia sp. Root22 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
8 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
9 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
10 2643221711 Terrabacter sp. Root85 Isolate Unclassified
11 2643221721 Oerskovia sp. Root918 Isolate Unclassified
12 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
13 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
14 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
15 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
16 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
17 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
18 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
19 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
20 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
21 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
22 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
23 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
24 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
25 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
26 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
27 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
28 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
29 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
30 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
31 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
32 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
33 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
34 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
35 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
36 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
37 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
38 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
39 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
40 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
41 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
42 2891562705 Microbispora tritici MT50 Isolate Unclassified
43 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
44 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
45 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
46 2922554459 Rhodococcus sp. 66b Isolate Unclassified
47 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
48 2928153084 Leifsonia sp. 563 Isolate Unclassified
49 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
50 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
51 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
52 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
53 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
54 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
55 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
56 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
57 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
58 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
59 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
60 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
63 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
64 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
65 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
66 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
67 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
71 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
76 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
84 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
88 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
89 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
90 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
91 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
164 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
165 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
166 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
172 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
231 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
267 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
268 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
269 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
270 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
365 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
366 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
371 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
372 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.18
Metatranscriptomes 0.52
Isolates 10.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0
Rhizoplane 6.98
Rhizosphere 74.69
Stem 0
Stem Tuber 0.17
Unclassified 11.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10003351 3300002077 Bacteria 3290
2 JGI24034J26672_10002339 3300002239 Bacteria 2600
3 JGI24742J22300_10004839 3300002244 Bacteria 2211
4 JGI25164J39214_1001647 3300002772 Bacteria 4619
5 JGI25165J46597_1000061 3300003214 Bacteria 208362
6 Ga0006562J51391_1002516 3300003578 Bacteria 10990
7 Ga0006562J51391_1002517 3300003578 Bacteria 5030
8 Ga0055539_1000005 3300003752 Bacteria 609598
9 Ga0055533_1000001 3300003756 Bacteria 1863437
10 Ga0055525_1001046 3300003759 Bacteria 7185
11 Ga0055525_1001748 3300003759 Bacteria 3121
12 Ga0055527_1000017 3300003760 Bacteria 242362
13 Ga0055542_1000044 3300003762 Bacteria 206982
14 Ga0055529_1000279 3300003763 Bacteria 60946
15 Ga0070676_10010227 3300005328 Bacteria 5089
16 Ga0068869_100022252 3300005334 Bacteria 4366
17 Ga0070680_100041296 3300005336 Bacteria 3740
18 Ga0070682_100030501 3300005337 Bacteria 3255
19 Ga0068868_100007142 3300005338 Bacteria 7938
20 Ga0070660_100044982 3300005339 Bacteria 3378
21 Ga0070660_100075211 3300005339 Bacteria 2644
22 Ga0070689_100056454 3300005340 Bacteria 3044
23 Ga0070691_10001503 3300005341 Bacteria 10012
24 Ga0070687_100043954 3300005343 Bacteria 2274
25 Ga0070668_100012150 3300005347 Bacteria 6413
26 Ga0070668_100023202 3300005347 Bacteria 4692
27 Ga0070669_100020467 3300005353 Bacteria 4726
28 Ga0070671_100025657 3300005355 Bacteria 4838
29 Ga0070688_100011461 3300005365 Bacteria 4926
30 Ga0070659_100001112 3300005366 Bacteria 19613
31 Ga0070659_100047953 3300005366 Bacteria 3353
32 Ga0070659_100101810 3300005366 Bacteria 2312
33 Ga0070667_100058732 3300005367 Bacteria 3252
34 Ga0070703_10013806 3300005406 Bacteria 2297
35 Ga0070709_10003834 3300005434 Bacteria 8092
36 Ga0070714_100001322 3300005435 Bacteria 17907
37 Ga0070714_100005084 3300005435 Bacteria 10009
38 Ga0070714_100044804 3300005435 Bacteria 3746
39 Ga0070714_100089560 3300005435 Bacteria 2694
40 Ga0070714_100110539 3300005435 Bacteria 2433
41 Ga0070713_100001527 3300005436 Bacteria 14772
42 Ga0070710_10001526 3300005437 Bacteria 10942
43 Ga0070710_10003868 3300005437 Bacteria 7083
44 Ga0070701_10001376 3300005438 Bacteria 8979
45 Ga0070711_100001298 3300005439 Bacteria 13594
46 Ga0070700_100035827 3300005441 Bacteria 3006
47 Ga0070694_100003044 3300005444 Bacteria 9988
48 Ga0070663_100008709 3300005455 Bacteria 6254
49 Ga0070678_100003051 3300005456 Bacteria 9279
50 Ga0070681_10000092 3300005458 Bacteria 66067
51 Ga0068867_100018245 3300005459 Bacteria 4986
52 Ga0070685_10016348 3300005466 Bacteria 3953
53 Ga0070698_100015325 3300005471 Bacteria 8101
54 Ga0070679_100000009 3300005530 Bacteria 191579
55 Ga0070679_100015989 3300005530 Bacteria 7226
56 Ga0070679_100040593 3300005530 Bacteria 4629
57 Ga0070684_100050208 3300005535 Bacteria 3622
58 Ga0070684_100086763 3300005535 Bacteria 2778
59 Ga0068853_100015450 3300005539 Bacteria 6272
60 Ga0070696_100055789 3300005546 Bacteria 2755
61 Ga0070693_100004959 3300005547 Bacteria 6355
62 Ga0070665_100059230 3300005548 Bacteria 3839
63 Ga0070665_100136751 3300005548 Bacteria 2453
64 Ga0070704_100011383 3300005549 Bacteria 5450
65 Ga0068855_100079606 3300005563 Bacteria 3800
66 Ga0068854_100003477 3300005578 Bacteria 9835
67 Ga0068856_100048778 3300005614 Bacteria 4174
68 Ga0070702_100003129 3300005615 Bacteria 7331
69 Ga0070702_100032412 3300005615 Bacteria 2867
70 Ga0068859_100017732 3300005617 Bacteria 7158
71 Ga0068866_10001286 3300005718 Bacteria 10867
72 Ga0068863_100175277 3300005841 Bacteria 2058
73 Ga0068858_100000016 3300005842 Bacteria 193130
74 Ga0068858_100012623 3300005842 Bacteria 7964
75 Ga0068860_100039609 3300005843 Bacteria 4507
76 Ga0068860_100068368 3300005843 Bacteria 3375
77 Ga0081455_10001393 3300005937 Bacteria 29861
78 Ga0081455_10010089 3300005937 Bacteria 9630
79 Ga0081455_10012756 3300005937 Bacteria 8357
80 Ga0081455_10014109 3300005937 Bacteria 7854
81 Ga0081538_10000264 3300005981 Bacteria 59881
82 Ga0081539_10000238 3300005985 Bacteria 129119
83 Ga0081539_10002050 3300005985 Bacteria 30294
84 Ga0070717_10000413 3300006028 Bacteria 27333
85 Ga0070717_10013074 3300006028 Bacteria 6343
86 Ga0075363_100021019 3300006048 Bacteria 3280
87 Ga0075364_10007063 3300006051 Bacteria 6638
88 Ga0075364_10046864 3300006051 Bacteria 2815
89 Ga0075432_10001019 3300006058 Bacteria 8891
90 Ga0075432_10001893 3300006058 Bacteria 6936
91 Ga0070715_10001773 3300006163 Bacteria 6420
92 Ga0070716_100000451 3300006173 Bacteria 16997
93 Ga0070716_100007313 3300006173 Bacteria 5433
94 Ga0070712_100011966 3300006175 Bacteria 5515
95 Ga0070712_100017360 3300006175 Bacteria 4659
96 Ga0097621_100016649 3300006237 Bacteria 5564
97 Ga0075370_10061351 3300006353 Bacteria 2142
98 Ga0075428_100006889 3300006844 Bacteria 12625
99 Ga0075428_100010070 3300006844 Bacteria 10503
100 Ga0075430_100025796 3300006846 Bacteria 5001
101 Ga0075431_100010112 3300006847 Bacteria 9482
102 Ga0075431_100070801 3300006847 Bacteria 3598
103 Ga0075433_10001532 3300006852 Bacteria 17068
104 Ga0075434_100005228 3300006871 Bacteria 11791
105 Ga0075434_100006176 3300006871 Bacteria 10969
106 Ga0075429_100111723 3300006880 Bacteria 2388
107 Ga0068865_100005382 3300006881 Bacteria 7756
108 Ga0068865_100056359 3300006881 Bacteria 2738
109 Ga0075436_100010308 3300006914 Bacteria 6400
110 Ga0097620_100017732 3300006931 Bacteria 7158
111 Ga0075435_100016247 3300007076 Bacteria 5611
112 Ga0105244_10034057 3300009036 Bacteria 2684
113 Ga0105250_10018818 3300009092 Bacteria 2794
114 Ga0105240_10115403 3300009093 Bacteria 3242
115 Ga0105240_10194768 3300009093 Bacteria 2381
116 Ga0111539_10003621 3300009094 Bacteria 20353
117 Ga0111539_10003666 3300009094 Bacteria 20226
118 Ga0105245_10006958 3300009098 Bacteria 9919
119 Ga0105245_10013491 3300009098 Bacteria 7117
120 Ga0105245_10209850 3300009098 Bacteria 1874
121 Ga0105247_10003161 3300009101 Bacteria 10856
122 Ga0114129_10007034 3300009147 Bacteria 16018
123 Ga0114129_10024589 3300009147 Bacteria 8535
124 Ga0105243_10003243 3300009148 Bacteria 13268
125 Ga0105243_10011970 3300009148 Bacteria 6558
126 Ga0105241_10031704 3300009174 Bacteria 3958
127 Ga0105242_10013303 3300009176 Bacteria 6355
128 Ga0105242_10041559 3300009176 Bacteria 3709
129 Ga0105248_10000880 3300009177 Bacteria 33648
130 Ga0105248_10148538 3300009177 Bacteria 2644
131 Ga0105237_10052001 3300009545 Bacteria 4114
132 Ga0105237_10132497 3300009545 Bacteria 2487
133 Ga0105238_10052842 3300009551 Bacteria 4084
134 Ga0105249_10008124 3300009553 Bacteria 9150
135 Ga0105249_10017913 3300009553 Bacteria 6294
136 Ga0105239_10015491 3300010375 Bacteria 8446
137 Ga0105239_10078916 3300010375 Bacteria 3623
138 Ga0157370_10079955 3300013104 Bacteria 3078
139 Ga0157369_10054906 3300013105 Bacteria 4301
140 Ga0157369_10079172 3300013105 Bacteria 3520
141 Ga0171462_1001 3300013250 Bacteria 1135406
142 Ga0157374_10024151 3300013296 Bacteria 5447
143 Ga0157374_10051438 3300013296 Bacteria 3834
144 Ga0157378_10023725 3300013297 Bacteria 5396
145 Ga0163162_10017114 3300013306 Bacteria 7093
146 Ga0157372_10073041 3300013307 Bacteria 3866
147 Ga0157372_10252706 3300013307 Bacteria 2046
148 Ga0157375_10090767 3300013308 Bacteria 3115
149 Ga0157375_10131974 3300013308 Bacteria 2618
150 Ga0157377_10027722 3300014745 Bacteria 3044
151 Ga0157376_10035368 3300014969 Bacteria 4041
152 Ga0163161_10015432 3300017792 Bacteria 5326
153 Ga0163161_10020812 3300017792 Bacteria 4606
154 Ga0163161_10036458 3300017792 Bacteria 3521
155 Ga0206353_10350813 3300020082 Bacteria 4579
156 Ga0213874_10004103 3300021377 Bacteria 3291
157 Ga0213876_10000676 3300021384 Bacteria 24257
158 Ga0213876_10054335 3300021384 Bacteria 2115
159 Ga0213875_10049946 3300021388 Bacteria 1960
160 Ga0209674_100001 3300025226 Bacteria 4013750
161 Ga0209672_100039 3300025228 Bacteria 283064
162 Ga0209147_101049 3300025229 Bacteria 11708
163 Ga0209563_100001 3300025230 Bacteria 4013775
164 Ga0209563_100766 3300025230 Bacteria 9765
165 Ga0207427_100042 3300025231 Bacteria 254170
166 Ga0209437_101321 3300025233 Bacteria 6536
167 Ga0209258_101806 3300025242 Bacteria 6557
168 Ga0209646_1000088 3300025246 Bacteria 192345
169 Ga0209677_100001 3300025253 Bacteria 4013787
170 Ga0209148_1000004 3300025254 Bacteria 1844481
171 Ga0209233_1000001 3300025261 Bacteria 2992747
172 Ga0209455_1000117 3300025272 Bacteria 176940
173 Ga0207692_10002768 3300025898 Bacteria 6761
174 Ga0207642_10000683 3300025899 Bacteria 10441
175 Ga0207642_10016311 3300025899 Bacteria 2794
176 Ga0207710_10003996 3300025900 Bacteria 6503
177 Ga0207688_10001884 3300025901 Bacteria 11227
178 Ga0207688_10006738 3300025901 Bacteria 6249
179 Ga0207647_10046366 3300025904 Bacteria 2709
180 Ga0207699_10001501 3300025906 Bacteria 11075
181 Ga0207699_10037346 3300025906 Bacteria 2776
182 Ga0207705_10022908 3300025909 Bacteria 4453
183 Ga0207707_10000174 3300025912 Bacteria 66915
184 Ga0207695_10005496 3300025913 Bacteria 16776
185 Ga0207671_10118140 3300025914 Bacteria 2025
186 Ga0207693_10002722 3300025915 Bacteria 15309
187 Ga0207693_10004743 3300025915 Bacteria 11434
188 Ga0207693_10014595 3300025915 Bacteria 6312
189 Ga0207663_10001616 3300025916 Bacteria 10610
190 Ga0207663_10032315 3300025916 Bacteria 3106
191 Ga0207663_10101710 3300025916 Bacteria 1931
192 Ga0207662_10016120 3300025918 Bacteria 4213
193 Ga0207657_10026242 3300025919 Bacteria 5357
194 Ga0207649_10022947 3300025920 Bacteria 3608
195 Ga0207652_10000070 3300025921 Bacteria 109705
196 Ga0207646_10067741 3300025922 Bacteria 3187
197 Ga0207681_10114770 3300025923 Bacteria 1965
198 Ga0207694_10083319 3300025924 Bacteria 2515
199 Ga0207687_10004540 3300025927 Bacteria 9236
200 Ga0207687_10013434 3300025927 Bacteria 5345
201 Ga0207700_10002316 3300025928 Bacteria 10926
202 Ga0207664_10000417 3300025929 Bacteria 30395
203 Ga0207664_10003739 3300025929 Bacteria 10217
204 Ga0207664_10064969 3300025929 Bacteria 2920
205 Ga0207644_10035876 3300025931 Bacteria 3478
206 Ga0207690_10003341 3300025932 Bacteria 9588
207 Ga0207706_10012551 3300025933 Bacteria 7716
208 Ga0207706_10058426 3300025933 Bacteria 3397
209 Ga0207686_10009538 3300025934 Bacteria 5266
210 Ga0207709_10005768 3300025935 Bacteria 6996
211 Ga0207709_10029256 3300025935 Bacteria 3193
212 Ga0207709_10058672 3300025935 Bacteria 2393
213 Ga0207670_10037759 3300025936 Bacteria 3149
214 Ga0207669_10003377 3300025937 Bacteria 6902
215 Ga0207704_10015741 3300025938 Bacteria 3864
216 Ga0207665_10000320 3300025939 Bacteria 33314
217 Ga0207665_10005671 3300025939 Bacteria 8317
218 Ga0207665_10016216 3300025939 Bacteria 4892
219 Ga0207691_10036370 3300025940 Bacteria 4562
220 Ga0207711_10005166 3300025941 Bacteria 11061
221 Ga0207689_10068601 3300025942 Bacteria 2914
222 Ga0207667_10002042 3300025949 Bacteria 25307
223 Ga0207667_10150832 3300025949 Bacteria 2392
224 Ga0207667_10152961 3300025949 Bacteria 2374
225 Ga0207712_10009304 3300025961 Bacteria 6215
226 Ga0207712_10013614 3300025961 Bacteria 5216
227 Ga0207668_10029087 3300025972 Bacteria 3619
228 Ga0207668_10083760 3300025972 Bacteria 2321
229 Ga0207640_10013306 3300025981 Bacteria 4711
230 Ga0207658_10011153 3300025986 Bacteria 6119
231 Ga0207658_10088123 3300025986 Bacteria 2398
232 Ga0207677_10006998 3300026023 Bacteria 6206
233 Ga0207703_10000345 3300026035 Bacteria 49953
234 Ga0207639_10016960 3300026041 Bacteria 5160
235 Ga0207678_10024989 3300026067 Bacteria 5217
236 Ga0207678_10150882 3300026067 Bacteria 1984
237 Ga0207708_10015633 3300026075 Bacteria 5692
238 Ga0207702_10021660 3300026078 Bacteria 5322
239 Ga0207648_10015144 3300026089 Bacteria 7098
240 Ga0207675_100028254 3300026118 Bacteria 5222
241 Ga0207675_100062744 3300026118 Bacteria 3472
242 Ga0207683_10007032 3300026121 Bacteria 9650
243 Ga0207683_10046752 3300026121 Bacteria 3789
244 Ga0207698_10044070 3300026142 Bacteria 3348
245 Ga0207428_10000964 3300027907 Bacteria 31921
246 Ga0207428_10003341 3300027907 Bacteria 15600
247 Ga0268265_10124555 3300028380 Bacteria 2130
248 Ga0268265_10133273 3300028380 Bacteria 2068
249 Ga0307515_10082545 3300028794 Bacteria 4154
250 Ga0307512_10003678 3300030522 Bacteria 17481
251 Ga0265320_10028670 3300031240 Bacteria 2888
252 Ga0265325_10002844 3300031241 Bacteria 11539
253 Ga0265327_10000138 3300031251 Bacteria 160313
254 Ga0265327_10004793 3300031251 Bacteria 11756
255 Ga0265316_10107160 3300031344 Bacteria 2119
256 Ga0307514_10008438 3300031649 Bacteria 8780
257 Ga0316579_10025169 3300031691 Bacteria 2685
258 Ga0265314_10043050 3300031711 Bacteria 3214
259 Ga0316576_10018315 3300031727 Bacteria 4778
260 Ga0307405_10001317 3300031731 Bacteria 10385
261 Ga0316577_10061345 3300031733 Bacteria 2098
262 Ga0307413_10000082 3300031824 Bacteria 23658
263 Ga0307410_10000502 3300031852 Bacteria 15911
264 Ga0307410_10003335 3300031852 Bacteria 8034
265 Ga0307410_10014909 3300031852 Bacteria 4592
266 Ga0307406_10000895 3300031901 Bacteria 16751
267 Ga0307406_10000932 3300031901 Bacteria 16339
268 Ga0307406_10004930 3300031901 Bacteria 7271
269 Ga0307406_10042666 3300031901 Bacteria 2833
270 Ga0307406_10059380 3300031901 Bacteria 2462
271 Ga0307407_10010679 3300031903 Bacteria 4340
272 Ga0307407_10014338 3300031903 Bacteria 3877
273 Ga0307412_10017184 3300031911 Bacteria 4327
274 Ga0307409_100000050 3300031995 Bacteria 42042
275 Ga0307409_100002047 3300031995 Bacteria 10353
276 Ga0307409_100006594 3300031995 Bacteria 6843
277 Ga0307416_100000150 3300032002 Bacteria 41366
278 Ga0307416_100006316 3300032002 Bacteria 7409
279 Ga0307416_100090070 3300032002 Bacteria 2629
280 Ga0307414_10002253 3300032004 Bacteria 10077
281 Ga0307414_10003797 3300032004 Bacteria 8118
282 Ga0307414_10027298 3300032004 Bacteria 3688
283 Ga0307415_100001151 3300032126 Bacteria 12363
284 Ga0307415_100009552 3300032126 Bacteria 5445
285 Ga0316583_10012970 3300032133 Bacteria 3006
286 Ga0307507_10000017 3300033179 Bacteria 224506
287 Ga0307507_10084728 3300033179 Bacteria 2761
288 Ga0373954_0058447 3300035118 Bacteria 1817
289 Ga0373956_0005060 3300035119 Bacteria 5278
290 Ga0316574_0013330 3300035398 Bacteria 4721
291 Ga0316574_0015583 3300035398 Bacteria 4413
292 Ga0373931_0002731 3300035691 Bacteria 7846
293 Ga0316584_0007978 3300036712 Bacteria 7268
294 Ga0316584_0011344 3300036712 Bacteria 6259
295 Ga0316584_0021716 3300036712 Bacteria 4669
296 Ga0395900_0018238 3300037418 Bacteria 7160
297 Ga0395898_0000381 3300037466 Bacteria 97274
298 Ga0395898_0016072 3300037466 Bacteria 7668
299 Ga0395905_0200529 3300037471 Bacteria 1871
300 Ga0436364_0915257 3300037853 Bacteria 20960
301 Ga0436364_1108321 3300037853 Bacteria 3757
302 Ga0436364_1348147 3300037853 Bacteria 2558
303 Ga0395901_0011246 3300038443 Bacteria 9067
304 Ga0395901_0044108 3300038443 Bacteria 4625
305 Ga0436365_0094667 3300039437 Bacteria 4688
306 Ga0436365_0296904 3300039437 Bacteria 5669
307 Ga0436365_0561521 3300039437 Bacteria 6593
308 Ga0436365_0747521 3300039437 Bacteria 20665
309 Ga0436365_1257400 3300039437 Bacteria 59519
310 Ga0436365_1313710 3300039437 Bacteria 6622
311 Ga0436365_1501762 3300039437 Bacteria 11122
312 Ga0436360_0661207 3300039438 Bacteria 1549
313 Ga0436363_0064533 3300039450 Bacteria 2686
314 Ga0436363_1430762 3300039450 Bacteria 4975
315 Ga0436362_0339593 3300039453 Bacteria 5460
316 Ga0451791_0254429 3300041451 Bacteria 1691
317 Ga0451791_1058766 3300041451 Bacteria 3764
318 Ga0451793_0234284 3300041452 Bacteria 6557
319 Ga0451839_1432976 3300041496 Bacteria 3470
320 Ga0439463_002957 3300042016 Bacteria 4312
321 Ga0439463_015219 3300042016 Bacteria 1902
322 Ga0439464_0007068 3300042439 Bacteria 2934
323 Ga0451577_0001490 3300042876 Bacteria 30999
324 Ga0439440_0010804 3300042993 Bacteria 1916
325 Ga0466961_0015646 3300044693 Bacteria 4867
326 Ga0466963_0003069 3300044694 Bacteria 9459
327 Ga0453684_0007203 3300044712 Bacteria 20638
328 Ga0466970_0017761 3300044765 Bacteria 3678
329 Ga0466970_0017955 3300044765 Bacteria 3660
330 Ga0466959_0006000 3300045049 Bacteria 8382
331 Ga0466959_0107069 3300045049 Bacteria 1998
332 Ga0466958_0000255 3300045836 Bacteria 20624
333 Ga0466958_0002346 3300045836 Bacteria 9465
334 Ga0466958_0011178 3300045836 Bacteria 5050
335 Ga0466958_0025107 3300045836 Bacteria 3510
336 Ga0466958_0046944 3300045836 Bacteria 2607
337 Ga0466958_0063851 3300045836 Bacteria 2246
338 Ga0466958_0070198 3300045836 Bacteria 2143
339 Ga0466967_0015398 3300045976 Bacteria 5992
340 Ga0466967_0017853 3300045976 Bacteria 5651
341 Ga0495627_001457 3300046453 Bacteria 13875
342 Ga0495629_0162333 3300046459 Bacteria 1552
343 Ga0495641_0020421 3300046461 Bacteria 3359
344 Ga0495653_0013339 3300046463 Bacteria 6696
345 Ga0495628_0033353 3300046516 Bacteria 4151
346 Ga0495628_0074669 3300046516 Bacteria 2641
347 Ga0495652_0128164 3300046529 Bacteria 2013
348 Ga0495587_0025825 3300046536 Bacteria 3587
349 Ga0495667_0115502 3300046559 Bacteria 1734
350 Ga0495599_0046415 3300046678 Bacteria 2724
351 Ga0495646_0006916 3300046680 Bacteria 7201
352 Ga0495613_0011083 3300046689 Bacteria 6694
353 Ga0495672_0012093 3300047320 Bacteria 6043
354 Ga0495680_0003021 3300047322 Bacteria 16778
355 Ga0495675_0076543 3300047444 Bacteria 2109
356 Ga0495684_0019823 3300047471 Bacteria 5182
357 Ga0496100_0008594 3300048903 Bacteria 5700
358 Ga0496101_0004916 3300048904 Bacteria 8481
359 Ga0496101_0012510 3300048904 Bacteria 5663
360 Ga0496102_0004460 3300048905 Bacteria 11812
361 Ga0496102_0020077 3300048905 Bacteria 5898
362 Ga0496102_0057324 3300048905 Bacteria 3557
363 Ga0496102_0082020 3300048905 Bacteria 2974
364 Ga0496103_0017406 3300048906 Bacteria 4302
365 Ga0496103_0029408 3300048906 Bacteria 3339
366 Ga0496104_0004952 3300048907 Bacteria 11623
367 Ga0496104_0016185 3300048907 Bacteria 6769
368 Ga0496104_0067801 3300048907 Bacteria 3390
369 Ga0496104_0172295 3300048907 Bacteria 2075
370 Ga0496105_0001397 3300048908 Bacteria 16954
371 Ga0496105_0009927 3300048908 Bacteria 7467
372 Ga0496105_0020520 3300048908 Bacteria 5340
373 Ga0496105_0042674 3300048908 Bacteria 3740
374 Ga0496105_0054876 3300048908 Bacteria 3290
375 Ga0496106_0010749 3300048909 Bacteria 6765
376 Ga0496107_0118794 3300048910 Bacteria 1947
377 Ga0496108_0000472 3300048911 Bacteria 32264
378 Ga0496108_0042683 3300048911 Bacteria 3786
379 Ga0496108_0043180 3300048911 Bacteria 3766
380 Ga0496108_0043709 3300048911 Bacteria 3742
381 Ga0496108_0076220 3300048911 Bacteria 2834
382 Ga0496108_0106696 3300048911 Bacteria 2392
383 Ga0496109_0044305 3300048912 Bacteria 4036
384 Ga0496109_0097363 3300048912 Bacteria 2727
385 Ga0496110_0004337 3300048913 Bacteria 10977
386 Ga0496110_0034495 3300048913 Bacteria 4383
387 Ga0496110_0036562 3300048913 Bacteria 4264
388 Ga0496110_0118205 3300048913 Bacteria 2387
389 Ga0496112_0100800 3300048915 Bacteria 2857
390 Ga0496113_0146760 3300048916 Bacteria 1859
391 Ga0496114_0004810 3300048917 Bacteria 10519
392 Ga0496114_0015500 3300048917 Bacteria 6127
393 Ga0496114_0148232 3300048917 Bacteria 2035
394 Ga0496117_0001718 3300048920 Bacteria 30310
395 Ga0496117_0012087 3300048920 Bacteria 7661
396 Ga0496117_0040411 3300048920 Bacteria 3430
397 Ga0496119_0000437 3300048922 Bacteria 57106
398 Ga0496120_0023496 3300048923 Bacteria 3859
399 Ga0496122_0011256 3300048925 Bacteria 9090
400 Ga0496125_0002545 3300048928 Bacteria 23516
401 Ga0496125_0006238 3300048928 Bacteria 12963
402 Ga0496125_0012012 3300048928 Bacteria 8623
403 Ga0496125_0043469 3300048928 Bacteria 3813
404 Ga0496126_0009429 3300048929 Bacteria 10363
405 Ga0496126_0030861 3300048929 Bacteria 5073
406 Ga0501031_0000962 3300049568 Bacteria 17461
407 Ga0501031_0005234 3300049568 Bacteria 8456
408 Ga0501031_0009118 3300049568 Bacteria 6454
409 Ga0501032_0004528 3300049569 Bacteria 10456
410 Ga0501032_0030351 3300049569 Bacteria 3709
411 Ga0501034_0000910 3300049571 Bacteria 43164
412 Ga0501034_0004867 3300049571 Bacteria 14811
413 Ga0501034_0010823 3300049571 Bacteria 9476
414 Ga0501034_0121234 3300049571 Bacteria 2601
415 Ga0501034_0202929 3300049571 Bacteria 1940
416 Ga0501036_0000459 3300049572 Bacteria 29154
417 Ga0501036_0004810 3300049572 Bacteria 10917
418 Ga0501036_0017176 3300049572 Bacteria 6048
419 Ga0501036_0098707 3300049572 Bacteria 2469
420 Ga0501037_0002189 3300049573 Bacteria 14138
421 Ga0501037_0063279 3300049573 Bacteria 2697
422 Ga0501038_0022776 3300049574 Bacteria 5608
423 Ga0501038_0030194 3300049574 Bacteria 4798
424 Ga0501039_0005821 3300049575 Bacteria 9335
425 Ga0501040_0007079 3300049576 Bacteria 7270
426 Ga0501040_0016936 3300049576 Bacteria 4832
427 Ga0501040_0053629 3300049576 Bacteria 2762
428 Ga0501041_0064989 3300049577 Bacteria 2234
429 Ga0501042_0002441 3300049578 Bacteria 11407
430 Ga0501042_0010640 3300049578 Bacteria 6180
431 Ga0501042_0014671 3300049578 Bacteria 5351
432 Ga0501042_0102403 3300049578 Bacteria 2060
433 Ga0501043_0002716 3300049579 Bacteria 14811
434 Ga0501043_0026532 3300049579 Bacteria 4545
435 Ga0501046_0003277 3300049580 Bacteria 14864
436 Ga0501046_0008161 3300049580 Bacteria 9148
437 Ga0501046_0038684 3300049580 Bacteria 3826
438 Ga0501047_0018200 3300049581 Bacteria 6732
439 Ga0501047_0027920 3300049581 Bacteria 5439
440 Ga0501047_0028269 3300049581 Bacteria 5405
441 Ga0501048_0002442 3300049582 Bacteria 14185
442 Ga0501048_0008269 3300049582 Bacteria 7870
443 Ga0501048_0021473 3300049582 Bacteria 4727
444 Ga0501068_0008750 3300049584 Bacteria 5647
445 Ga0501069_0003890 3300049585 Bacteria 7697
446 Ga0501070_0001332 3300049586 Bacteria 22064
447 Ga0501070_0002352 3300049586 Bacteria 16602
448 Ga0501070_0004032 3300049586 Bacteria 12616
449 Ga0501070_0060611 3300049586 Bacteria 3136
450 Ga0501070_0072478 3300049586 Bacteria 2851
451 Ga0501071_0000654 3300049587 Bacteria 18059
452 Ga0501072_0003041 3300049588 Bacteria 12653
453 Ga0501072_0045321 3300049588 Bacteria 3457
454 Ga0501073_0016747 3300049589 Bacteria 5311
455 Ga0501074_0001816 3300049590 Bacteria 14607
456 Ga0501074_0012382 3300049590 Bacteria 6200
457 Ga0501075_0005478 3300049591 Bacteria 8679
458 Ga0501075_0010882 3300049591 Bacteria 6418
459 Ga0501075_0049787 3300049591 Bacteria 3149
460 Ga0501076_0005227 3300049592 Bacteria 9304
461 Ga0501076_0019672 3300049592 Bacteria 5162
462 Ga0501076_0054338 3300049592 Bacteria 3174
463 Ga0501077_0025156 3300049593 Bacteria 3781
464 Ga0501079_0001234 3300049741 Bacteria 17906
465 Ga0501080_0000473 3300049742 Bacteria 31252
466 Ga0501080_0012985 3300049742 Bacteria 7648
467 Ga0501080_0018519 3300049742 Bacteria 6441
468 Ga0501080_0026537 3300049742 Bacteria 5382
469 Ga0501081_0005886 3300049743 Bacteria 7937
470 Ga0501081_0055845 3300049743 Bacteria 2728
471 Ga0501083_0000795 3300049744 Bacteria 20733
472 Ga0501035_0002239 3300049822 Bacteria 19166
473 Ga0501035_0034180 3300049822 Bacteria 4621
474 Ga0501035_0039322 3300049822 Bacteria 4281
475 Ga0501044_0016031 3300049823 Bacteria 8060
476 Ga0501044_0035379 3300049823 Bacteria 5230
477 Ga0501044_0173282 3300049823 Bacteria 2128
478 Ga0501045_0019688 3300049824 Bacteria 4815
479 Ga0501045_0089798 3300049824 Bacteria 2270
480 nmdc:mga00v17_50599_c1 3300050491 Bacteria 2525
481 nmdc:mga0yw44_7068_c1 3300050492 Bacteria 5494
482 nmdc:mga05p37_707_c1 3300050507 Bacteria 37015
483 nmdc:mga09592_5971_c1 3300050508 Bacteria 9927
484 nmdc:mga0qj67_33_c3 3300050509 Bacteria 9892
485 nmdc:mga06r32_1_c1 3300050510 Bacteria 147976
486 nmdc:mga06r32_33846_c1 3300050510 Bacteria 4815
487 nmdc:mga08y16_26425_c1 3300050511 Bacteria 6122
488 nmdc:mga0n895_6199_c1 3300050512 Bacteria 10115
489 nmdc:mga0rr50_12402_c1 3300050513 Bacteria 5508
490 nmdc:mga08x19_3272_c1 3300050514 Bacteria 9693
491 Ga0495601_0058500 3300053077 Bacteria 2443
492 Ga0495612_0011571 3300053078 Bacteria 3554
493 Ga0500635_0000664 3300053080 Bacteria 8729
494 Ga0495619_0005982 3300053085 Bacteria 7702
495 Ga0500651_0003063 3300053093 Bacteria 9045
496 Ga0500641_0001776 3300053096 Bacteria 7633
497 Ga0500556_0000426 3300053104 Bacteria 30343
498 Ga0500559_0000050 3300053136 Bacteria 93262
499 Ga0500573_0002056 3300053140 Bacteria 9889
500 Ga0500573_0006455 3300053140 Bacteria 6350
501 Ga0500590_013523 3300053148 Bacteria 4191
502 Ga0500620_006216 3300053155 Bacteria 2843
503 Ga0501084_0002423 3300054114 Bacteria 15013
504 Ga0501084_0006412 3300054114 Bacteria 9672
505 Ga0501084_0028555 3300054114 Bacteria 4663
506 Ga0501084_0111511 3300054114 Bacteria 2299
507 Ga0501082_0009581 3300060353 Bacteria 8336
508 Ga0501082_0017542 3300060353 Bacteria 6166
509 Ga0501082_0029897 3300060353 Bacteria 4693
510 Ga0466962_0014488 3300061719 Bacteria 3800
511 Ga0466962_0052983 3300061719 Bacteria 1939
512 Ga0530510_0006453 3300061734 Bacteria 8167
513 Ga0530510_0013748 3300061734 Bacteria 5698
514 Ga0530510_0096225 3300061734 Bacteria 2164

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0046415 Ga0495599_0046415_438_1766 429
2 3300039438 Ga0436360_0661207 Ga0436360_0661207_53_1384 430
3 3300046459 Ga0495629_0162333 Ga0495629_0162333_44_1477 460
4 3300036712 Ga0316584_0011344 Ga0316584_0011344_703_2322 486
5 3300017792 Ga0163161_10036458 Ga0163161_100364581 488
6 3300049586 Ga0501070_0060611 Ga0501070_0060611_1628_3103 488
7 3300045836 Ga0466958_0025107 Ga0466958_0025107_736_2430 494
8 3300039437 Ga0436365_0296904 Ga0436365_0296904_3920_5479 500
9 3300042016 Ga0439463_002957 Ga0439463_002957_178_1689 500
10 3300047444 Ga0495675_0076543 Ga0495675_0076543_436_2052 509
11 3300042876 Ga0451577_0001490 Ga0451577_0001490_11944_13608 512
12 3300044712 Ga0453684_0007203 Ga0453684_0007203_14366_16030 512
13 3300046559 Ga0495667_0115502 Ga0495667_0115502_100_1689 512
14 3300049584 Ga0501068_0008750 Ga0501068_0008750_2513_4123 513
15 3300045836 Ga0466958_0011178 Ga0466958_0011178_545_2209 515
16 3300005615 Ga0070702_100032412 Ga0070702_1000324122 516
17 3300017792 Ga0163161_10020812 Ga0163161_100208123 516
18 3300025922 Ga0207646_10067741 Ga0207646_100677412 516
19 3300041451 Ga0451791_0254429 Ga0451791_0254429_50_1681 517
20 3300047320 Ga0495672_0012093 Ga0495672_0012093_1543_3171 517
21 3300061734 Ga0530510_0013748 Ga0530510_0013748_4018_5658 517
22 3300031901 Ga0307406_10059380 Ga0307406_100593802 518
23 3300033179 Ga0307507_10084728 Ga0307507_100847282 518
24 3300009147 Ga0114129_10007034 Ga0114129_1000703424 519
25 3300032002 Ga0307416_100090070 Ga0307416_1000900702 519
26 3300049568 Ga0501031_0009118 Ga0501031_0009118_1684_3324 519
27 3300049569 Ga0501032_0030351 Ga0501032_0030351_1381_3021 519
28 3300049572 Ga0501036_0004810 Ga0501036_0004810_3441_5081 519
29 3300049575 Ga0501039_0005821 Ga0501039_0005821_3977_5617 519
30 3300049576 Ga0501040_0007079 Ga0501040_0007079_401_2041 519
31 3300049578 Ga0501042_0010640 Ga0501042_0010640_494_2134 519
32 3300049588 Ga0501072_0003041 Ga0501072_0003041_6726_8366 519
33 3300049591 Ga0501075_0005478 Ga0501075_0005478_4911_6551 519
34 3300049593 Ga0501077_0025156 Ga0501077_0025156_1901_3541 519
35 3300049743 Ga0501081_0005886 Ga0501081_0005886_3987_5627 519
36 3300049824 Ga0501045_0089798 Ga0501045_0089798_68_1696 519
37 3300050507 nmdc:mga05p37_707_c1 nmdc:mga05p37_707_c1_29758_31350 519
38 3300050508 nmdc:mga09592_5971_c1 nmdc:mga09592_5971_c1_101_1693 519
39 3300050509 nmdc:mga0qj67_33_c3 nmdc:mga0qj67_33_c3_8207_9799 519
40 3300050510 nmdc:mga06r32_1_c1 nmdc:mga06r32_1_c1_138075_139667 519
41 3300054114 Ga0501084_0028555 Ga0501084_0028555_1375_3015 519
42 3300060353 Ga0501082_0029897 Ga0501082_0029897_1726_3366 519
43 iso_pu_bacteria 2675903060 2676496212 520
44 iso_pu_bacteria 2884693830 2884697947 520
45 iso_pu_bacteria 2895442618 2895445008 520
46 iso_pu_bacteria 2675903058 2676476886 521
47 iso_pu_bacteria 2827628540 2827630024 521
48 3300037853 Ga0436364_1348147 Ga0436364_1348147_78_1703 523
49 3300048905 Ga0496102_0057324 Ga0496102_0057324_35_1639 523
50 3300048906 Ga0496103_0029408 Ga0496103_0029408_428_2032 523
51 3300005435 Ga0070714_100005084 Ga0070714_1000050845 524
52 3300005435 Ga0070714_100044804 Ga0070714_1000448042 524
53 3300021377 Ga0213874_10004103 Ga0213874_100041032 524
54 3300025929 Ga0207664_10003739 Ga0207664_100037395 524
55 3300048912 Ga0496109_0044305 Ga0496109_0044305_1632_3239 526
56 3300049576 Ga0501040_0016936 Ga0501040_0016936_903_2537 526
57 3300049582 Ga0501048_0021473 Ga0501048_0021473_845_2479 526
58 3300049824 Ga0501045_0019688 Ga0501045_0019688_736_2370 526
59 3300054114 Ga0501084_0111511 Ga0501084_0111511_146_1780 526
60 iso_pu_bacteria 2791354901 2791915328 526
61 3300006028 Ga0070717_10013074 Ga0070717_100130744 527
62 3300021384 Ga0213876_10054335 Ga0213876_100543352 527
63 3300037853 Ga0436364_0915257 Ga0436364_0915257_8502_10136 527
64 3300037853 Ga0436364_1108321 Ga0436364_1108321_1362_2996 527
65 3300039437 Ga0436365_0094667 Ga0436365_0094667_2135_3769 527
66 3300039437 Ga0436365_0561521 Ga0436365_0561521_1487_3121 527
67 3300039437 Ga0436365_0747521 Ga0436365_0747521_10298_11932 527
68 3300039437 Ga0436365_1313710 Ga0436365_1313710_3554_5188 527
69 3300039437 Ga0436365_1501762 Ga0436365_1501762_5935_7569 527
70 3300039450 Ga0436363_0064533 Ga0436363_0064533_157_1791 527
71 3300039450 Ga0436363_1430762 Ga0436363_1430762_627_2261 527
72 3300039453 Ga0436362_0339593 Ga0436362_0339593_3725_5359 527
73 3300045049 Ga0466959_0006000 Ga0466959_0006000_1785_3419 527
74 3300045049 Ga0466959_0107069 Ga0466959_0107069_32_1666 527
75 3300045836 Ga0466958_0002346 Ga0466958_0002346_5386_7047 527
76 3300045976 Ga0466967_0015398 Ga0466967_0015398_2983_4617 527
77 3300045976 Ga0466967_0017853 Ga0466967_0017853_3432_5093 527
78 3300046529 Ga0495652_0128164 Ga0495652_0128164_107_1741 527
79 3300061719 Ga0466962_0052983 Ga0466962_0052983_27_1634 527
80 3300005535 Ga0070684_100050208 Ga0070684_1000502082 528
81 3300020082 Ga0206353_10350813 Ga0206353_103508132 528
82 3300021388 Ga0213875_10049946 Ga0213875_100499461 528
83 3300025916 Ga0207663_10032315 Ga0207663_100323153 528
84 3300025915 Ga0207693_10002722 Ga0207693_100027224 529
85 3300025916 Ga0207663_10101710 Ga0207663_101017102 529
86 3300025929 Ga0207664_10064969 Ga0207664_100649692 529
87 3300025939 Ga0207665_10016216 Ga0207665_100162164 529
88 3300032133 Ga0316583_10012970 Ga0316583_100129702 529
89 3300035118 Ga0373954_0058447 Ga0373954_0058447_73_1713 529
90 3300035119 Ga0373956_0005060 Ga0373956_0005060_2244_3908 529
91 3300045836 Ga0466958_0046944 Ga0466958_0046944_528_2171 529
92 3300045836 Ga0466958_0070198 Ga0466958_0070198_290_1930 529
93 3300046463 Ga0495653_0013339 Ga0495653_0013339_4059_5699 529
94 3300046516 Ga0495628_0033353 Ga0495628_0033353_882_2522 529
95 3300046536 Ga0495587_0025825 Ga0495587_0025825_246_1886 529
96 3300046680 Ga0495646_0006916 Ga0495646_0006916_1304_2944 529
97 3300047322 Ga0495680_0003021 Ga0495680_0003021_5262_6902 529
98 3300047471 Ga0495684_0019823 Ga0495684_0019823_711_2351 529
99 3300048912 Ga0496109_0097363 Ga0496109_0097363_993_2633 529
100 3300048915 Ga0496112_0100800 Ga0496112_0100800_122_1762 529
101 3300049578 Ga0501042_0102403 Ga0501042_0102403_318_1961 529
102 3300049592 Ga0501076_0054338 Ga0501076_0054338_84_1727 529
103 3300053077 Ga0495601_0058500 Ga0495601_0058500_42_1682 529
104 3300053085 Ga0495619_0005982 Ga0495619_0005982_4677_6317 529
105 3300006844 Ga0075428_100006889 Ga0075428_1000068897 530
106 3300006846 Ga0075430_100025796 Ga0075430_1000257964 530
107 3300006847 Ga0075431_100070801 Ga0075431_1000708011 530
108 3300006880 Ga0075429_100111723 Ga0075429_1001117232 530
109 3300031852 Ga0307410_10003335 Ga0307410_100033352 530
110 3300031901 Ga0307406_10042666 Ga0307406_100426662 530
111 3300031995 Ga0307409_100002047 Ga0307409_1000020471 530
112 3300044765 Ga0466970_0017955 Ga0466970_0017955_165_1841 530
113 3300046689 Ga0495613_0011083 Ga0495613_0011083_4645_6288 530
114 3300048907 Ga0496104_0067801 Ga0496104_0067801_778_2421 530
115 3300048911 Ga0496108_0106696 Ga0496108_0106696_614_2257 530
116 3300049568 Ga0501031_0005234 Ga0501031_0005234_2225_3907 530
117 3300049572 Ga0501036_0017176 Ga0501036_0017176_3054_4736 530
118 3300049574 Ga0501038_0022776 Ga0501038_0022776_2257_3939 530
119 3300049576 Ga0501040_0053629 Ga0501040_0053629_391_2073 530
120 3300049577 Ga0501041_0064989 Ga0501041_0064989_93_1775 530
121 3300049578 Ga0501042_0014671 Ga0501042_0014671_128_1810 530
122 3300049580 Ga0501046_0008161 Ga0501046_0008161_5761_7443 530
123 3300049582 Ga0501048_0008269 Ga0501048_0008269_5970_7652 530
124 3300049588 Ga0501072_0045321 Ga0501072_0045321_1646_3328 530
125 3300049590 Ga0501074_0012382 Ga0501074_0012382_1125_2807 530
126 3300049591 Ga0501075_0010882 Ga0501075_0010882_184_1866 530
127 3300049592 Ga0501076_0005227 Ga0501076_0005227_1539_3221 530
128 3300049742 Ga0501080_0026537 Ga0501080_0026537_3489_5171 530
129 3300049743 Ga0501081_0055845 Ga0501081_0055845_817_2499 530
130 3300049822 Ga0501035_0034180 Ga0501035_0034180_1278_2960 530
131 3300053078 Ga0495612_0011571 Ga0495612_0011571_709_2352 530
132 3300054114 Ga0501084_0006412 Ga0501084_0006412_3365_5047 530
133 3300060353 Ga0501082_0017542 Ga0501082_0017542_3089_4771 530
134 3300061734 Ga0530510_0006453 Ga0530510_0006453_1763_3445 530
135 3300005617 Ga0068859_100017732 Ga0068859_1000177323 531
136 3300006931 Ga0097620_100017732 Ga0097620_1000177326 531
137 3300013308 Ga0157375_10090767 Ga0157375_100907672 531
138 3300031691 Ga0316579_10025169 Ga0316579_100251692 531
139 3300031727 Ga0316576_10018315 Ga0316576_100183152 531
140 3300036712 Ga0316584_0021716 Ga0316584_0021716_569_2263 531
141 3300046516 Ga0495628_0074669 Ga0495628_0074669_130_1812 531
142 3300048904 Ga0496101_0012510 Ga0496101_0012510_3207_4889 531
143 3300048905 Ga0496102_0004460 Ga0496102_0004460_2599_4281 531
144 3300048906 Ga0496103_0017406 Ga0496103_0017406_1273_2955 531
145 3300048907 Ga0496104_0016185 Ga0496104_0016185_3073_4755 531
146 3300048908 Ga0496105_0009927 Ga0496105_0009927_2682_4364 531
147 3300048908 Ga0496105_0020520 Ga0496105_0020520_3639_5330 531
148 3300048913 Ga0496110_0036562 Ga0496110_0036562_1626_3317 531
149 3300048917 Ga0496114_0015500 Ga0496114_0015500_1771_3453 531
150 3300002772 JGI25164J39214_1001647 JGI25164J39214_10016473 532
151 3300003214 JGI25165J46597_1000061 JGI25165J46597_100006181 532
152 3300025231 Ga0207427_100042 Ga0207427_10004275 532
153 3300025233 Ga0209437_101321 Ga0209437_1013212 532
154 3300025261 Ga0209233_1000001 Ga0209233_10000011161 532
155 3300037466 Ga0395898_0016072 Ga0395898_0016072_4815_6506 532
156 3300005434 Ga0070709_10003834 Ga0070709_100038347 534
157 3300005435 Ga0070714_100001322 Ga0070714_1000013227 534
158 3300005436 Ga0070713_100001527 Ga0070713_1000015274 534
159 3300005437 Ga0070710_10003868 Ga0070710_100038687 534
160 3300005439 Ga0070711_100001298 Ga0070711_10000129812 534
161 3300005471 Ga0070698_100015325 Ga0070698_1000153252 534
162 3300006028 Ga0070717_10000413 Ga0070717_100004137 534
163 3300006173 Ga0070716_100000451 Ga0070716_10000045117 534
164 3300006175 Ga0070712_100011966 Ga0070712_1000119661 534
165 3300025906 Ga0207699_10001501 Ga0207699_100015017 534
166 3300025915 Ga0207693_10004743 Ga0207693_1000474310 534
167 3300025916 Ga0207663_10001616 Ga0207663_100016163 534
168 3300025928 Ga0207700_10002316 Ga0207700_100023167 534
169 3300025929 Ga0207664_10000417 Ga0207664_100004177 534
170 3300025939 Ga0207665_10000320 Ga0207665_1000032018 534
171 3300048913 Ga0496110_0118205 Ga0496110_0118205_12_1703 535
172 3300053155 Ga0500620_006216 Ga0500620_006216_1105_2793 536
173 3300037471 Ga0395905_0200529 Ga0395905_0200529_65_1711 537
174 3300038443 Ga0395901_0011246 Ga0395901_0011246_7316_8962 537
175 3300048908 Ga0496105_0042674 Ga0496105_0042674_1910_3592 537
176 3300048928 Ga0496125_0002545 Ga0496125_0002545_20853_22553 537
177 iso_pu_bacteria 2856741275 2856741388 538
178 iso_pu_bacteria 2861520306 2861521575 538
179 iso_pu_bacteria 2891562705 2891563727 538
180 3300013104 Ga0157370_10079955 Ga0157370_100799553 539
181 3300048920 Ga0496117_0012087 Ga0496117_0012087_2452_4140 539
182 3300003752 Ga0055539_1000005 Ga0055539_1000005569 540
183 3300003756 Ga0055533_1000001 Ga0055533_10000011638 540
184 3300003759 Ga0055525_1001046 Ga0055525_10010465 540
185 3300005435 Ga0070714_100110539 Ga0070714_1001105392 540
186 3300009545 Ga0105237_10052001 Ga0105237_100520013 540
187 3300025226 Ga0209674_100001 Ga0209674_1000011639 540
188 3300025230 Ga0209563_100001 Ga0209563_1000011639 540
189 3300025253 Ga0209677_100001 Ga0209677_1000011639 540
190 3300030522 Ga0307512_10003678 Ga0307512_1000367812 540
191 3300025899 Ga0207642_10016311 Ga0207642_100163112 541
192 3300049581 Ga0501047_0027920 Ga0501047_0027920_732_2375 541
193 3300049586 Ga0501070_0002352 Ga0501070_0002352_9385_11073 541
194 3300049590 Ga0501074_0001816 Ga0501074_0001816_12939_14585 541
195 3300028794 Ga0307515_10082545 Ga0307515_100825452 542
196 3300038443 Ga0395901_0044108 Ga0395901_0044108_2133_3824 543
197 3300053096 Ga0500641_0001776 Ga0500641_0001776_4714_6396 543
198 iso_pu_bacteria 2929219909 2929225694 543
199 3300033179 Ga0307507_10000017 Ga0307507_10000017173 544
200 3300003578 Ga0006562J51391_1002516 Ga0006562J51391_100251611 546
201 3300003578 Ga0006562J51391_1002517 Ga0006562J51391_10025172 546
202 iso_pu_bacteria 2891395885 2891398612 546
203 3300009098 Ga0105245_10013491 Ga0105245_100134914 547
204 3300025927 Ga0207687_10013434 Ga0207687_100134343 547
205 3300031649 Ga0307514_10008438 Ga0307514_100084384 547
206 3300048911 Ga0496108_0042683 Ga0496108_0042683_338_2020 547
207 3300048913 Ga0496110_0034495 Ga0496110_0034495_1010_2692 547
208 3300053136 Ga0500559_0000050 Ga0500559_0000050_17348_19036 547
209 3300053148 Ga0500590_013523 Ga0500590_013523_1873_3576 547
210 3300035398 Ga0316574_0015583 Ga0316574_0015583_2315_3997 548
211 3300049568 Ga0501031_0000962 Ga0501031_0000962_10750_12423 548
212 3300049569 Ga0501032_0004528 Ga0501032_0004528_8403_10076 548
213 3300049571 Ga0501034_0004867 Ga0501034_0004867_2530_4203 548
214 3300049571 Ga0501034_0202929 Ga0501034_0202929_192_1871 548
215 3300049572 Ga0501036_0000459 Ga0501036_0000459_24555_26228 548
216 3300049573 Ga0501037_0002189 Ga0501037_0002189_10941_12614 548
217 3300049579 Ga0501043_0002716 Ga0501043_0002716_2530_4203 548
218 3300049579 Ga0501043_0026532 Ga0501043_0026532_1528_3207 548
219 3300049580 Ga0501046_0003277 Ga0501046_0003277_3045_4724 548
220 3300049581 Ga0501047_0018200 Ga0501047_0018200_2530_4203 548
221 3300049581 Ga0501047_0028269 Ga0501047_0028269_1456_3135 548
222 3300049586 Ga0501070_0004032 Ga0501070_0004032_2530_4203 548
223 3300049589 Ga0501073_0016747 Ga0501073_0016747_115_1788 548
224 3300049742 Ga0501080_0000473 Ga0501080_0000473_19021_20694 548
225 3300049744 Ga0501083_0000795 Ga0501083_0000795_184_1863 548
226 3300049822 Ga0501035_0002239 Ga0501035_0002239_10609_12282 548
227 3300049823 Ga0501044_0016031 Ga0501044_0016031_3347_5026 548
228 3300054114 Ga0501084_0002423 Ga0501084_0002423_2732_4405 548
229 iso_pu_bacteria 2675903058 2676476359 548
230 iso_pu_bacteria 2839986021 2839988361 548
231 iso_pu_bacteria 2932431166 2932432223 548
232 3300005563 Ga0068855_100079606 Ga0068855_1000796062 549
233 3300005841 Ga0068863_100175277 Ga0068863_1001752772 549
234 3300009177 Ga0105248_10000880 Ga0105248_1000088019 549
235 3300013296 Ga0157374_10024151 Ga0157374_100241514 549
236 3300025941 Ga0207711_10005166 Ga0207711_100051664 549
237 3300025949 Ga0207667_10152961 Ga0207667_101529612 549
238 3300031251 Ga0265327_10000138 Ga0265327_1000013859 549
239 3300031251 Ga0265327_10004793 Ga0265327_100047937 549
240 3300042016 Ga0439463_015219 Ga0439463_015219_13_1671 549
241 3300049571 Ga0501034_0000910 Ga0501034_0000910_7262_8950 549
242 3300053093 Ga0500651_0003063 Ga0500651_0003063_4649_6352 549
243 3300053104 Ga0500556_0000426 Ga0500556_0000426_10828_12516 549
244 iso_pu_bacteria 8002811521 8002813984 549
245 3300003759 Ga0055525_1001748 Ga0055525_10017483 550
246 3300006051 Ga0075364_10046864 Ga0075364_100468642 550
247 3300025230 Ga0209563_100766 Ga0209563_1007666 550
248 3300048920 Ga0496117_0001718 Ga0496117_0001718_12551_14239 550
249 3300048928 Ga0496125_0012012 Ga0496125_0012012_902_2590 550
250 3300048929 Ga0496126_0009429 Ga0496126_0009429_6576_8264 550
251 3300048929 Ga0496126_0030861 Ga0496126_0030861_1862_3550 550
252 3300050491 nmdc:mga00v17_50599_c1 nmdc:mga00v17_50599_c1_406_2094 550
253 3300050492 nmdc:mga0yw44_7068_c1 nmdc:mga0yw44_7068_c1_949_2637 550
254 3300053140 Ga0500573_0006455 Ga0500573_0006455_463_2151 550
255 3300031901 Ga0307406_10000932 Ga0307406_1000093214 551
256 3300046453 Ga0495627_001457 Ga0495627_001457_7946_9634 551
257 3300032004 Ga0307414_10003797 Ga0307414_100037973 552
258 iso_pu_bacteria 2643221613 2644082355 552
259 iso_pu_bacteria 2643221721 2644667022 552
260 iso_pu_bacteria 2935890801 2935893585 552
261 iso_pu_bacteria 2515154155 2515856616 553
262 iso_pu_bacteria 2565956761 2566992424 553
263 iso_pu_bacteria 2643221616 2644096453 553
264 iso_pu_bacteria 2643221624 2644134940 553
265 iso_pu_bacteria 2643221630 2644173024 553
266 iso_pu_bacteria 2643221690 2644502868 553
267 iso_pu_bacteria 2643221694 2644525228 553
268 iso_pu_bacteria 2643221711 2644607484 553
269 iso_pu_bacteria 2643221722 2644669316 553
270 iso_pu_bacteria 2643221724 2644679223 553
271 iso_pu_bacteria 2643221961 2645720562 553
272 iso_pu_bacteria 2643221962 2645723578 553
273 iso_pu_bacteria 2721755702 2723643101 553
274 iso_pu_bacteria 2728369380 2730228726 553
275 iso_pu_bacteria 2747842429 2747953638 553
276 iso_pu_bacteria 2811994882 2812373742 553
277 iso_pu_bacteria 2818991318 2819426356 553
278 iso_pu_bacteria 2818991458 2819665397 553
279 iso_pu_bacteria 2818991462 2819691398 553
280 iso_pu_bacteria 2818991469 2819727566 553
281 iso_pu_bacteria 2827628540 2827632167 553
282 iso_pu_bacteria 2844841374 2844843323 553
283 iso_pu_bacteria 2852663356 2852665832 553
284 iso_pu_bacteria 2857729791 2857730969 553
285 iso_pu_bacteria 2857737099 2857739750 553
286 iso_pu_bacteria 2883821847 2883823172 553
287 iso_pu_bacteria 2884763398 2884766351 553
288 iso_pu_bacteria 2884994152 2884996421 553
289 iso_pu_bacteria 2904535858 2904539324 553
290 iso_pu_bacteria 2919055335 2919058804 553
291 iso_pu_bacteria 2922554459 2922555596 553
292 iso_pu_bacteria 2928121344 2928122471 553
293 iso_pu_bacteria 2928153084 2928153461 553
294 iso_pu_bacteria 2939582691 2939589216 553
295 iso_pu_bacteria 2945968032 2945970884 553
296 iso_pu_bacteria 2946080515 2946081801 553
297 iso_pu_bacteria 8004182704 8004183587 553
298 3300005530 Ga0070679_100015989 Ga0070679_1000159894 554
299 iso_pu_bacteria 2643221681 2644456169 554
300 iso_pu_bacteria 2939657138 2939659403 554
301 3300005535 Ga0070684_100086763 Ga0070684_1000867632 555
302 3300053080 Ga0500635_0000664 Ga0500635_0000664_4245_5927 555
303 3300003760 Ga0055527_1000017 Ga0055527_100001793 557
304 3300003762 Ga0055542_1000044 Ga0055542_100004493 557
305 3300003763 Ga0055529_1000279 Ga0055529_100027948 557
306 3300005339 Ga0070660_100075211 Ga0070660_1000752112 557
307 3300005347 Ga0070668_100023202 Ga0070668_1000232023 557
308 3300005366 Ga0070659_100001112 Ga0070659_1000011123 557
309 3300005366 Ga0070659_100047953 Ga0070659_1000479532 557
310 3300005367 Ga0070667_100058732 Ga0070667_1000587322 557
311 3300005548 Ga0070665_100136751 Ga0070665_1001367512 557
312 3300005842 Ga0068858_100000016 Ga0068858_1000000166 557
313 3300005843 Ga0068860_100068368 Ga0068860_1000683683 557
314 3300005937 Ga0081455_10001393 Ga0081455_1000139315 557
315 3300005937 Ga0081455_10010089 Ga0081455_100100895 557
316 3300005937 Ga0081455_10012756 Ga0081455_100127566 557
317 3300005937 Ga0081455_10014109 Ga0081455_100141096 557
318 3300005981 Ga0081538_10000264 Ga0081538_1000026441 557
319 3300005985 Ga0081539_10002050 Ga0081539_1000205013 557
320 3300006048 Ga0075363_100021019 Ga0075363_1000210192 557
321 3300006051 Ga0075364_10007063 Ga0075364_100070633 557
322 3300006058 Ga0075432_10001019 Ga0075432_100010198 557
323 3300006058 Ga0075432_10001893 Ga0075432_100018936 557
324 3300006353 Ga0075370_10061351 Ga0075370_100613511 557
325 3300006844 Ga0075428_100010070 Ga0075428_10001007010 557
326 3300006847 Ga0075431_100010112 Ga0075431_1000101126 557
327 3300006852 Ga0075433_10001532 Ga0075433_100015323 557
328 3300006871 Ga0075434_100005228 Ga0075434_10000522811 557
329 3300006871 Ga0075434_100006176 Ga0075434_10000617610 557
330 3300006881 Ga0068865_100056359 Ga0068865_1000563592 557
331 3300006914 Ga0075436_100010308 Ga0075436_1000103083 557
332 3300007076 Ga0075435_100016247 Ga0075435_1000162474 557
333 3300009036 Ga0105244_10034057 Ga0105244_100340572 557
334 3300009093 Ga0105240_10115403 Ga0105240_101154032 557
335 3300009094 Ga0111539_10003621 Ga0111539_100036212 557
336 3300009094 Ga0111539_10003666 Ga0111539_1000366622 557
337 3300009098 Ga0105245_10209850 Ga0105245_102098501 557
338 3300009147 Ga0114129_10024589 Ga0114129_100245897 557
339 3300009148 Ga0105243_10003243 Ga0105243_100032435 557
340 3300009176 Ga0105242_10041559 Ga0105242_100415592 557
341 3300009553 Ga0105249_10008124 Ga0105249_1000812410 557
342 3300009553 Ga0105249_10017913 Ga0105249_100179135 557
343 3300010375 Ga0105239_10078916 Ga0105239_100789163 557
344 3300013105 Ga0157369_10054906 Ga0157369_100549064 557
345 3300013250 Ga0171462_1001 Ga0171462_1001713 557
346 3300013306 Ga0163162_10017114 Ga0163162_100171143 557
347 3300013307 Ga0157372_10252706 Ga0157372_102527061 557
348 3300013308 Ga0157375_10131974 Ga0157375_101319743 557
349 3300021384 Ga0213876_10000676 Ga0213876_1000067618 557
350 3300025228 Ga0209672_100039 Ga0209672_10003994 557
351 3300025229 Ga0209147_101049 Ga0209147_1010496 557
352 3300025242 Ga0209258_101806 Ga0209258_1018062 557
353 3300025246 Ga0209646_1000088 Ga0209646_1000088125 557
354 3300025254 Ga0209148_1000004 Ga0209148_100000494 557
355 3300025272 Ga0209455_1000117 Ga0209455_1000117139 557
356 3300025901 Ga0207688_10001884 Ga0207688_100018846 557
357 3300025909 Ga0207705_10022908 Ga0207705_100229082 557
358 3300025913 Ga0207695_10005496 Ga0207695_100054966 557
359 3300025920 Ga0207649_10022947 Ga0207649_100229473 557
360 3300025932 Ga0207690_10003341 Ga0207690_100033416 557
361 3300025933 Ga0207706_10012551 Ga0207706_100125515 557
362 3300025935 Ga0207709_10005768 Ga0207709_100057685 557
363 3300025935 Ga0207709_10029256 Ga0207709_100292563 557
364 3300025949 Ga0207667_10002042 Ga0207667_100020423 557
365 3300025961 Ga0207712_10013614 Ga0207712_100136145 557
366 3300025972 Ga0207668_10029087 Ga0207668_100290872 557
367 3300025986 Ga0207658_10088123 Ga0207658_100881232 557
368 3300026035 Ga0207703_10000345 Ga0207703_1000034537 557
369 3300026067 Ga0207678_10150882 Ga0207678_101508821 557
370 3300026118 Ga0207675_100028254 Ga0207675_1000282544 557
371 3300026118 Ga0207675_100062744 Ga0207675_1000627441 557
372 3300026121 Ga0207683_10046752 Ga0207683_100467523 557
373 3300026142 Ga0207698_10044070 Ga0207698_100440702 557
374 3300027907 Ga0207428_10000964 Ga0207428_1000096416 557
375 3300027907 Ga0207428_10003341 Ga0207428_1000334115 557
376 3300028380 Ga0268265_10124555 Ga0268265_101245551 557
377 3300031240 Ga0265320_10028670 Ga0265320_100286703 557
378 3300031241 Ga0265325_10002844 Ga0265325_100028448 557
379 3300031344 Ga0265316_10107160 Ga0265316_101071602 557
380 3300031711 Ga0265314_10043050 Ga0265314_100430502 557
381 3300031731 Ga0307405_10001317 Ga0307405_1000131712 557
382 3300031733 Ga0316577_10061345 Ga0316577_100613452 557
383 3300031824 Ga0307413_10000082 Ga0307413_1000008219 557
384 3300031852 Ga0307410_10000502 Ga0307410_1000050214 557
385 3300031852 Ga0307410_10014909 Ga0307410_100149095 557
386 3300031901 Ga0307406_10000895 Ga0307406_100008952 557
387 3300031901 Ga0307406_10004930 Ga0307406_100049306 557
388 3300031903 Ga0307407_10010679 Ga0307407_100106791 557
389 3300031903 Ga0307407_10014338 Ga0307407_100143383 557
390 3300031911 Ga0307412_10017184 Ga0307412_100171843 557
391 3300031995 Ga0307409_100000050 Ga0307409_10000005012 557
392 3300031995 Ga0307409_100006594 Ga0307409_1000065945 557
393 3300032002 Ga0307416_100000150 Ga0307416_10000015011 557
394 3300032002 Ga0307416_100006316 Ga0307416_1000063165 557
395 3300032004 Ga0307414_10002253 Ga0307414_1000225311 557
396 3300032004 Ga0307414_10027298 Ga0307414_100272982 557
397 3300032126 Ga0307415_100001151 Ga0307415_1000011518 557
398 3300032126 Ga0307415_100009552 Ga0307415_1000095523 557
399 3300035398 Ga0316574_0013330 Ga0316574_0013330_2814_4508 557
400 3300036712 Ga0316584_0007978 Ga0316584_0007978_746_2440 557
401 3300037418 Ga0395900_0018238 Ga0395900_0018238_3027_4715 557
402 3300037466 Ga0395898_0000381 Ga0395898_0000381_65150_66838 557
403 3300039437 Ga0436365_1257400 Ga0436365_1257400_19906_21588 557
404 3300041451 Ga0451791_1058766 Ga0451791_1058766_434_2116 557
405 3300041452 Ga0451793_0234284 Ga0451793_0234284_2346_4028 557
406 3300041496 Ga0451839_1432976 Ga0451839_1432976_488_2170 557
407 3300042439 Ga0439464_0007068 Ga0439464_0007068_338_2020 557
408 3300042993 Ga0439440_0010804 Ga0439440_0010804_81_1763 557
409 3300044693 Ga0466961_0015646 Ga0466961_0015646_959_2668 557
410 3300044694 Ga0466963_0003069 Ga0466963_0003069_6452_8134 557
411 3300045836 Ga0466958_0000255 Ga0466958_0000255_8298_9980 557
412 3300045836 Ga0466958_0063851 Ga0466958_0063851_211_1893 557
413 3300046461 Ga0495641_0020421 Ga0495641_0020421_706_2430 557
414 3300048905 Ga0496102_0082020 Ga0496102_0082020_328_2010 557
415 3300048907 Ga0496104_0004952 Ga0496104_0004952_30_1736 557
416 3300048908 Ga0496105_0001397 Ga0496105_0001397_13709_15415 557
417 3300048908 Ga0496105_0054876 Ga0496105_0054876_85_1773 557
418 3300048910 Ga0496107_0118794 Ga0496107_0118794_159_1847 557
419 3300048911 Ga0496108_0000472 Ga0496108_0000472_8518_10224 557
420 3300048911 Ga0496108_0043180 Ga0496108_0043180_1995_3677 557
421 3300048911 Ga0496108_0043709 Ga0496108_0043709_1645_3339 557
422 3300048911 Ga0496108_0076220 Ga0496108_0076220_386_2068 557
423 3300048913 Ga0496110_0004337 Ga0496110_0004337_8645_10351 557
424 3300048916 Ga0496113_0146760 Ga0496113_0146760_138_1829 557
425 3300048917 Ga0496114_0148232 Ga0496114_0148232_239_1921 557
426 3300048920 Ga0496117_0040411 Ga0496117_0040411_912_2648 557
427 3300048922 Ga0496119_0000437 Ga0496119_0000437_29987_31675 557
428 3300048923 Ga0496120_0023496 Ga0496120_0023496_1330_3018 557
429 3300048925 Ga0496122_0011256 Ga0496122_0011256_6865_8553 557
430 3300048928 Ga0496125_0006238 Ga0496125_0006238_8041_9729 557
431 3300048928 Ga0496125_0043469 Ga0496125_0043469_2084_3772 557
432 3300049571 Ga0501034_0010823 Ga0501034_0010823_2790_4472 557
433 3300049571 Ga0501034_0121234 Ga0501034_0121234_239_1927 557
434 3300049572 Ga0501036_0098707 Ga0501036_0098707_585_2270 557
435 3300049573 Ga0501037_0063279 Ga0501037_0063279_755_2440 557
436 3300049574 Ga0501038_0030194 Ga0501038_0030194_191_1876 557
437 3300049578 Ga0501042_0002441 Ga0501042_0002441_6508_8193 557
438 3300049580 Ga0501046_0038684 Ga0501046_0038684_1357_3042 557
439 3300049582 Ga0501048_0002442 Ga0501048_0002442_877_2562 557
440 3300049585 Ga0501069_0003890 Ga0501069_0003890_4025_5707 557
441 3300049586 Ga0501070_0001332 Ga0501070_0001332_20364_22052 557
442 3300049587 Ga0501071_0000654 Ga0501071_0000654_45_1733 557
443 3300049591 Ga0501075_0049787 Ga0501075_0049787_1006_2691 557
444 3300049592 Ga0501076_0019672 Ga0501076_0019672_2783_4468 557
445 3300049742 Ga0501080_0012985 Ga0501080_0012985_3802_5484 557
446 3300049742 Ga0501080_0018519 Ga0501080_0018519_1261_2943 557
447 3300049822 Ga0501035_0039322 Ga0501035_0039322_1450_3135 557
448 3300049823 Ga0501044_0173282 Ga0501044_0173282_229_1911 557
449 3300050510 nmdc:mga06r32_33846_c1 nmdc:mga06r32_33846_c1_542_2224 557
450 3300050511 nmdc:mga08y16_26425_c1 nmdc:mga08y16_26425_c1_2836_4518 557
451 3300050512 nmdc:mga0n895_6199_c1 nmdc:mga0n895_6199_c1_8168_9850 557
452 3300050513 nmdc:mga0rr50_12402_c1 nmdc:mga0rr50_12402_c1_895_2577 557
453 3300050514 nmdc:mga08x19_3272_c1 nmdc:mga08x19_3272_c1_4261_5943 557
454 3300053140 Ga0500573_0002056 Ga0500573_0002056_98_1786 557
455 3300060353 Ga0501082_0009581 Ga0501082_0009581_1907_3589 557
456 3300061719 Ga0466962_0014488 Ga0466962_0014488_2066_3748 557
457 3300061734 Ga0530510_0096225 Ga0530510_0096225_408_2093 557
458 iso_pu_bacteria 2728369276 2729906650 557
459 iso_pu_bacteria 2811994880 2812364394 557
460 3300005336 Ga0070680_100041296 Ga0070680_1000412962 558
461 3300005458 Ga0070681_10000092 Ga0070681_1000009256 558
462 3300005530 Ga0070679_100000009 Ga0070679_100000009170 558
463 3300005530 Ga0070679_100040593 Ga0070679_1000405932 558
464 3300025912 Ga0207707_10000174 Ga0207707_1000017456 558
465 3300025921 Ga0207652_10000070 Ga0207652_100000708 558
466 3300044765 Ga0466970_0017761 Ga0466970_0017761_1858_3549 558
467 3300049586 Ga0501070_0072478 Ga0501070_0072478_584_2281 558
468 3300049741 Ga0501079_0001234 Ga0501079_0001234_1395_3092 558
469 3300049823 Ga0501044_0035379 Ga0501044_0035379_1252_2949 558
470 3300005985 Ga0081539_10000238 Ga0081539_1000023892 559
471 3300013105 Ga0157369_10079172 Ga0157369_100791721 559
472 3300002077 JGI24744J21845_10003351 JGI24744J21845_100033513 561
473 3300002239 JGI24034J26672_10002339 JGI24034J26672_100023394 561
474 3300002244 JGI24742J22300_10004839 JGI24742J22300_100048391 561
475 3300005328 Ga0070676_10010227 Ga0070676_100102273 561
476 3300005334 Ga0068869_100022252 Ga0068869_1000222523 561
477 3300005337 Ga0070682_100030501 Ga0070682_1000305011 561
478 3300005338 Ga0068868_100007142 Ga0068868_1000071426 561
479 3300005339 Ga0070660_100044982 Ga0070660_1000449822 561
480 3300005340 Ga0070689_100056454 Ga0070689_1000564542 561
481 3300005341 Ga0070691_10001503 Ga0070691_100015036 561
482 3300005343 Ga0070687_100043954 Ga0070687_1000439542 561
483 3300005347 Ga0070668_100012150 Ga0070668_1000121507 561
484 3300005353 Ga0070669_100020467 Ga0070669_1000204672 561
485 3300005355 Ga0070671_100025657 Ga0070671_1000256572 561
486 3300005365 Ga0070688_100011461 Ga0070688_1000114613 561
487 3300005366 Ga0070659_100101810 Ga0070659_1001018102 561
488 3300005406 Ga0070703_10013806 Ga0070703_100138062 561
489 3300005435 Ga0070714_100089560 Ga0070714_1000895601 561
490 3300005437 Ga0070710_10001526 Ga0070710_100015266 561
491 3300005438 Ga0070701_10001376 Ga0070701_100013764 561
492 3300005441 Ga0070700_100035827 Ga0070700_1000358271 561
493 3300005444 Ga0070694_100003044 Ga0070694_1000030446 561
494 3300005455 Ga0070663_100008709 Ga0070663_1000087095 561
495 3300005456 Ga0070678_100003051 Ga0070678_1000030516 561
496 3300005459 Ga0068867_100018245 Ga0068867_1000182455 561
497 3300005466 Ga0070685_10016348 Ga0070685_100163482 561
498 3300005539 Ga0068853_100015450 Ga0068853_1000154503 561
499 3300005546 Ga0070696_100055789 Ga0070696_1000557891 561
500 3300005547 Ga0070693_100004959 Ga0070693_1000049593 561
501 3300005548 Ga0070665_100059230 Ga0070665_1000592304 561
502 3300005549 Ga0070704_100011383 Ga0070704_1000113831 561
503 3300005578 Ga0068854_100003477 Ga0068854_1000034776 561
504 3300005614 Ga0068856_100048778 Ga0068856_1000487781 561
505 3300005615 Ga0070702_100003129 Ga0070702_1000031296 561
506 3300005718 Ga0068866_10001286 Ga0068866_1000128610 561
507 3300005842 Ga0068858_100012623 Ga0068858_1000126234 561
508 3300005843 Ga0068860_100039609 Ga0068860_1000396094 561
509 3300006163 Ga0070715_10001773 Ga0070715_100017733 561
510 3300006173 Ga0070716_100007313 Ga0070716_1000073133 561
511 3300006175 Ga0070712_100017360 Ga0070712_1000173601 561
512 3300006237 Ga0097621_100016649 Ga0097621_1000166495 561
513 3300006881 Ga0068865_100005382 Ga0068865_1000053828 561
514 3300009092 Ga0105250_10018818 Ga0105250_100188182 561
515 3300009093 Ga0105240_10194768 Ga0105240_101947681 561
516 3300009098 Ga0105245_10006958 Ga0105245_100069584 561
517 3300009101 Ga0105247_10003161 Ga0105247_100031616 561
518 3300009148 Ga0105243_10011970 Ga0105243_100119706 561
519 3300009174 Ga0105241_10031704 Ga0105241_100317042 561
520 3300009176 Ga0105242_10013303 Ga0105242_100133033 561
521 3300009177 Ga0105248_10148538 Ga0105248_101485383 561
522 3300009545 Ga0105237_10132497 Ga0105237_101324971 561
523 3300009551 Ga0105238_10052842 Ga0105238_100528423 561
524 3300010375 Ga0105239_10015491 Ga0105239_100154917 561
525 3300013296 Ga0157374_10051438 Ga0157374_100514382 561
526 3300013297 Ga0157378_10023725 Ga0157378_100237251 561
527 3300013307 Ga0157372_10073041 Ga0157372_100730411 561
528 3300014745 Ga0157377_10027722 Ga0157377_100277223 561
529 3300014969 Ga0157376_10035368 Ga0157376_100353683 561
530 3300017792 Ga0163161_10015432 Ga0163161_100154321 561
531 3300025898 Ga0207692_10002768 Ga0207692_100027683 561
532 3300025899 Ga0207642_10000683 Ga0207642_100006838 561
533 3300025900 Ga0207710_10003996 Ga0207710_100039964 561
534 3300025901 Ga0207688_10006738 Ga0207688_100067387 561
535 3300025904 Ga0207647_10046366 Ga0207647_100463662 561
536 3300025906 Ga0207699_10037346 Ga0207699_100373462 561
537 3300025914 Ga0207671_10118140 Ga0207671_101181401 561
538 3300025915 Ga0207693_10014595 Ga0207693_100145951 561
539 3300025918 Ga0207662_10016120 Ga0207662_100161203 561
540 3300025919 Ga0207657_10026242 Ga0207657_100262424 561
541 3300025923 Ga0207681_10114770 Ga0207681_101147701 561
542 3300025924 Ga0207694_10083319 Ga0207694_100833192 561
543 3300025927 Ga0207687_10004540 Ga0207687_100045405 561
544 3300025931 Ga0207644_10035876 Ga0207644_100358763 561
545 3300025933 Ga0207706_10058426 Ga0207706_100584262 561
546 3300025934 Ga0207686_10009538 Ga0207686_100095381 561
547 3300025935 Ga0207709_10058672 Ga0207709_100586721 561
548 3300025936 Ga0207670_10037759 Ga0207670_100377592 561
549 3300025937 Ga0207669_10003377 Ga0207669_100033778 561
550 3300025938 Ga0207704_10015741 Ga0207704_100157412 561
551 3300025939 Ga0207665_10005671 Ga0207665_100056717 561
552 3300025940 Ga0207691_10036370 Ga0207691_100363702 561
553 3300025942 Ga0207689_10068601 Ga0207689_100686012 561
554 3300025949 Ga0207667_10150832 Ga0207667_101508323 561
555 3300025961 Ga0207712_10009304 Ga0207712_100093044 561
556 3300025972 Ga0207668_10083760 Ga0207668_100837601 561
557 3300025981 Ga0207640_10013306 Ga0207640_100133064 561
558 3300025986 Ga0207658_10011153 Ga0207658_100111535 561
559 3300026023 Ga0207677_10006998 Ga0207677_100069986 561
560 3300026041 Ga0207639_10016960 Ga0207639_100169602 561
561 3300026067 Ga0207678_10024989 Ga0207678_100249892 561
562 3300026075 Ga0207708_10015633 Ga0207708_100156333 561
563 3300026078 Ga0207702_10021660 Ga0207702_100216602 561
564 3300026089 Ga0207648_10015144 Ga0207648_100151447 561
565 3300026121 Ga0207683_10007032 Ga0207683_100070326 561
566 3300028380 Ga0268265_10133273 Ga0268265_101332731 561
567 3300035691 Ga0373931_0002731 Ga0373931_0002731_3147_4832 561
568 3300048903 Ga0496100_0008594 Ga0496100_0008594_2145_3830 561
569 3300048904 Ga0496101_0004916 Ga0496101_0004916_3795_5480 561
570 3300048905 Ga0496102_0020077 Ga0496102_0020077_2713_4398 561
571 3300048907 Ga0496104_0172295 Ga0496104_0172295_342_2027 561
572 3300048909 Ga0496106_0010749 Ga0496106_0010749_1169_2854 561
573 3300048917 Ga0496114_0004810 Ga0496114_0004810_4813_6498 561

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

56

227

0.77

PF00005

ABC_tran

ABC transporter

383

535

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8szz-assembly1.cif.gz_T cryoem structure of computationally designed nanocage o32-zl4 0.8293 257 310
4abm-assembly1.cif.gz_B crystal structure of chmp4b hairpin 0.823 253 310
5zxd-assembly1.cif.gz_A crystal structure of atp-bound human abcf1 0.8067 5 552
5zxd-assembly1.cif.gz_A crystal structure of atp-bound human abcf1 0.7751 5 552
6r84-assembly1.cif.gz_A yeast vms1 (q295l)-60s ribosomal subunit complex (pre-state with arb1) 0.7734 7 547
ID Description Score Start End Superfamily
af_Q57982_1_74_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9664 93 133 1.10.287.10
af_A0A1D6DXQ6_8_144_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9415 4 62 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9147 2 62 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.903 3 62 3.40.50.300
af_C0P4H6_339_588_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.855 301 548 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A535J7C1-F1-model_v4 ABC-F family ATP-binding cassette domain-containing protein 0.9596 1 551 GO:0005524
GO:0016887
AF-A0A535J7C1-F1-model_v4 ABC-F family ATP-binding cassette domain-containing protein 0.9561 1 551 GO:0005524
GO:0016887
AF-A0A3D3KW32-F1-model_v4 ABC transporter 0.9298 1 335 GO:0005524
GO:0016887
AF-A0A3D3KW32-F1-model_v4 ABC transporter 0.9271 1 335 GO:0005524
GO:0016887
AF-A0A7V8LI36-F1-model_v4 deleted 0.9224 2 560

Feature Viewer

pLDDT pTM Quality
92.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map