F465176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 372 | 514 | 553 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10034057|Ga0105244_100340572 |
| Length | 598 |
| Sequence | MAMISRLSWPVSSSLEGSFERGRPKMHGVRTAERFLVGYIDVSGISYSLADGRPLLDDVSFRVGEGSVSALIGANGAGKSTLLRIIRGDLKPDSGSIGIDGGLGVMDQFVGHVRDERTVRDLLVSVAPTAVRAAAEGLTAAEDAILERDELDTQLAYATALGEYADAGGYDHEVVWDHCTIAALGVPFERAQYRGLRSLSGGEQKRLALEALLRGPEQVLLLDEPDNYLDVPAKRWLEAELRATPKTXXXVSHDRELLANAADRIITLELGAAGNTVWTHGGGFGGYQQARDDRMARLEELRRRWDEEHAKLKALVLRMWEKAKYNSDVAPAYRAAQTRLAKFEEAGPPQLRPREQNVSMRLTGARTGRRVVECFSLELSGLMRPFDSEIWFGERIAVLGSNGSGKSHFLRLLAAGGTDPDPSAGHLASADQVGTPVAHTGVAKLGARVVPGLFAQAHEHPELIGRTLLEILHRGDDFRTGLPRDAASRVLDRYGLAGSSEQTFESLSGGQQARLQILLLELSGATLLLLDEPTDNLDLVSAEALEEGLRGFEGTVIAVTHDRWFARGFDRFLVFGSDGTVYESDTAVWDESRVTRSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 4 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 5 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 6 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 7 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 8 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 9 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 10 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 11 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 12 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 13 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 14 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 15 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 16 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 17 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 18 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 19 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 20 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 21 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 22 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 23 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 24 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 25 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 26 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 27 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 28 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 29 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 30 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 31 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 32 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 33 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 34 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 35 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 36 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 37 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 38 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 39 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 40 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 41 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 42 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 43 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 44 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 45 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 46 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 47 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 48 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 49 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 50 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 51 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 52 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 53 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 54 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 55 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 56 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 57 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 58 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 59 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 60 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 61 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 62 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 68 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 96 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 116 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 121 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 164 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 165 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 166 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 231 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 251 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 252 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 269 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 270 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 273 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 312 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 365 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 367 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 370 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 371 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 372 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.18 |
| Metatranscriptomes | 0.52 |
| Isolates | 10.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.28 |
| Nodule | 0 |
| Rhizoplane | 6.98 |
| Rhizosphere | 74.69 |
| Stem | 0 |
| Stem Tuber | 0.17 |
| Unclassified | 11.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10003351 | 3300002077 | Bacteria | 3290 |
| 2 | JGI24034J26672_10002339 | 3300002239 | Bacteria | 2600 |
| 3 | JGI24742J22300_10004839 | 3300002244 | Bacteria | 2211 |
| 4 | JGI25164J39214_1001647 | 3300002772 | Bacteria | 4619 |
| 5 | JGI25165J46597_1000061 | 3300003214 | Bacteria | 208362 |
| 6 | Ga0006562J51391_1002516 | 3300003578 | Bacteria | 10990 |
| 7 | Ga0006562J51391_1002517 | 3300003578 | Bacteria | 5030 |
| 8 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 9 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 10 | Ga0055525_1001046 | 3300003759 | Bacteria | 7185 |
| 11 | Ga0055525_1001748 | 3300003759 | Bacteria | 3121 |
| 12 | Ga0055527_1000017 | 3300003760 | Bacteria | 242362 |
| 13 | Ga0055542_1000044 | 3300003762 | Bacteria | 206982 |
| 14 | Ga0055529_1000279 | 3300003763 | Bacteria | 60946 |
| 15 | Ga0070676_10010227 | 3300005328 | Bacteria | 5089 |
| 16 | Ga0068869_100022252 | 3300005334 | Bacteria | 4366 |
| 17 | Ga0070680_100041296 | 3300005336 | Bacteria | 3740 |
| 18 | Ga0070682_100030501 | 3300005337 | Bacteria | 3255 |
| 19 | Ga0068868_100007142 | 3300005338 | Bacteria | 7938 |
| 20 | Ga0070660_100044982 | 3300005339 | Bacteria | 3378 |
| 21 | Ga0070660_100075211 | 3300005339 | Bacteria | 2644 |
| 22 | Ga0070689_100056454 | 3300005340 | Bacteria | 3044 |
| 23 | Ga0070691_10001503 | 3300005341 | Bacteria | 10012 |
| 24 | Ga0070687_100043954 | 3300005343 | Bacteria | 2274 |
| 25 | Ga0070668_100012150 | 3300005347 | Bacteria | 6413 |
| 26 | Ga0070668_100023202 | 3300005347 | Bacteria | 4692 |
| 27 | Ga0070669_100020467 | 3300005353 | Bacteria | 4726 |
| 28 | Ga0070671_100025657 | 3300005355 | Bacteria | 4838 |
| 29 | Ga0070688_100011461 | 3300005365 | Bacteria | 4926 |
| 30 | Ga0070659_100001112 | 3300005366 | Bacteria | 19613 |
| 31 | Ga0070659_100047953 | 3300005366 | Bacteria | 3353 |
| 32 | Ga0070659_100101810 | 3300005366 | Bacteria | 2312 |
| 33 | Ga0070667_100058732 | 3300005367 | Bacteria | 3252 |
| 34 | Ga0070703_10013806 | 3300005406 | Bacteria | 2297 |
| 35 | Ga0070709_10003834 | 3300005434 | Bacteria | 8092 |
| 36 | Ga0070714_100001322 | 3300005435 | Bacteria | 17907 |
| 37 | Ga0070714_100005084 | 3300005435 | Bacteria | 10009 |
| 38 | Ga0070714_100044804 | 3300005435 | Bacteria | 3746 |
| 39 | Ga0070714_100089560 | 3300005435 | Bacteria | 2694 |
| 40 | Ga0070714_100110539 | 3300005435 | Bacteria | 2433 |
| 41 | Ga0070713_100001527 | 3300005436 | Bacteria | 14772 |
| 42 | Ga0070710_10001526 | 3300005437 | Bacteria | 10942 |
| 43 | Ga0070710_10003868 | 3300005437 | Bacteria | 7083 |
| 44 | Ga0070701_10001376 | 3300005438 | Bacteria | 8979 |
| 45 | Ga0070711_100001298 | 3300005439 | Bacteria | 13594 |
| 46 | Ga0070700_100035827 | 3300005441 | Bacteria | 3006 |
| 47 | Ga0070694_100003044 | 3300005444 | Bacteria | 9988 |
| 48 | Ga0070663_100008709 | 3300005455 | Bacteria | 6254 |
| 49 | Ga0070678_100003051 | 3300005456 | Bacteria | 9279 |
| 50 | Ga0070681_10000092 | 3300005458 | Bacteria | 66067 |
| 51 | Ga0068867_100018245 | 3300005459 | Bacteria | 4986 |
| 52 | Ga0070685_10016348 | 3300005466 | Bacteria | 3953 |
| 53 | Ga0070698_100015325 | 3300005471 | Bacteria | 8101 |
| 54 | Ga0070679_100000009 | 3300005530 | Bacteria | 191579 |
| 55 | Ga0070679_100015989 | 3300005530 | Bacteria | 7226 |
| 56 | Ga0070679_100040593 | 3300005530 | Bacteria | 4629 |
| 57 | Ga0070684_100050208 | 3300005535 | Bacteria | 3622 |
| 58 | Ga0070684_100086763 | 3300005535 | Bacteria | 2778 |
| 59 | Ga0068853_100015450 | 3300005539 | Bacteria | 6272 |
| 60 | Ga0070696_100055789 | 3300005546 | Bacteria | 2755 |
| 61 | Ga0070693_100004959 | 3300005547 | Bacteria | 6355 |
| 62 | Ga0070665_100059230 | 3300005548 | Bacteria | 3839 |
| 63 | Ga0070665_100136751 | 3300005548 | Bacteria | 2453 |
| 64 | Ga0070704_100011383 | 3300005549 | Bacteria | 5450 |
| 65 | Ga0068855_100079606 | 3300005563 | Bacteria | 3800 |
| 66 | Ga0068854_100003477 | 3300005578 | Bacteria | 9835 |
| 67 | Ga0068856_100048778 | 3300005614 | Bacteria | 4174 |
| 68 | Ga0070702_100003129 | 3300005615 | Bacteria | 7331 |
| 69 | Ga0070702_100032412 | 3300005615 | Bacteria | 2867 |
| 70 | Ga0068859_100017732 | 3300005617 | Bacteria | 7158 |
| 71 | Ga0068866_10001286 | 3300005718 | Bacteria | 10867 |
| 72 | Ga0068863_100175277 | 3300005841 | Bacteria | 2058 |
| 73 | Ga0068858_100000016 | 3300005842 | Bacteria | 193130 |
| 74 | Ga0068858_100012623 | 3300005842 | Bacteria | 7964 |
| 75 | Ga0068860_100039609 | 3300005843 | Bacteria | 4507 |
| 76 | Ga0068860_100068368 | 3300005843 | Bacteria | 3375 |
| 77 | Ga0081455_10001393 | 3300005937 | Bacteria | 29861 |
| 78 | Ga0081455_10010089 | 3300005937 | Bacteria | 9630 |
| 79 | Ga0081455_10012756 | 3300005937 | Bacteria | 8357 |
| 80 | Ga0081455_10014109 | 3300005937 | Bacteria | 7854 |
| 81 | Ga0081538_10000264 | 3300005981 | Bacteria | 59881 |
| 82 | Ga0081539_10000238 | 3300005985 | Bacteria | 129119 |
| 83 | Ga0081539_10002050 | 3300005985 | Bacteria | 30294 |
| 84 | Ga0070717_10000413 | 3300006028 | Bacteria | 27333 |
| 85 | Ga0070717_10013074 | 3300006028 | Bacteria | 6343 |
| 86 | Ga0075363_100021019 | 3300006048 | Bacteria | 3280 |
| 87 | Ga0075364_10007063 | 3300006051 | Bacteria | 6638 |
| 88 | Ga0075364_10046864 | 3300006051 | Bacteria | 2815 |
| 89 | Ga0075432_10001019 | 3300006058 | Bacteria | 8891 |
| 90 | Ga0075432_10001893 | 3300006058 | Bacteria | 6936 |
| 91 | Ga0070715_10001773 | 3300006163 | Bacteria | 6420 |
| 92 | Ga0070716_100000451 | 3300006173 | Bacteria | 16997 |
| 93 | Ga0070716_100007313 | 3300006173 | Bacteria | 5433 |
| 94 | Ga0070712_100011966 | 3300006175 | Bacteria | 5515 |
| 95 | Ga0070712_100017360 | 3300006175 | Bacteria | 4659 |
| 96 | Ga0097621_100016649 | 3300006237 | Bacteria | 5564 |
| 97 | Ga0075370_10061351 | 3300006353 | Bacteria | 2142 |
| 98 | Ga0075428_100006889 | 3300006844 | Bacteria | 12625 |
| 99 | Ga0075428_100010070 | 3300006844 | Bacteria | 10503 |
| 100 | Ga0075430_100025796 | 3300006846 | Bacteria | 5001 |
| 101 | Ga0075431_100010112 | 3300006847 | Bacteria | 9482 |
| 102 | Ga0075431_100070801 | 3300006847 | Bacteria | 3598 |
| 103 | Ga0075433_10001532 | 3300006852 | Bacteria | 17068 |
| 104 | Ga0075434_100005228 | 3300006871 | Bacteria | 11791 |
| 105 | Ga0075434_100006176 | 3300006871 | Bacteria | 10969 |
| 106 | Ga0075429_100111723 | 3300006880 | Bacteria | 2388 |
| 107 | Ga0068865_100005382 | 3300006881 | Bacteria | 7756 |
| 108 | Ga0068865_100056359 | 3300006881 | Bacteria | 2738 |
| 109 | Ga0075436_100010308 | 3300006914 | Bacteria | 6400 |
| 110 | Ga0097620_100017732 | 3300006931 | Bacteria | 7158 |
| 111 | Ga0075435_100016247 | 3300007076 | Bacteria | 5611 |
| 112 | Ga0105244_10034057 | 3300009036 | Bacteria | 2684 |
| 113 | Ga0105250_10018818 | 3300009092 | Bacteria | 2794 |
| 114 | Ga0105240_10115403 | 3300009093 | Bacteria | 3242 |
| 115 | Ga0105240_10194768 | 3300009093 | Bacteria | 2381 |
| 116 | Ga0111539_10003621 | 3300009094 | Bacteria | 20353 |
| 117 | Ga0111539_10003666 | 3300009094 | Bacteria | 20226 |
| 118 | Ga0105245_10006958 | 3300009098 | Bacteria | 9919 |
| 119 | Ga0105245_10013491 | 3300009098 | Bacteria | 7117 |
| 120 | Ga0105245_10209850 | 3300009098 | Bacteria | 1874 |
| 121 | Ga0105247_10003161 | 3300009101 | Bacteria | 10856 |
| 122 | Ga0114129_10007034 | 3300009147 | Bacteria | 16018 |
| 123 | Ga0114129_10024589 | 3300009147 | Bacteria | 8535 |
| 124 | Ga0105243_10003243 | 3300009148 | Bacteria | 13268 |
| 125 | Ga0105243_10011970 | 3300009148 | Bacteria | 6558 |
| 126 | Ga0105241_10031704 | 3300009174 | Bacteria | 3958 |
| 127 | Ga0105242_10013303 | 3300009176 | Bacteria | 6355 |
| 128 | Ga0105242_10041559 | 3300009176 | Bacteria | 3709 |
| 129 | Ga0105248_10000880 | 3300009177 | Bacteria | 33648 |
| 130 | Ga0105248_10148538 | 3300009177 | Bacteria | 2644 |
| 131 | Ga0105237_10052001 | 3300009545 | Bacteria | 4114 |
| 132 | Ga0105237_10132497 | 3300009545 | Bacteria | 2487 |
| 133 | Ga0105238_10052842 | 3300009551 | Bacteria | 4084 |
| 134 | Ga0105249_10008124 | 3300009553 | Bacteria | 9150 |
| 135 | Ga0105249_10017913 | 3300009553 | Bacteria | 6294 |
| 136 | Ga0105239_10015491 | 3300010375 | Bacteria | 8446 |
| 137 | Ga0105239_10078916 | 3300010375 | Bacteria | 3623 |
| 138 | Ga0157370_10079955 | 3300013104 | Bacteria | 3078 |
| 139 | Ga0157369_10054906 | 3300013105 | Bacteria | 4301 |
| 140 | Ga0157369_10079172 | 3300013105 | Bacteria | 3520 |
| 141 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 142 | Ga0157374_10024151 | 3300013296 | Bacteria | 5447 |
| 143 | Ga0157374_10051438 | 3300013296 | Bacteria | 3834 |
| 144 | Ga0157378_10023725 | 3300013297 | Bacteria | 5396 |
| 145 | Ga0163162_10017114 | 3300013306 | Bacteria | 7093 |
| 146 | Ga0157372_10073041 | 3300013307 | Bacteria | 3866 |
| 147 | Ga0157372_10252706 | 3300013307 | Bacteria | 2046 |
| 148 | Ga0157375_10090767 | 3300013308 | Bacteria | 3115 |
| 149 | Ga0157375_10131974 | 3300013308 | Bacteria | 2618 |
| 150 | Ga0157377_10027722 | 3300014745 | Bacteria | 3044 |
| 151 | Ga0157376_10035368 | 3300014969 | Bacteria | 4041 |
| 152 | Ga0163161_10015432 | 3300017792 | Bacteria | 5326 |
| 153 | Ga0163161_10020812 | 3300017792 | Bacteria | 4606 |
| 154 | Ga0163161_10036458 | 3300017792 | Bacteria | 3521 |
| 155 | Ga0206353_10350813 | 3300020082 | Bacteria | 4579 |
| 156 | Ga0213874_10004103 | 3300021377 | Bacteria | 3291 |
| 157 | Ga0213876_10000676 | 3300021384 | Bacteria | 24257 |
| 158 | Ga0213876_10054335 | 3300021384 | Bacteria | 2115 |
| 159 | Ga0213875_10049946 | 3300021388 | Bacteria | 1960 |
| 160 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 161 | Ga0209672_100039 | 3300025228 | Bacteria | 283064 |
| 162 | Ga0209147_101049 | 3300025229 | Bacteria | 11708 |
| 163 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 164 | Ga0209563_100766 | 3300025230 | Bacteria | 9765 |
| 165 | Ga0207427_100042 | 3300025231 | Bacteria | 254170 |
| 166 | Ga0209437_101321 | 3300025233 | Bacteria | 6536 |
| 167 | Ga0209258_101806 | 3300025242 | Bacteria | 6557 |
| 168 | Ga0209646_1000088 | 3300025246 | Bacteria | 192345 |
| 169 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 170 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 171 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 172 | Ga0209455_1000117 | 3300025272 | Bacteria | 176940 |
| 173 | Ga0207692_10002768 | 3300025898 | Bacteria | 6761 |
| 174 | Ga0207642_10000683 | 3300025899 | Bacteria | 10441 |
| 175 | Ga0207642_10016311 | 3300025899 | Bacteria | 2794 |
| 176 | Ga0207710_10003996 | 3300025900 | Bacteria | 6503 |
| 177 | Ga0207688_10001884 | 3300025901 | Bacteria | 11227 |
| 178 | Ga0207688_10006738 | 3300025901 | Bacteria | 6249 |
| 179 | Ga0207647_10046366 | 3300025904 | Bacteria | 2709 |
| 180 | Ga0207699_10001501 | 3300025906 | Bacteria | 11075 |
| 181 | Ga0207699_10037346 | 3300025906 | Bacteria | 2776 |
| 182 | Ga0207705_10022908 | 3300025909 | Bacteria | 4453 |
| 183 | Ga0207707_10000174 | 3300025912 | Bacteria | 66915 |
| 184 | Ga0207695_10005496 | 3300025913 | Bacteria | 16776 |
| 185 | Ga0207671_10118140 | 3300025914 | Bacteria | 2025 |
| 186 | Ga0207693_10002722 | 3300025915 | Bacteria | 15309 |
| 187 | Ga0207693_10004743 | 3300025915 | Bacteria | 11434 |
| 188 | Ga0207693_10014595 | 3300025915 | Bacteria | 6312 |
| 189 | Ga0207663_10001616 | 3300025916 | Bacteria | 10610 |
| 190 | Ga0207663_10032315 | 3300025916 | Bacteria | 3106 |
| 191 | Ga0207663_10101710 | 3300025916 | Bacteria | 1931 |
| 192 | Ga0207662_10016120 | 3300025918 | Bacteria | 4213 |
| 193 | Ga0207657_10026242 | 3300025919 | Bacteria | 5357 |
| 194 | Ga0207649_10022947 | 3300025920 | Bacteria | 3608 |
| 195 | Ga0207652_10000070 | 3300025921 | Bacteria | 109705 |
| 196 | Ga0207646_10067741 | 3300025922 | Bacteria | 3187 |
| 197 | Ga0207681_10114770 | 3300025923 | Bacteria | 1965 |
| 198 | Ga0207694_10083319 | 3300025924 | Bacteria | 2515 |
| 199 | Ga0207687_10004540 | 3300025927 | Bacteria | 9236 |
| 200 | Ga0207687_10013434 | 3300025927 | Bacteria | 5345 |
| 201 | Ga0207700_10002316 | 3300025928 | Bacteria | 10926 |
| 202 | Ga0207664_10000417 | 3300025929 | Bacteria | 30395 |
| 203 | Ga0207664_10003739 | 3300025929 | Bacteria | 10217 |
| 204 | Ga0207664_10064969 | 3300025929 | Bacteria | 2920 |
| 205 | Ga0207644_10035876 | 3300025931 | Bacteria | 3478 |
| 206 | Ga0207690_10003341 | 3300025932 | Bacteria | 9588 |
| 207 | Ga0207706_10012551 | 3300025933 | Bacteria | 7716 |
| 208 | Ga0207706_10058426 | 3300025933 | Bacteria | 3397 |
| 209 | Ga0207686_10009538 | 3300025934 | Bacteria | 5266 |
| 210 | Ga0207709_10005768 | 3300025935 | Bacteria | 6996 |
| 211 | Ga0207709_10029256 | 3300025935 | Bacteria | 3193 |
| 212 | Ga0207709_10058672 | 3300025935 | Bacteria | 2393 |
| 213 | Ga0207670_10037759 | 3300025936 | Bacteria | 3149 |
| 214 | Ga0207669_10003377 | 3300025937 | Bacteria | 6902 |
| 215 | Ga0207704_10015741 | 3300025938 | Bacteria | 3864 |
| 216 | Ga0207665_10000320 | 3300025939 | Bacteria | 33314 |
| 217 | Ga0207665_10005671 | 3300025939 | Bacteria | 8317 |
| 218 | Ga0207665_10016216 | 3300025939 | Bacteria | 4892 |
| 219 | Ga0207691_10036370 | 3300025940 | Bacteria | 4562 |
| 220 | Ga0207711_10005166 | 3300025941 | Bacteria | 11061 |
| 221 | Ga0207689_10068601 | 3300025942 | Bacteria | 2914 |
| 222 | Ga0207667_10002042 | 3300025949 | Bacteria | 25307 |
| 223 | Ga0207667_10150832 | 3300025949 | Bacteria | 2392 |
| 224 | Ga0207667_10152961 | 3300025949 | Bacteria | 2374 |
| 225 | Ga0207712_10009304 | 3300025961 | Bacteria | 6215 |
| 226 | Ga0207712_10013614 | 3300025961 | Bacteria | 5216 |
| 227 | Ga0207668_10029087 | 3300025972 | Bacteria | 3619 |
| 228 | Ga0207668_10083760 | 3300025972 | Bacteria | 2321 |
| 229 | Ga0207640_10013306 | 3300025981 | Bacteria | 4711 |
| 230 | Ga0207658_10011153 | 3300025986 | Bacteria | 6119 |
| 231 | Ga0207658_10088123 | 3300025986 | Bacteria | 2398 |
| 232 | Ga0207677_10006998 | 3300026023 | Bacteria | 6206 |
| 233 | Ga0207703_10000345 | 3300026035 | Bacteria | 49953 |
| 234 | Ga0207639_10016960 | 3300026041 | Bacteria | 5160 |
| 235 | Ga0207678_10024989 | 3300026067 | Bacteria | 5217 |
| 236 | Ga0207678_10150882 | 3300026067 | Bacteria | 1984 |
| 237 | Ga0207708_10015633 | 3300026075 | Bacteria | 5692 |
| 238 | Ga0207702_10021660 | 3300026078 | Bacteria | 5322 |
| 239 | Ga0207648_10015144 | 3300026089 | Bacteria | 7098 |
| 240 | Ga0207675_100028254 | 3300026118 | Bacteria | 5222 |
| 241 | Ga0207675_100062744 | 3300026118 | Bacteria | 3472 |
| 242 | Ga0207683_10007032 | 3300026121 | Bacteria | 9650 |
| 243 | Ga0207683_10046752 | 3300026121 | Bacteria | 3789 |
| 244 | Ga0207698_10044070 | 3300026142 | Bacteria | 3348 |
| 245 | Ga0207428_10000964 | 3300027907 | Bacteria | 31921 |
| 246 | Ga0207428_10003341 | 3300027907 | Bacteria | 15600 |
| 247 | Ga0268265_10124555 | 3300028380 | Bacteria | 2130 |
| 248 | Ga0268265_10133273 | 3300028380 | Bacteria | 2068 |
| 249 | Ga0307515_10082545 | 3300028794 | Bacteria | 4154 |
| 250 | Ga0307512_10003678 | 3300030522 | Bacteria | 17481 |
| 251 | Ga0265320_10028670 | 3300031240 | Bacteria | 2888 |
| 252 | Ga0265325_10002844 | 3300031241 | Bacteria | 11539 |
| 253 | Ga0265327_10000138 | 3300031251 | Bacteria | 160313 |
| 254 | Ga0265327_10004793 | 3300031251 | Bacteria | 11756 |
| 255 | Ga0265316_10107160 | 3300031344 | Bacteria | 2119 |
| 256 | Ga0307514_10008438 | 3300031649 | Bacteria | 8780 |
| 257 | Ga0316579_10025169 | 3300031691 | Bacteria | 2685 |
| 258 | Ga0265314_10043050 | 3300031711 | Bacteria | 3214 |
| 259 | Ga0316576_10018315 | 3300031727 | Bacteria | 4778 |
| 260 | Ga0307405_10001317 | 3300031731 | Bacteria | 10385 |
| 261 | Ga0316577_10061345 | 3300031733 | Bacteria | 2098 |
| 262 | Ga0307413_10000082 | 3300031824 | Bacteria | 23658 |
| 263 | Ga0307410_10000502 | 3300031852 | Bacteria | 15911 |
| 264 | Ga0307410_10003335 | 3300031852 | Bacteria | 8034 |
| 265 | Ga0307410_10014909 | 3300031852 | Bacteria | 4592 |
| 266 | Ga0307406_10000895 | 3300031901 | Bacteria | 16751 |
| 267 | Ga0307406_10000932 | 3300031901 | Bacteria | 16339 |
| 268 | Ga0307406_10004930 | 3300031901 | Bacteria | 7271 |
| 269 | Ga0307406_10042666 | 3300031901 | Bacteria | 2833 |
| 270 | Ga0307406_10059380 | 3300031901 | Bacteria | 2462 |
| 271 | Ga0307407_10010679 | 3300031903 | Bacteria | 4340 |
| 272 | Ga0307407_10014338 | 3300031903 | Bacteria | 3877 |
| 273 | Ga0307412_10017184 | 3300031911 | Bacteria | 4327 |
| 274 | Ga0307409_100000050 | 3300031995 | Bacteria | 42042 |
| 275 | Ga0307409_100002047 | 3300031995 | Bacteria | 10353 |
| 276 | Ga0307409_100006594 | 3300031995 | Bacteria | 6843 |
| 277 | Ga0307416_100000150 | 3300032002 | Bacteria | 41366 |
| 278 | Ga0307416_100006316 | 3300032002 | Bacteria | 7409 |
| 279 | Ga0307416_100090070 | 3300032002 | Bacteria | 2629 |
| 280 | Ga0307414_10002253 | 3300032004 | Bacteria | 10077 |
| 281 | Ga0307414_10003797 | 3300032004 | Bacteria | 8118 |
| 282 | Ga0307414_10027298 | 3300032004 | Bacteria | 3688 |
| 283 | Ga0307415_100001151 | 3300032126 | Bacteria | 12363 |
| 284 | Ga0307415_100009552 | 3300032126 | Bacteria | 5445 |
| 285 | Ga0316583_10012970 | 3300032133 | Bacteria | 3006 |
| 286 | Ga0307507_10000017 | 3300033179 | Bacteria | 224506 |
| 287 | Ga0307507_10084728 | 3300033179 | Bacteria | 2761 |
| 288 | Ga0373954_0058447 | 3300035118 | Bacteria | 1817 |
| 289 | Ga0373956_0005060 | 3300035119 | Bacteria | 5278 |
| 290 | Ga0316574_0013330 | 3300035398 | Bacteria | 4721 |
| 291 | Ga0316574_0015583 | 3300035398 | Bacteria | 4413 |
| 292 | Ga0373931_0002731 | 3300035691 | Bacteria | 7846 |
| 293 | Ga0316584_0007978 | 3300036712 | Bacteria | 7268 |
| 294 | Ga0316584_0011344 | 3300036712 | Bacteria | 6259 |
| 295 | Ga0316584_0021716 | 3300036712 | Bacteria | 4669 |
| 296 | Ga0395900_0018238 | 3300037418 | Bacteria | 7160 |
| 297 | Ga0395898_0000381 | 3300037466 | Bacteria | 97274 |
| 298 | Ga0395898_0016072 | 3300037466 | Bacteria | 7668 |
| 299 | Ga0395905_0200529 | 3300037471 | Bacteria | 1871 |
| 300 | Ga0436364_0915257 | 3300037853 | Bacteria | 20960 |
| 301 | Ga0436364_1108321 | 3300037853 | Bacteria | 3757 |
| 302 | Ga0436364_1348147 | 3300037853 | Bacteria | 2558 |
| 303 | Ga0395901_0011246 | 3300038443 | Bacteria | 9067 |
| 304 | Ga0395901_0044108 | 3300038443 | Bacteria | 4625 |
| 305 | Ga0436365_0094667 | 3300039437 | Bacteria | 4688 |
| 306 | Ga0436365_0296904 | 3300039437 | Bacteria | 5669 |
| 307 | Ga0436365_0561521 | 3300039437 | Bacteria | 6593 |
| 308 | Ga0436365_0747521 | 3300039437 | Bacteria | 20665 |
| 309 | Ga0436365_1257400 | 3300039437 | Bacteria | 59519 |
| 310 | Ga0436365_1313710 | 3300039437 | Bacteria | 6622 |
| 311 | Ga0436365_1501762 | 3300039437 | Bacteria | 11122 |
| 312 | Ga0436360_0661207 | 3300039438 | Bacteria | 1549 |
| 313 | Ga0436363_0064533 | 3300039450 | Bacteria | 2686 |
| 314 | Ga0436363_1430762 | 3300039450 | Bacteria | 4975 |
| 315 | Ga0436362_0339593 | 3300039453 | Bacteria | 5460 |
| 316 | Ga0451791_0254429 | 3300041451 | Bacteria | 1691 |
| 317 | Ga0451791_1058766 | 3300041451 | Bacteria | 3764 |
| 318 | Ga0451793_0234284 | 3300041452 | Bacteria | 6557 |
| 319 | Ga0451839_1432976 | 3300041496 | Bacteria | 3470 |
| 320 | Ga0439463_002957 | 3300042016 | Bacteria | 4312 |
| 321 | Ga0439463_015219 | 3300042016 | Bacteria | 1902 |
| 322 | Ga0439464_0007068 | 3300042439 | Bacteria | 2934 |
| 323 | Ga0451577_0001490 | 3300042876 | Bacteria | 30999 |
| 324 | Ga0439440_0010804 | 3300042993 | Bacteria | 1916 |
| 325 | Ga0466961_0015646 | 3300044693 | Bacteria | 4867 |
| 326 | Ga0466963_0003069 | 3300044694 | Bacteria | 9459 |
| 327 | Ga0453684_0007203 | 3300044712 | Bacteria | 20638 |
| 328 | Ga0466970_0017761 | 3300044765 | Bacteria | 3678 |
| 329 | Ga0466970_0017955 | 3300044765 | Bacteria | 3660 |
| 330 | Ga0466959_0006000 | 3300045049 | Bacteria | 8382 |
| 331 | Ga0466959_0107069 | 3300045049 | Bacteria | 1998 |
| 332 | Ga0466958_0000255 | 3300045836 | Bacteria | 20624 |
| 333 | Ga0466958_0002346 | 3300045836 | Bacteria | 9465 |
| 334 | Ga0466958_0011178 | 3300045836 | Bacteria | 5050 |
| 335 | Ga0466958_0025107 | 3300045836 | Bacteria | 3510 |
| 336 | Ga0466958_0046944 | 3300045836 | Bacteria | 2607 |
| 337 | Ga0466958_0063851 | 3300045836 | Bacteria | 2246 |
| 338 | Ga0466958_0070198 | 3300045836 | Bacteria | 2143 |
| 339 | Ga0466967_0015398 | 3300045976 | Bacteria | 5992 |
| 340 | Ga0466967_0017853 | 3300045976 | Bacteria | 5651 |
| 341 | Ga0495627_001457 | 3300046453 | Bacteria | 13875 |
| 342 | Ga0495629_0162333 | 3300046459 | Bacteria | 1552 |
| 343 | Ga0495641_0020421 | 3300046461 | Bacteria | 3359 |
| 344 | Ga0495653_0013339 | 3300046463 | Bacteria | 6696 |
| 345 | Ga0495628_0033353 | 3300046516 | Bacteria | 4151 |
| 346 | Ga0495628_0074669 | 3300046516 | Bacteria | 2641 |
| 347 | Ga0495652_0128164 | 3300046529 | Bacteria | 2013 |
| 348 | Ga0495587_0025825 | 3300046536 | Bacteria | 3587 |
| 349 | Ga0495667_0115502 | 3300046559 | Bacteria | 1734 |
| 350 | Ga0495599_0046415 | 3300046678 | Bacteria | 2724 |
| 351 | Ga0495646_0006916 | 3300046680 | Bacteria | 7201 |
| 352 | Ga0495613_0011083 | 3300046689 | Bacteria | 6694 |
| 353 | Ga0495672_0012093 | 3300047320 | Bacteria | 6043 |
| 354 | Ga0495680_0003021 | 3300047322 | Bacteria | 16778 |
| 355 | Ga0495675_0076543 | 3300047444 | Bacteria | 2109 |
| 356 | Ga0495684_0019823 | 3300047471 | Bacteria | 5182 |
| 357 | Ga0496100_0008594 | 3300048903 | Bacteria | 5700 |
| 358 | Ga0496101_0004916 | 3300048904 | Bacteria | 8481 |
| 359 | Ga0496101_0012510 | 3300048904 | Bacteria | 5663 |
| 360 | Ga0496102_0004460 | 3300048905 | Bacteria | 11812 |
| 361 | Ga0496102_0020077 | 3300048905 | Bacteria | 5898 |
| 362 | Ga0496102_0057324 | 3300048905 | Bacteria | 3557 |
| 363 | Ga0496102_0082020 | 3300048905 | Bacteria | 2974 |
| 364 | Ga0496103_0017406 | 3300048906 | Bacteria | 4302 |
| 365 | Ga0496103_0029408 | 3300048906 | Bacteria | 3339 |
| 366 | Ga0496104_0004952 | 3300048907 | Bacteria | 11623 |
| 367 | Ga0496104_0016185 | 3300048907 | Bacteria | 6769 |
| 368 | Ga0496104_0067801 | 3300048907 | Bacteria | 3390 |
| 369 | Ga0496104_0172295 | 3300048907 | Bacteria | 2075 |
| 370 | Ga0496105_0001397 | 3300048908 | Bacteria | 16954 |
| 371 | Ga0496105_0009927 | 3300048908 | Bacteria | 7467 |
| 372 | Ga0496105_0020520 | 3300048908 | Bacteria | 5340 |
| 373 | Ga0496105_0042674 | 3300048908 | Bacteria | 3740 |
| 374 | Ga0496105_0054876 | 3300048908 | Bacteria | 3290 |
| 375 | Ga0496106_0010749 | 3300048909 | Bacteria | 6765 |
| 376 | Ga0496107_0118794 | 3300048910 | Bacteria | 1947 |
| 377 | Ga0496108_0000472 | 3300048911 | Bacteria | 32264 |
| 378 | Ga0496108_0042683 | 3300048911 | Bacteria | 3786 |
| 379 | Ga0496108_0043180 | 3300048911 | Bacteria | 3766 |
| 380 | Ga0496108_0043709 | 3300048911 | Bacteria | 3742 |
| 381 | Ga0496108_0076220 | 3300048911 | Bacteria | 2834 |
| 382 | Ga0496108_0106696 | 3300048911 | Bacteria | 2392 |
| 383 | Ga0496109_0044305 | 3300048912 | Bacteria | 4036 |
| 384 | Ga0496109_0097363 | 3300048912 | Bacteria | 2727 |
| 385 | Ga0496110_0004337 | 3300048913 | Bacteria | 10977 |
| 386 | Ga0496110_0034495 | 3300048913 | Bacteria | 4383 |
| 387 | Ga0496110_0036562 | 3300048913 | Bacteria | 4264 |
| 388 | Ga0496110_0118205 | 3300048913 | Bacteria | 2387 |
| 389 | Ga0496112_0100800 | 3300048915 | Bacteria | 2857 |
| 390 | Ga0496113_0146760 | 3300048916 | Bacteria | 1859 |
| 391 | Ga0496114_0004810 | 3300048917 | Bacteria | 10519 |
| 392 | Ga0496114_0015500 | 3300048917 | Bacteria | 6127 |
| 393 | Ga0496114_0148232 | 3300048917 | Bacteria | 2035 |
| 394 | Ga0496117_0001718 | 3300048920 | Bacteria | 30310 |
| 395 | Ga0496117_0012087 | 3300048920 | Bacteria | 7661 |
| 396 | Ga0496117_0040411 | 3300048920 | Bacteria | 3430 |
| 397 | Ga0496119_0000437 | 3300048922 | Bacteria | 57106 |
| 398 | Ga0496120_0023496 | 3300048923 | Bacteria | 3859 |
| 399 | Ga0496122_0011256 | 3300048925 | Bacteria | 9090 |
| 400 | Ga0496125_0002545 | 3300048928 | Bacteria | 23516 |
| 401 | Ga0496125_0006238 | 3300048928 | Bacteria | 12963 |
| 402 | Ga0496125_0012012 | 3300048928 | Bacteria | 8623 |
| 403 | Ga0496125_0043469 | 3300048928 | Bacteria | 3813 |
| 404 | Ga0496126_0009429 | 3300048929 | Bacteria | 10363 |
| 405 | Ga0496126_0030861 | 3300048929 | Bacteria | 5073 |
| 406 | Ga0501031_0000962 | 3300049568 | Bacteria | 17461 |
| 407 | Ga0501031_0005234 | 3300049568 | Bacteria | 8456 |
| 408 | Ga0501031_0009118 | 3300049568 | Bacteria | 6454 |
| 409 | Ga0501032_0004528 | 3300049569 | Bacteria | 10456 |
| 410 | Ga0501032_0030351 | 3300049569 | Bacteria | 3709 |
| 411 | Ga0501034_0000910 | 3300049571 | Bacteria | 43164 |
| 412 | Ga0501034_0004867 | 3300049571 | Bacteria | 14811 |
| 413 | Ga0501034_0010823 | 3300049571 | Bacteria | 9476 |
| 414 | Ga0501034_0121234 | 3300049571 | Bacteria | 2601 |
| 415 | Ga0501034_0202929 | 3300049571 | Bacteria | 1940 |
| 416 | Ga0501036_0000459 | 3300049572 | Bacteria | 29154 |
| 417 | Ga0501036_0004810 | 3300049572 | Bacteria | 10917 |
| 418 | Ga0501036_0017176 | 3300049572 | Bacteria | 6048 |
| 419 | Ga0501036_0098707 | 3300049572 | Bacteria | 2469 |
| 420 | Ga0501037_0002189 | 3300049573 | Bacteria | 14138 |
| 421 | Ga0501037_0063279 | 3300049573 | Bacteria | 2697 |
| 422 | Ga0501038_0022776 | 3300049574 | Bacteria | 5608 |
| 423 | Ga0501038_0030194 | 3300049574 | Bacteria | 4798 |
| 424 | Ga0501039_0005821 | 3300049575 | Bacteria | 9335 |
| 425 | Ga0501040_0007079 | 3300049576 | Bacteria | 7270 |
| 426 | Ga0501040_0016936 | 3300049576 | Bacteria | 4832 |
| 427 | Ga0501040_0053629 | 3300049576 | Bacteria | 2762 |
| 428 | Ga0501041_0064989 | 3300049577 | Bacteria | 2234 |
| 429 | Ga0501042_0002441 | 3300049578 | Bacteria | 11407 |
| 430 | Ga0501042_0010640 | 3300049578 | Bacteria | 6180 |
| 431 | Ga0501042_0014671 | 3300049578 | Bacteria | 5351 |
| 432 | Ga0501042_0102403 | 3300049578 | Bacteria | 2060 |
| 433 | Ga0501043_0002716 | 3300049579 | Bacteria | 14811 |
| 434 | Ga0501043_0026532 | 3300049579 | Bacteria | 4545 |
| 435 | Ga0501046_0003277 | 3300049580 | Bacteria | 14864 |
| 436 | Ga0501046_0008161 | 3300049580 | Bacteria | 9148 |
| 437 | Ga0501046_0038684 | 3300049580 | Bacteria | 3826 |
| 438 | Ga0501047_0018200 | 3300049581 | Bacteria | 6732 |
| 439 | Ga0501047_0027920 | 3300049581 | Bacteria | 5439 |
| 440 | Ga0501047_0028269 | 3300049581 | Bacteria | 5405 |
| 441 | Ga0501048_0002442 | 3300049582 | Bacteria | 14185 |
| 442 | Ga0501048_0008269 | 3300049582 | Bacteria | 7870 |
| 443 | Ga0501048_0021473 | 3300049582 | Bacteria | 4727 |
| 444 | Ga0501068_0008750 | 3300049584 | Bacteria | 5647 |
| 445 | Ga0501069_0003890 | 3300049585 | Bacteria | 7697 |
| 446 | Ga0501070_0001332 | 3300049586 | Bacteria | 22064 |
| 447 | Ga0501070_0002352 | 3300049586 | Bacteria | 16602 |
| 448 | Ga0501070_0004032 | 3300049586 | Bacteria | 12616 |
| 449 | Ga0501070_0060611 | 3300049586 | Bacteria | 3136 |
| 450 | Ga0501070_0072478 | 3300049586 | Bacteria | 2851 |
| 451 | Ga0501071_0000654 | 3300049587 | Bacteria | 18059 |
| 452 | Ga0501072_0003041 | 3300049588 | Bacteria | 12653 |
| 453 | Ga0501072_0045321 | 3300049588 | Bacteria | 3457 |
| 454 | Ga0501073_0016747 | 3300049589 | Bacteria | 5311 |
| 455 | Ga0501074_0001816 | 3300049590 | Bacteria | 14607 |
| 456 | Ga0501074_0012382 | 3300049590 | Bacteria | 6200 |
| 457 | Ga0501075_0005478 | 3300049591 | Bacteria | 8679 |
| 458 | Ga0501075_0010882 | 3300049591 | Bacteria | 6418 |
| 459 | Ga0501075_0049787 | 3300049591 | Bacteria | 3149 |
| 460 | Ga0501076_0005227 | 3300049592 | Bacteria | 9304 |
| 461 | Ga0501076_0019672 | 3300049592 | Bacteria | 5162 |
| 462 | Ga0501076_0054338 | 3300049592 | Bacteria | 3174 |
| 463 | Ga0501077_0025156 | 3300049593 | Bacteria | 3781 |
| 464 | Ga0501079_0001234 | 3300049741 | Bacteria | 17906 |
| 465 | Ga0501080_0000473 | 3300049742 | Bacteria | 31252 |
| 466 | Ga0501080_0012985 | 3300049742 | Bacteria | 7648 |
| 467 | Ga0501080_0018519 | 3300049742 | Bacteria | 6441 |
| 468 | Ga0501080_0026537 | 3300049742 | Bacteria | 5382 |
| 469 | Ga0501081_0005886 | 3300049743 | Bacteria | 7937 |
| 470 | Ga0501081_0055845 | 3300049743 | Bacteria | 2728 |
| 471 | Ga0501083_0000795 | 3300049744 | Bacteria | 20733 |
| 472 | Ga0501035_0002239 | 3300049822 | Bacteria | 19166 |
| 473 | Ga0501035_0034180 | 3300049822 | Bacteria | 4621 |
| 474 | Ga0501035_0039322 | 3300049822 | Bacteria | 4281 |
| 475 | Ga0501044_0016031 | 3300049823 | Bacteria | 8060 |
| 476 | Ga0501044_0035379 | 3300049823 | Bacteria | 5230 |
| 477 | Ga0501044_0173282 | 3300049823 | Bacteria | 2128 |
| 478 | Ga0501045_0019688 | 3300049824 | Bacteria | 4815 |
| 479 | Ga0501045_0089798 | 3300049824 | Bacteria | 2270 |
| 480 | nmdc:mga00v17_50599_c1 | 3300050491 | Bacteria | 2525 |
| 481 | nmdc:mga0yw44_7068_c1 | 3300050492 | Bacteria | 5494 |
| 482 | nmdc:mga05p37_707_c1 | 3300050507 | Bacteria | 37015 |
| 483 | nmdc:mga09592_5971_c1 | 3300050508 | Bacteria | 9927 |
| 484 | nmdc:mga0qj67_33_c3 | 3300050509 | Bacteria | 9892 |
| 485 | nmdc:mga06r32_1_c1 | 3300050510 | Bacteria | 147976 |
| 486 | nmdc:mga06r32_33846_c1 | 3300050510 | Bacteria | 4815 |
| 487 | nmdc:mga08y16_26425_c1 | 3300050511 | Bacteria | 6122 |
| 488 | nmdc:mga0n895_6199_c1 | 3300050512 | Bacteria | 10115 |
| 489 | nmdc:mga0rr50_12402_c1 | 3300050513 | Bacteria | 5508 |
| 490 | nmdc:mga08x19_3272_c1 | 3300050514 | Bacteria | 9693 |
| 491 | Ga0495601_0058500 | 3300053077 | Bacteria | 2443 |
| 492 | Ga0495612_0011571 | 3300053078 | Bacteria | 3554 |
| 493 | Ga0500635_0000664 | 3300053080 | Bacteria | 8729 |
| 494 | Ga0495619_0005982 | 3300053085 | Bacteria | 7702 |
| 495 | Ga0500651_0003063 | 3300053093 | Bacteria | 9045 |
| 496 | Ga0500641_0001776 | 3300053096 | Bacteria | 7633 |
| 497 | Ga0500556_0000426 | 3300053104 | Bacteria | 30343 |
| 498 | Ga0500559_0000050 | 3300053136 | Bacteria | 93262 |
| 499 | Ga0500573_0002056 | 3300053140 | Bacteria | 9889 |
| 500 | Ga0500573_0006455 | 3300053140 | Bacteria | 6350 |
| 501 | Ga0500590_013523 | 3300053148 | Bacteria | 4191 |
| 502 | Ga0500620_006216 | 3300053155 | Bacteria | 2843 |
| 503 | Ga0501084_0002423 | 3300054114 | Bacteria | 15013 |
| 504 | Ga0501084_0006412 | 3300054114 | Bacteria | 9672 |
| 505 | Ga0501084_0028555 | 3300054114 | Bacteria | 4663 |
| 506 | Ga0501084_0111511 | 3300054114 | Bacteria | 2299 |
| 507 | Ga0501082_0009581 | 3300060353 | Bacteria | 8336 |
| 508 | Ga0501082_0017542 | 3300060353 | Bacteria | 6166 |
| 509 | Ga0501082_0029897 | 3300060353 | Bacteria | 4693 |
| 510 | Ga0466962_0014488 | 3300061719 | Bacteria | 3800 |
| 511 | Ga0466962_0052983 | 3300061719 | Bacteria | 1939 |
| 512 | Ga0530510_0006453 | 3300061734 | Bacteria | 8167 |
| 513 | Ga0530510_0013748 | 3300061734 | Bacteria | 5698 |
| 514 | Ga0530510_0096225 | 3300061734 | Bacteria | 2164 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046678 | Ga0495599_0046415 | Ga0495599_0046415_438_1766 | 429 |
| 2 | 3300039438 | Ga0436360_0661207 | Ga0436360_0661207_53_1384 | 430 |
| 3 | 3300046459 | Ga0495629_0162333 | Ga0495629_0162333_44_1477 | 460 |
| 4 | 3300036712 | Ga0316584_0011344 | Ga0316584_0011344_703_2322 | 486 |
| 5 | 3300017792 | Ga0163161_10036458 | Ga0163161_100364581 | 488 |
| 6 | 3300049586 | Ga0501070_0060611 | Ga0501070_0060611_1628_3103 | 488 |
| 7 | 3300045836 | Ga0466958_0025107 | Ga0466958_0025107_736_2430 | 494 |
| 8 | 3300039437 | Ga0436365_0296904 | Ga0436365_0296904_3920_5479 | 500 |
| 9 | 3300042016 | Ga0439463_002957 | Ga0439463_002957_178_1689 | 500 |
| 10 | 3300047444 | Ga0495675_0076543 | Ga0495675_0076543_436_2052 | 509 |
| 11 | 3300042876 | Ga0451577_0001490 | Ga0451577_0001490_11944_13608 | 512 |
| 12 | 3300044712 | Ga0453684_0007203 | Ga0453684_0007203_14366_16030 | 512 |
| 13 | 3300046559 | Ga0495667_0115502 | Ga0495667_0115502_100_1689 | 512 |
| 14 | 3300049584 | Ga0501068_0008750 | Ga0501068_0008750_2513_4123 | 513 |
| 15 | 3300045836 | Ga0466958_0011178 | Ga0466958_0011178_545_2209 | 515 |
| 16 | 3300005615 | Ga0070702_100032412 | Ga0070702_1000324122 | 516 |
| 17 | 3300017792 | Ga0163161_10020812 | Ga0163161_100208123 | 516 |
| 18 | 3300025922 | Ga0207646_10067741 | Ga0207646_100677412 | 516 |
| 19 | 3300041451 | Ga0451791_0254429 | Ga0451791_0254429_50_1681 | 517 |
| 20 | 3300047320 | Ga0495672_0012093 | Ga0495672_0012093_1543_3171 | 517 |
| 21 | 3300061734 | Ga0530510_0013748 | Ga0530510_0013748_4018_5658 | 517 |
| 22 | 3300031901 | Ga0307406_10059380 | Ga0307406_100593802 | 518 |
| 23 | 3300033179 | Ga0307507_10084728 | Ga0307507_100847282 | 518 |
| 24 | 3300009147 | Ga0114129_10007034 | Ga0114129_1000703424 | 519 |
| 25 | 3300032002 | Ga0307416_100090070 | Ga0307416_1000900702 | 519 |
| 26 | 3300049568 | Ga0501031_0009118 | Ga0501031_0009118_1684_3324 | 519 |
| 27 | 3300049569 | Ga0501032_0030351 | Ga0501032_0030351_1381_3021 | 519 |
| 28 | 3300049572 | Ga0501036_0004810 | Ga0501036_0004810_3441_5081 | 519 |
| 29 | 3300049575 | Ga0501039_0005821 | Ga0501039_0005821_3977_5617 | 519 |
| 30 | 3300049576 | Ga0501040_0007079 | Ga0501040_0007079_401_2041 | 519 |
| 31 | 3300049578 | Ga0501042_0010640 | Ga0501042_0010640_494_2134 | 519 |
| 32 | 3300049588 | Ga0501072_0003041 | Ga0501072_0003041_6726_8366 | 519 |
| 33 | 3300049591 | Ga0501075_0005478 | Ga0501075_0005478_4911_6551 | 519 |
| 34 | 3300049593 | Ga0501077_0025156 | Ga0501077_0025156_1901_3541 | 519 |
| 35 | 3300049743 | Ga0501081_0005886 | Ga0501081_0005886_3987_5627 | 519 |
| 36 | 3300049824 | Ga0501045_0089798 | Ga0501045_0089798_68_1696 | 519 |
| 37 | 3300050507 | nmdc:mga05p37_707_c1 | nmdc:mga05p37_707_c1_29758_31350 | 519 |
| 38 | 3300050508 | nmdc:mga09592_5971_c1 | nmdc:mga09592_5971_c1_101_1693 | 519 |
| 39 | 3300050509 | nmdc:mga0qj67_33_c3 | nmdc:mga0qj67_33_c3_8207_9799 | 519 |
| 40 | 3300050510 | nmdc:mga06r32_1_c1 | nmdc:mga06r32_1_c1_138075_139667 | 519 |
| 41 | 3300054114 | Ga0501084_0028555 | Ga0501084_0028555_1375_3015 | 519 |
| 42 | 3300060353 | Ga0501082_0029897 | Ga0501082_0029897_1726_3366 | 519 |
| 43 | iso_pu_bacteria | 2675903060 | 2676496212 | 520 |
| 44 | iso_pu_bacteria | 2884693830 | 2884697947 | 520 |
| 45 | iso_pu_bacteria | 2895442618 | 2895445008 | 520 |
| 46 | iso_pu_bacteria | 2675903058 | 2676476886 | 521 |
| 47 | iso_pu_bacteria | 2827628540 | 2827630024 | 521 |
| 48 | 3300037853 | Ga0436364_1348147 | Ga0436364_1348147_78_1703 | 523 |
| 49 | 3300048905 | Ga0496102_0057324 | Ga0496102_0057324_35_1639 | 523 |
| 50 | 3300048906 | Ga0496103_0029408 | Ga0496103_0029408_428_2032 | 523 |
| 51 | 3300005435 | Ga0070714_100005084 | Ga0070714_1000050845 | 524 |
| 52 | 3300005435 | Ga0070714_100044804 | Ga0070714_1000448042 | 524 |
| 53 | 3300021377 | Ga0213874_10004103 | Ga0213874_100041032 | 524 |
| 54 | 3300025929 | Ga0207664_10003739 | Ga0207664_100037395 | 524 |
| 55 | 3300048912 | Ga0496109_0044305 | Ga0496109_0044305_1632_3239 | 526 |
| 56 | 3300049576 | Ga0501040_0016936 | Ga0501040_0016936_903_2537 | 526 |
| 57 | 3300049582 | Ga0501048_0021473 | Ga0501048_0021473_845_2479 | 526 |
| 58 | 3300049824 | Ga0501045_0019688 | Ga0501045_0019688_736_2370 | 526 |
| 59 | 3300054114 | Ga0501084_0111511 | Ga0501084_0111511_146_1780 | 526 |
| 60 | iso_pu_bacteria | 2791354901 | 2791915328 | 526 |
| 61 | 3300006028 | Ga0070717_10013074 | Ga0070717_100130744 | 527 |
| 62 | 3300021384 | Ga0213876_10054335 | Ga0213876_100543352 | 527 |
| 63 | 3300037853 | Ga0436364_0915257 | Ga0436364_0915257_8502_10136 | 527 |
| 64 | 3300037853 | Ga0436364_1108321 | Ga0436364_1108321_1362_2996 | 527 |
| 65 | 3300039437 | Ga0436365_0094667 | Ga0436365_0094667_2135_3769 | 527 |
| 66 | 3300039437 | Ga0436365_0561521 | Ga0436365_0561521_1487_3121 | 527 |
| 67 | 3300039437 | Ga0436365_0747521 | Ga0436365_0747521_10298_11932 | 527 |
| 68 | 3300039437 | Ga0436365_1313710 | Ga0436365_1313710_3554_5188 | 527 |
| 69 | 3300039437 | Ga0436365_1501762 | Ga0436365_1501762_5935_7569 | 527 |
| 70 | 3300039450 | Ga0436363_0064533 | Ga0436363_0064533_157_1791 | 527 |
| 71 | 3300039450 | Ga0436363_1430762 | Ga0436363_1430762_627_2261 | 527 |
| 72 | 3300039453 | Ga0436362_0339593 | Ga0436362_0339593_3725_5359 | 527 |
| 73 | 3300045049 | Ga0466959_0006000 | Ga0466959_0006000_1785_3419 | 527 |
| 74 | 3300045049 | Ga0466959_0107069 | Ga0466959_0107069_32_1666 | 527 |
| 75 | 3300045836 | Ga0466958_0002346 | Ga0466958_0002346_5386_7047 | 527 |
| 76 | 3300045976 | Ga0466967_0015398 | Ga0466967_0015398_2983_4617 | 527 |
| 77 | 3300045976 | Ga0466967_0017853 | Ga0466967_0017853_3432_5093 | 527 |
| 78 | 3300046529 | Ga0495652_0128164 | Ga0495652_0128164_107_1741 | 527 |
| 79 | 3300061719 | Ga0466962_0052983 | Ga0466962_0052983_27_1634 | 527 |
| 80 | 3300005535 | Ga0070684_100050208 | Ga0070684_1000502082 | 528 |
| 81 | 3300020082 | Ga0206353_10350813 | Ga0206353_103508132 | 528 |
| 82 | 3300021388 | Ga0213875_10049946 | Ga0213875_100499461 | 528 |
| 83 | 3300025916 | Ga0207663_10032315 | Ga0207663_100323153 | 528 |
| 84 | 3300025915 | Ga0207693_10002722 | Ga0207693_100027224 | 529 |
| 85 | 3300025916 | Ga0207663_10101710 | Ga0207663_101017102 | 529 |
| 86 | 3300025929 | Ga0207664_10064969 | Ga0207664_100649692 | 529 |
| 87 | 3300025939 | Ga0207665_10016216 | Ga0207665_100162164 | 529 |
| 88 | 3300032133 | Ga0316583_10012970 | Ga0316583_100129702 | 529 |
| 89 | 3300035118 | Ga0373954_0058447 | Ga0373954_0058447_73_1713 | 529 |
| 90 | 3300035119 | Ga0373956_0005060 | Ga0373956_0005060_2244_3908 | 529 |
| 91 | 3300045836 | Ga0466958_0046944 | Ga0466958_0046944_528_2171 | 529 |
| 92 | 3300045836 | Ga0466958_0070198 | Ga0466958_0070198_290_1930 | 529 |
| 93 | 3300046463 | Ga0495653_0013339 | Ga0495653_0013339_4059_5699 | 529 |
| 94 | 3300046516 | Ga0495628_0033353 | Ga0495628_0033353_882_2522 | 529 |
| 95 | 3300046536 | Ga0495587_0025825 | Ga0495587_0025825_246_1886 | 529 |
| 96 | 3300046680 | Ga0495646_0006916 | Ga0495646_0006916_1304_2944 | 529 |
| 97 | 3300047322 | Ga0495680_0003021 | Ga0495680_0003021_5262_6902 | 529 |
| 98 | 3300047471 | Ga0495684_0019823 | Ga0495684_0019823_711_2351 | 529 |
| 99 | 3300048912 | Ga0496109_0097363 | Ga0496109_0097363_993_2633 | 529 |
| 100 | 3300048915 | Ga0496112_0100800 | Ga0496112_0100800_122_1762 | 529 |
| 101 | 3300049578 | Ga0501042_0102403 | Ga0501042_0102403_318_1961 | 529 |
| 102 | 3300049592 | Ga0501076_0054338 | Ga0501076_0054338_84_1727 | 529 |
| 103 | 3300053077 | Ga0495601_0058500 | Ga0495601_0058500_42_1682 | 529 |
| 104 | 3300053085 | Ga0495619_0005982 | Ga0495619_0005982_4677_6317 | 529 |
| 105 | 3300006844 | Ga0075428_100006889 | Ga0075428_1000068897 | 530 |
| 106 | 3300006846 | Ga0075430_100025796 | Ga0075430_1000257964 | 530 |
| 107 | 3300006847 | Ga0075431_100070801 | Ga0075431_1000708011 | 530 |
| 108 | 3300006880 | Ga0075429_100111723 | Ga0075429_1001117232 | 530 |
| 109 | 3300031852 | Ga0307410_10003335 | Ga0307410_100033352 | 530 |
| 110 | 3300031901 | Ga0307406_10042666 | Ga0307406_100426662 | 530 |
| 111 | 3300031995 | Ga0307409_100002047 | Ga0307409_1000020471 | 530 |
| 112 | 3300044765 | Ga0466970_0017955 | Ga0466970_0017955_165_1841 | 530 |
| 113 | 3300046689 | Ga0495613_0011083 | Ga0495613_0011083_4645_6288 | 530 |
| 114 | 3300048907 | Ga0496104_0067801 | Ga0496104_0067801_778_2421 | 530 |
| 115 | 3300048911 | Ga0496108_0106696 | Ga0496108_0106696_614_2257 | 530 |
| 116 | 3300049568 | Ga0501031_0005234 | Ga0501031_0005234_2225_3907 | 530 |
| 117 | 3300049572 | Ga0501036_0017176 | Ga0501036_0017176_3054_4736 | 530 |
| 118 | 3300049574 | Ga0501038_0022776 | Ga0501038_0022776_2257_3939 | 530 |
| 119 | 3300049576 | Ga0501040_0053629 | Ga0501040_0053629_391_2073 | 530 |
| 120 | 3300049577 | Ga0501041_0064989 | Ga0501041_0064989_93_1775 | 530 |
| 121 | 3300049578 | Ga0501042_0014671 | Ga0501042_0014671_128_1810 | 530 |
| 122 | 3300049580 | Ga0501046_0008161 | Ga0501046_0008161_5761_7443 | 530 |
| 123 | 3300049582 | Ga0501048_0008269 | Ga0501048_0008269_5970_7652 | 530 |
| 124 | 3300049588 | Ga0501072_0045321 | Ga0501072_0045321_1646_3328 | 530 |
| 125 | 3300049590 | Ga0501074_0012382 | Ga0501074_0012382_1125_2807 | 530 |
| 126 | 3300049591 | Ga0501075_0010882 | Ga0501075_0010882_184_1866 | 530 |
| 127 | 3300049592 | Ga0501076_0005227 | Ga0501076_0005227_1539_3221 | 530 |
| 128 | 3300049742 | Ga0501080_0026537 | Ga0501080_0026537_3489_5171 | 530 |
| 129 | 3300049743 | Ga0501081_0055845 | Ga0501081_0055845_817_2499 | 530 |
| 130 | 3300049822 | Ga0501035_0034180 | Ga0501035_0034180_1278_2960 | 530 |
| 131 | 3300053078 | Ga0495612_0011571 | Ga0495612_0011571_709_2352 | 530 |
| 132 | 3300054114 | Ga0501084_0006412 | Ga0501084_0006412_3365_5047 | 530 |
| 133 | 3300060353 | Ga0501082_0017542 | Ga0501082_0017542_3089_4771 | 530 |
| 134 | 3300061734 | Ga0530510_0006453 | Ga0530510_0006453_1763_3445 | 530 |
| 135 | 3300005617 | Ga0068859_100017732 | Ga0068859_1000177323 | 531 |
| 136 | 3300006931 | Ga0097620_100017732 | Ga0097620_1000177326 | 531 |
| 137 | 3300013308 | Ga0157375_10090767 | Ga0157375_100907672 | 531 |
| 138 | 3300031691 | Ga0316579_10025169 | Ga0316579_100251692 | 531 |
| 139 | 3300031727 | Ga0316576_10018315 | Ga0316576_100183152 | 531 |
| 140 | 3300036712 | Ga0316584_0021716 | Ga0316584_0021716_569_2263 | 531 |
| 141 | 3300046516 | Ga0495628_0074669 | Ga0495628_0074669_130_1812 | 531 |
| 142 | 3300048904 | Ga0496101_0012510 | Ga0496101_0012510_3207_4889 | 531 |
| 143 | 3300048905 | Ga0496102_0004460 | Ga0496102_0004460_2599_4281 | 531 |
| 144 | 3300048906 | Ga0496103_0017406 | Ga0496103_0017406_1273_2955 | 531 |
| 145 | 3300048907 | Ga0496104_0016185 | Ga0496104_0016185_3073_4755 | 531 |
| 146 | 3300048908 | Ga0496105_0009927 | Ga0496105_0009927_2682_4364 | 531 |
| 147 | 3300048908 | Ga0496105_0020520 | Ga0496105_0020520_3639_5330 | 531 |
| 148 | 3300048913 | Ga0496110_0036562 | Ga0496110_0036562_1626_3317 | 531 |
| 149 | 3300048917 | Ga0496114_0015500 | Ga0496114_0015500_1771_3453 | 531 |
| 150 | 3300002772 | JGI25164J39214_1001647 | JGI25164J39214_10016473 | 532 |
| 151 | 3300003214 | JGI25165J46597_1000061 | JGI25165J46597_100006181 | 532 |
| 152 | 3300025231 | Ga0207427_100042 | Ga0207427_10004275 | 532 |
| 153 | 3300025233 | Ga0209437_101321 | Ga0209437_1013212 | 532 |
| 154 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011161 | 532 |
| 155 | 3300037466 | Ga0395898_0016072 | Ga0395898_0016072_4815_6506 | 532 |
| 156 | 3300005434 | Ga0070709_10003834 | Ga0070709_100038347 | 534 |
| 157 | 3300005435 | Ga0070714_100001322 | Ga0070714_1000013227 | 534 |
| 158 | 3300005436 | Ga0070713_100001527 | Ga0070713_1000015274 | 534 |
| 159 | 3300005437 | Ga0070710_10003868 | Ga0070710_100038687 | 534 |
| 160 | 3300005439 | Ga0070711_100001298 | Ga0070711_10000129812 | 534 |
| 161 | 3300005471 | Ga0070698_100015325 | Ga0070698_1000153252 | 534 |
| 162 | 3300006028 | Ga0070717_10000413 | Ga0070717_100004137 | 534 |
| 163 | 3300006173 | Ga0070716_100000451 | Ga0070716_10000045117 | 534 |
| 164 | 3300006175 | Ga0070712_100011966 | Ga0070712_1000119661 | 534 |
| 165 | 3300025906 | Ga0207699_10001501 | Ga0207699_100015017 | 534 |
| 166 | 3300025915 | Ga0207693_10004743 | Ga0207693_1000474310 | 534 |
| 167 | 3300025916 | Ga0207663_10001616 | Ga0207663_100016163 | 534 |
| 168 | 3300025928 | Ga0207700_10002316 | Ga0207700_100023167 | 534 |
| 169 | 3300025929 | Ga0207664_10000417 | Ga0207664_100004177 | 534 |
| 170 | 3300025939 | Ga0207665_10000320 | Ga0207665_1000032018 | 534 |
| 171 | 3300048913 | Ga0496110_0118205 | Ga0496110_0118205_12_1703 | 535 |
| 172 | 3300053155 | Ga0500620_006216 | Ga0500620_006216_1105_2793 | 536 |
| 173 | 3300037471 | Ga0395905_0200529 | Ga0395905_0200529_65_1711 | 537 |
| 174 | 3300038443 | Ga0395901_0011246 | Ga0395901_0011246_7316_8962 | 537 |
| 175 | 3300048908 | Ga0496105_0042674 | Ga0496105_0042674_1910_3592 | 537 |
| 176 | 3300048928 | Ga0496125_0002545 | Ga0496125_0002545_20853_22553 | 537 |
| 177 | iso_pu_bacteria | 2856741275 | 2856741388 | 538 |
| 178 | iso_pu_bacteria | 2861520306 | 2861521575 | 538 |
| 179 | iso_pu_bacteria | 2891562705 | 2891563727 | 538 |
| 180 | 3300013104 | Ga0157370_10079955 | Ga0157370_100799553 | 539 |
| 181 | 3300048920 | Ga0496117_0012087 | Ga0496117_0012087_2452_4140 | 539 |
| 182 | 3300003752 | Ga0055539_1000005 | Ga0055539_1000005569 | 540 |
| 183 | 3300003756 | Ga0055533_1000001 | Ga0055533_10000011638 | 540 |
| 184 | 3300003759 | Ga0055525_1001046 | Ga0055525_10010465 | 540 |
| 185 | 3300005435 | Ga0070714_100110539 | Ga0070714_1001105392 | 540 |
| 186 | 3300009545 | Ga0105237_10052001 | Ga0105237_100520013 | 540 |
| 187 | 3300025226 | Ga0209674_100001 | Ga0209674_1000011639 | 540 |
| 188 | 3300025230 | Ga0209563_100001 | Ga0209563_1000011639 | 540 |
| 189 | 3300025253 | Ga0209677_100001 | Ga0209677_1000011639 | 540 |
| 190 | 3300030522 | Ga0307512_10003678 | Ga0307512_1000367812 | 540 |
| 191 | 3300025899 | Ga0207642_10016311 | Ga0207642_100163112 | 541 |
| 192 | 3300049581 | Ga0501047_0027920 | Ga0501047_0027920_732_2375 | 541 |
| 193 | 3300049586 | Ga0501070_0002352 | Ga0501070_0002352_9385_11073 | 541 |
| 194 | 3300049590 | Ga0501074_0001816 | Ga0501074_0001816_12939_14585 | 541 |
| 195 | 3300028794 | Ga0307515_10082545 | Ga0307515_100825452 | 542 |
| 196 | 3300038443 | Ga0395901_0044108 | Ga0395901_0044108_2133_3824 | 543 |
| 197 | 3300053096 | Ga0500641_0001776 | Ga0500641_0001776_4714_6396 | 543 |
| 198 | iso_pu_bacteria | 2929219909 | 2929225694 | 543 |
| 199 | 3300033179 | Ga0307507_10000017 | Ga0307507_10000017173 | 544 |
| 200 | 3300003578 | Ga0006562J51391_1002516 | Ga0006562J51391_100251611 | 546 |
| 201 | 3300003578 | Ga0006562J51391_1002517 | Ga0006562J51391_10025172 | 546 |
| 202 | iso_pu_bacteria | 2891395885 | 2891398612 | 546 |
| 203 | 3300009098 | Ga0105245_10013491 | Ga0105245_100134914 | 547 |
| 204 | 3300025927 | Ga0207687_10013434 | Ga0207687_100134343 | 547 |
| 205 | 3300031649 | Ga0307514_10008438 | Ga0307514_100084384 | 547 |
| 206 | 3300048911 | Ga0496108_0042683 | Ga0496108_0042683_338_2020 | 547 |
| 207 | 3300048913 | Ga0496110_0034495 | Ga0496110_0034495_1010_2692 | 547 |
| 208 | 3300053136 | Ga0500559_0000050 | Ga0500559_0000050_17348_19036 | 547 |
| 209 | 3300053148 | Ga0500590_013523 | Ga0500590_013523_1873_3576 | 547 |
| 210 | 3300035398 | Ga0316574_0015583 | Ga0316574_0015583_2315_3997 | 548 |
| 211 | 3300049568 | Ga0501031_0000962 | Ga0501031_0000962_10750_12423 | 548 |
| 212 | 3300049569 | Ga0501032_0004528 | Ga0501032_0004528_8403_10076 | 548 |
| 213 | 3300049571 | Ga0501034_0004867 | Ga0501034_0004867_2530_4203 | 548 |
| 214 | 3300049571 | Ga0501034_0202929 | Ga0501034_0202929_192_1871 | 548 |
| 215 | 3300049572 | Ga0501036_0000459 | Ga0501036_0000459_24555_26228 | 548 |
| 216 | 3300049573 | Ga0501037_0002189 | Ga0501037_0002189_10941_12614 | 548 |
| 217 | 3300049579 | Ga0501043_0002716 | Ga0501043_0002716_2530_4203 | 548 |
| 218 | 3300049579 | Ga0501043_0026532 | Ga0501043_0026532_1528_3207 | 548 |
| 219 | 3300049580 | Ga0501046_0003277 | Ga0501046_0003277_3045_4724 | 548 |
| 220 | 3300049581 | Ga0501047_0018200 | Ga0501047_0018200_2530_4203 | 548 |
| 221 | 3300049581 | Ga0501047_0028269 | Ga0501047_0028269_1456_3135 | 548 |
| 222 | 3300049586 | Ga0501070_0004032 | Ga0501070_0004032_2530_4203 | 548 |
| 223 | 3300049589 | Ga0501073_0016747 | Ga0501073_0016747_115_1788 | 548 |
| 224 | 3300049742 | Ga0501080_0000473 | Ga0501080_0000473_19021_20694 | 548 |
| 225 | 3300049744 | Ga0501083_0000795 | Ga0501083_0000795_184_1863 | 548 |
| 226 | 3300049822 | Ga0501035_0002239 | Ga0501035_0002239_10609_12282 | 548 |
| 227 | 3300049823 | Ga0501044_0016031 | Ga0501044_0016031_3347_5026 | 548 |
| 228 | 3300054114 | Ga0501084_0002423 | Ga0501084_0002423_2732_4405 | 548 |
| 229 | iso_pu_bacteria | 2675903058 | 2676476359 | 548 |
| 230 | iso_pu_bacteria | 2839986021 | 2839988361 | 548 |
| 231 | iso_pu_bacteria | 2932431166 | 2932432223 | 548 |
| 232 | 3300005563 | Ga0068855_100079606 | Ga0068855_1000796062 | 549 |
| 233 | 3300005841 | Ga0068863_100175277 | Ga0068863_1001752772 | 549 |
| 234 | 3300009177 | Ga0105248_10000880 | Ga0105248_1000088019 | 549 |
| 235 | 3300013296 | Ga0157374_10024151 | Ga0157374_100241514 | 549 |
| 236 | 3300025941 | Ga0207711_10005166 | Ga0207711_100051664 | 549 |
| 237 | 3300025949 | Ga0207667_10152961 | Ga0207667_101529612 | 549 |
| 238 | 3300031251 | Ga0265327_10000138 | Ga0265327_1000013859 | 549 |
| 239 | 3300031251 | Ga0265327_10004793 | Ga0265327_100047937 | 549 |
| 240 | 3300042016 | Ga0439463_015219 | Ga0439463_015219_13_1671 | 549 |
| 241 | 3300049571 | Ga0501034_0000910 | Ga0501034_0000910_7262_8950 | 549 |
| 242 | 3300053093 | Ga0500651_0003063 | Ga0500651_0003063_4649_6352 | 549 |
| 243 | 3300053104 | Ga0500556_0000426 | Ga0500556_0000426_10828_12516 | 549 |
| 244 | iso_pu_bacteria | 8002811521 | 8002813984 | 549 |
| 245 | 3300003759 | Ga0055525_1001748 | Ga0055525_10017483 | 550 |
| 246 | 3300006051 | Ga0075364_10046864 | Ga0075364_100468642 | 550 |
| 247 | 3300025230 | Ga0209563_100766 | Ga0209563_1007666 | 550 |
| 248 | 3300048920 | Ga0496117_0001718 | Ga0496117_0001718_12551_14239 | 550 |
| 249 | 3300048928 | Ga0496125_0012012 | Ga0496125_0012012_902_2590 | 550 |
| 250 | 3300048929 | Ga0496126_0009429 | Ga0496126_0009429_6576_8264 | 550 |
| 251 | 3300048929 | Ga0496126_0030861 | Ga0496126_0030861_1862_3550 | 550 |
| 252 | 3300050491 | nmdc:mga00v17_50599_c1 | nmdc:mga00v17_50599_c1_406_2094 | 550 |
| 253 | 3300050492 | nmdc:mga0yw44_7068_c1 | nmdc:mga0yw44_7068_c1_949_2637 | 550 |
| 254 | 3300053140 | Ga0500573_0006455 | Ga0500573_0006455_463_2151 | 550 |
| 255 | 3300031901 | Ga0307406_10000932 | Ga0307406_1000093214 | 551 |
| 256 | 3300046453 | Ga0495627_001457 | Ga0495627_001457_7946_9634 | 551 |
| 257 | 3300032004 | Ga0307414_10003797 | Ga0307414_100037973 | 552 |
| 258 | iso_pu_bacteria | 2643221613 | 2644082355 | 552 |
| 259 | iso_pu_bacteria | 2643221721 | 2644667022 | 552 |
| 260 | iso_pu_bacteria | 2935890801 | 2935893585 | 552 |
| 261 | iso_pu_bacteria | 2515154155 | 2515856616 | 553 |
| 262 | iso_pu_bacteria | 2565956761 | 2566992424 | 553 |
| 263 | iso_pu_bacteria | 2643221616 | 2644096453 | 553 |
| 264 | iso_pu_bacteria | 2643221624 | 2644134940 | 553 |
| 265 | iso_pu_bacteria | 2643221630 | 2644173024 | 553 |
| 266 | iso_pu_bacteria | 2643221690 | 2644502868 | 553 |
| 267 | iso_pu_bacteria | 2643221694 | 2644525228 | 553 |
| 268 | iso_pu_bacteria | 2643221711 | 2644607484 | 553 |
| 269 | iso_pu_bacteria | 2643221722 | 2644669316 | 553 |
| 270 | iso_pu_bacteria | 2643221724 | 2644679223 | 553 |
| 271 | iso_pu_bacteria | 2643221961 | 2645720562 | 553 |
| 272 | iso_pu_bacteria | 2643221962 | 2645723578 | 553 |
| 273 | iso_pu_bacteria | 2721755702 | 2723643101 | 553 |
| 274 | iso_pu_bacteria | 2728369380 | 2730228726 | 553 |
| 275 | iso_pu_bacteria | 2747842429 | 2747953638 | 553 |
| 276 | iso_pu_bacteria | 2811994882 | 2812373742 | 553 |
| 277 | iso_pu_bacteria | 2818991318 | 2819426356 | 553 |
| 278 | iso_pu_bacteria | 2818991458 | 2819665397 | 553 |
| 279 | iso_pu_bacteria | 2818991462 | 2819691398 | 553 |
| 280 | iso_pu_bacteria | 2818991469 | 2819727566 | 553 |
| 281 | iso_pu_bacteria | 2827628540 | 2827632167 | 553 |
| 282 | iso_pu_bacteria | 2844841374 | 2844843323 | 553 |
| 283 | iso_pu_bacteria | 2852663356 | 2852665832 | 553 |
| 284 | iso_pu_bacteria | 2857729791 | 2857730969 | 553 |
| 285 | iso_pu_bacteria | 2857737099 | 2857739750 | 553 |
| 286 | iso_pu_bacteria | 2883821847 | 2883823172 | 553 |
| 287 | iso_pu_bacteria | 2884763398 | 2884766351 | 553 |
| 288 | iso_pu_bacteria | 2884994152 | 2884996421 | 553 |
| 289 | iso_pu_bacteria | 2904535858 | 2904539324 | 553 |
| 290 | iso_pu_bacteria | 2919055335 | 2919058804 | 553 |
| 291 | iso_pu_bacteria | 2922554459 | 2922555596 | 553 |
| 292 | iso_pu_bacteria | 2928121344 | 2928122471 | 553 |
| 293 | iso_pu_bacteria | 2928153084 | 2928153461 | 553 |
| 294 | iso_pu_bacteria | 2939582691 | 2939589216 | 553 |
| 295 | iso_pu_bacteria | 2945968032 | 2945970884 | 553 |
| 296 | iso_pu_bacteria | 2946080515 | 2946081801 | 553 |
| 297 | iso_pu_bacteria | 8004182704 | 8004183587 | 553 |
| 298 | 3300005530 | Ga0070679_100015989 | Ga0070679_1000159894 | 554 |
| 299 | iso_pu_bacteria | 2643221681 | 2644456169 | 554 |
| 300 | iso_pu_bacteria | 2939657138 | 2939659403 | 554 |
| 301 | 3300005535 | Ga0070684_100086763 | Ga0070684_1000867632 | 555 |
| 302 | 3300053080 | Ga0500635_0000664 | Ga0500635_0000664_4245_5927 | 555 |
| 303 | 3300003760 | Ga0055527_1000017 | Ga0055527_100001793 | 557 |
| 304 | 3300003762 | Ga0055542_1000044 | Ga0055542_100004493 | 557 |
| 305 | 3300003763 | Ga0055529_1000279 | Ga0055529_100027948 | 557 |
| 306 | 3300005339 | Ga0070660_100075211 | Ga0070660_1000752112 | 557 |
| 307 | 3300005347 | Ga0070668_100023202 | Ga0070668_1000232023 | 557 |
| 308 | 3300005366 | Ga0070659_100001112 | Ga0070659_1000011123 | 557 |
| 309 | 3300005366 | Ga0070659_100047953 | Ga0070659_1000479532 | 557 |
| 310 | 3300005367 | Ga0070667_100058732 | Ga0070667_1000587322 | 557 |
| 311 | 3300005548 | Ga0070665_100136751 | Ga0070665_1001367512 | 557 |
| 312 | 3300005842 | Ga0068858_100000016 | Ga0068858_1000000166 | 557 |
| 313 | 3300005843 | Ga0068860_100068368 | Ga0068860_1000683683 | 557 |
| 314 | 3300005937 | Ga0081455_10001393 | Ga0081455_1000139315 | 557 |
| 315 | 3300005937 | Ga0081455_10010089 | Ga0081455_100100895 | 557 |
| 316 | 3300005937 | Ga0081455_10012756 | Ga0081455_100127566 | 557 |
| 317 | 3300005937 | Ga0081455_10014109 | Ga0081455_100141096 | 557 |
| 318 | 3300005981 | Ga0081538_10000264 | Ga0081538_1000026441 | 557 |
| 319 | 3300005985 | Ga0081539_10002050 | Ga0081539_1000205013 | 557 |
| 320 | 3300006048 | Ga0075363_100021019 | Ga0075363_1000210192 | 557 |
| 321 | 3300006051 | Ga0075364_10007063 | Ga0075364_100070633 | 557 |
| 322 | 3300006058 | Ga0075432_10001019 | Ga0075432_100010198 | 557 |
| 323 | 3300006058 | Ga0075432_10001893 | Ga0075432_100018936 | 557 |
| 324 | 3300006353 | Ga0075370_10061351 | Ga0075370_100613511 | 557 |
| 325 | 3300006844 | Ga0075428_100010070 | Ga0075428_10001007010 | 557 |
| 326 | 3300006847 | Ga0075431_100010112 | Ga0075431_1000101126 | 557 |
| 327 | 3300006852 | Ga0075433_10001532 | Ga0075433_100015323 | 557 |
| 328 | 3300006871 | Ga0075434_100005228 | Ga0075434_10000522811 | 557 |
| 329 | 3300006871 | Ga0075434_100006176 | Ga0075434_10000617610 | 557 |
| 330 | 3300006881 | Ga0068865_100056359 | Ga0068865_1000563592 | 557 |
| 331 | 3300006914 | Ga0075436_100010308 | Ga0075436_1000103083 | 557 |
| 332 | 3300007076 | Ga0075435_100016247 | Ga0075435_1000162474 | 557 |
| 333 | 3300009036 | Ga0105244_10034057 | Ga0105244_100340572 | 557 |
| 334 | 3300009093 | Ga0105240_10115403 | Ga0105240_101154032 | 557 |
| 335 | 3300009094 | Ga0111539_10003621 | Ga0111539_100036212 | 557 |
| 336 | 3300009094 | Ga0111539_10003666 | Ga0111539_1000366622 | 557 |
| 337 | 3300009098 | Ga0105245_10209850 | Ga0105245_102098501 | 557 |
| 338 | 3300009147 | Ga0114129_10024589 | Ga0114129_100245897 | 557 |
| 339 | 3300009148 | Ga0105243_10003243 | Ga0105243_100032435 | 557 |
| 340 | 3300009176 | Ga0105242_10041559 | Ga0105242_100415592 | 557 |
| 341 | 3300009553 | Ga0105249_10008124 | Ga0105249_1000812410 | 557 |
| 342 | 3300009553 | Ga0105249_10017913 | Ga0105249_100179135 | 557 |
| 343 | 3300010375 | Ga0105239_10078916 | Ga0105239_100789163 | 557 |
| 344 | 3300013105 | Ga0157369_10054906 | Ga0157369_100549064 | 557 |
| 345 | 3300013250 | Ga0171462_1001 | Ga0171462_1001713 | 557 |
| 346 | 3300013306 | Ga0163162_10017114 | Ga0163162_100171143 | 557 |
| 347 | 3300013307 | Ga0157372_10252706 | Ga0157372_102527061 | 557 |
| 348 | 3300013308 | Ga0157375_10131974 | Ga0157375_101319743 | 557 |
| 349 | 3300021384 | Ga0213876_10000676 | Ga0213876_1000067618 | 557 |
| 350 | 3300025228 | Ga0209672_100039 | Ga0209672_10003994 | 557 |
| 351 | 3300025229 | Ga0209147_101049 | Ga0209147_1010496 | 557 |
| 352 | 3300025242 | Ga0209258_101806 | Ga0209258_1018062 | 557 |
| 353 | 3300025246 | Ga0209646_1000088 | Ga0209646_1000088125 | 557 |
| 354 | 3300025254 | Ga0209148_1000004 | Ga0209148_100000494 | 557 |
| 355 | 3300025272 | Ga0209455_1000117 | Ga0209455_1000117139 | 557 |
| 356 | 3300025901 | Ga0207688_10001884 | Ga0207688_100018846 | 557 |
| 357 | 3300025909 | Ga0207705_10022908 | Ga0207705_100229082 | 557 |
| 358 | 3300025913 | Ga0207695_10005496 | Ga0207695_100054966 | 557 |
| 359 | 3300025920 | Ga0207649_10022947 | Ga0207649_100229473 | 557 |
| 360 | 3300025932 | Ga0207690_10003341 | Ga0207690_100033416 | 557 |
| 361 | 3300025933 | Ga0207706_10012551 | Ga0207706_100125515 | 557 |
| 362 | 3300025935 | Ga0207709_10005768 | Ga0207709_100057685 | 557 |
| 363 | 3300025935 | Ga0207709_10029256 | Ga0207709_100292563 | 557 |
| 364 | 3300025949 | Ga0207667_10002042 | Ga0207667_100020423 | 557 |
| 365 | 3300025961 | Ga0207712_10013614 | Ga0207712_100136145 | 557 |
| 366 | 3300025972 | Ga0207668_10029087 | Ga0207668_100290872 | 557 |
| 367 | 3300025986 | Ga0207658_10088123 | Ga0207658_100881232 | 557 |
| 368 | 3300026035 | Ga0207703_10000345 | Ga0207703_1000034537 | 557 |
| 369 | 3300026067 | Ga0207678_10150882 | Ga0207678_101508821 | 557 |
| 370 | 3300026118 | Ga0207675_100028254 | Ga0207675_1000282544 | 557 |
| 371 | 3300026118 | Ga0207675_100062744 | Ga0207675_1000627441 | 557 |
| 372 | 3300026121 | Ga0207683_10046752 | Ga0207683_100467523 | 557 |
| 373 | 3300026142 | Ga0207698_10044070 | Ga0207698_100440702 | 557 |
| 374 | 3300027907 | Ga0207428_10000964 | Ga0207428_1000096416 | 557 |
| 375 | 3300027907 | Ga0207428_10003341 | Ga0207428_1000334115 | 557 |
| 376 | 3300028380 | Ga0268265_10124555 | Ga0268265_101245551 | 557 |
| 377 | 3300031240 | Ga0265320_10028670 | Ga0265320_100286703 | 557 |
| 378 | 3300031241 | Ga0265325_10002844 | Ga0265325_100028448 | 557 |
| 379 | 3300031344 | Ga0265316_10107160 | Ga0265316_101071602 | 557 |
| 380 | 3300031711 | Ga0265314_10043050 | Ga0265314_100430502 | 557 |
| 381 | 3300031731 | Ga0307405_10001317 | Ga0307405_1000131712 | 557 |
| 382 | 3300031733 | Ga0316577_10061345 | Ga0316577_100613452 | 557 |
| 383 | 3300031824 | Ga0307413_10000082 | Ga0307413_1000008219 | 557 |
| 384 | 3300031852 | Ga0307410_10000502 | Ga0307410_1000050214 | 557 |
| 385 | 3300031852 | Ga0307410_10014909 | Ga0307410_100149095 | 557 |
| 386 | 3300031901 | Ga0307406_10000895 | Ga0307406_100008952 | 557 |
| 387 | 3300031901 | Ga0307406_10004930 | Ga0307406_100049306 | 557 |
| 388 | 3300031903 | Ga0307407_10010679 | Ga0307407_100106791 | 557 |
| 389 | 3300031903 | Ga0307407_10014338 | Ga0307407_100143383 | 557 |
| 390 | 3300031911 | Ga0307412_10017184 | Ga0307412_100171843 | 557 |
| 391 | 3300031995 | Ga0307409_100000050 | Ga0307409_10000005012 | 557 |
| 392 | 3300031995 | Ga0307409_100006594 | Ga0307409_1000065945 | 557 |
| 393 | 3300032002 | Ga0307416_100000150 | Ga0307416_10000015011 | 557 |
| 394 | 3300032002 | Ga0307416_100006316 | Ga0307416_1000063165 | 557 |
| 395 | 3300032004 | Ga0307414_10002253 | Ga0307414_1000225311 | 557 |
| 396 | 3300032004 | Ga0307414_10027298 | Ga0307414_100272982 | 557 |
| 397 | 3300032126 | Ga0307415_100001151 | Ga0307415_1000011518 | 557 |
| 398 | 3300032126 | Ga0307415_100009552 | Ga0307415_1000095523 | 557 |
| 399 | 3300035398 | Ga0316574_0013330 | Ga0316574_0013330_2814_4508 | 557 |
| 400 | 3300036712 | Ga0316584_0007978 | Ga0316584_0007978_746_2440 | 557 |
| 401 | 3300037418 | Ga0395900_0018238 | Ga0395900_0018238_3027_4715 | 557 |
| 402 | 3300037466 | Ga0395898_0000381 | Ga0395898_0000381_65150_66838 | 557 |
| 403 | 3300039437 | Ga0436365_1257400 | Ga0436365_1257400_19906_21588 | 557 |
| 404 | 3300041451 | Ga0451791_1058766 | Ga0451791_1058766_434_2116 | 557 |
| 405 | 3300041452 | Ga0451793_0234284 | Ga0451793_0234284_2346_4028 | 557 |
| 406 | 3300041496 | Ga0451839_1432976 | Ga0451839_1432976_488_2170 | 557 |
| 407 | 3300042439 | Ga0439464_0007068 | Ga0439464_0007068_338_2020 | 557 |
| 408 | 3300042993 | Ga0439440_0010804 | Ga0439440_0010804_81_1763 | 557 |
| 409 | 3300044693 | Ga0466961_0015646 | Ga0466961_0015646_959_2668 | 557 |
| 410 | 3300044694 | Ga0466963_0003069 | Ga0466963_0003069_6452_8134 | 557 |
| 411 | 3300045836 | Ga0466958_0000255 | Ga0466958_0000255_8298_9980 | 557 |
| 412 | 3300045836 | Ga0466958_0063851 | Ga0466958_0063851_211_1893 | 557 |
| 413 | 3300046461 | Ga0495641_0020421 | Ga0495641_0020421_706_2430 | 557 |
| 414 | 3300048905 | Ga0496102_0082020 | Ga0496102_0082020_328_2010 | 557 |
| 415 | 3300048907 | Ga0496104_0004952 | Ga0496104_0004952_30_1736 | 557 |
| 416 | 3300048908 | Ga0496105_0001397 | Ga0496105_0001397_13709_15415 | 557 |
| 417 | 3300048908 | Ga0496105_0054876 | Ga0496105_0054876_85_1773 | 557 |
| 418 | 3300048910 | Ga0496107_0118794 | Ga0496107_0118794_159_1847 | 557 |
| 419 | 3300048911 | Ga0496108_0000472 | Ga0496108_0000472_8518_10224 | 557 |
| 420 | 3300048911 | Ga0496108_0043180 | Ga0496108_0043180_1995_3677 | 557 |
| 421 | 3300048911 | Ga0496108_0043709 | Ga0496108_0043709_1645_3339 | 557 |
| 422 | 3300048911 | Ga0496108_0076220 | Ga0496108_0076220_386_2068 | 557 |
| 423 | 3300048913 | Ga0496110_0004337 | Ga0496110_0004337_8645_10351 | 557 |
| 424 | 3300048916 | Ga0496113_0146760 | Ga0496113_0146760_138_1829 | 557 |
| 425 | 3300048917 | Ga0496114_0148232 | Ga0496114_0148232_239_1921 | 557 |
| 426 | 3300048920 | Ga0496117_0040411 | Ga0496117_0040411_912_2648 | 557 |
| 427 | 3300048922 | Ga0496119_0000437 | Ga0496119_0000437_29987_31675 | 557 |
| 428 | 3300048923 | Ga0496120_0023496 | Ga0496120_0023496_1330_3018 | 557 |
| 429 | 3300048925 | Ga0496122_0011256 | Ga0496122_0011256_6865_8553 | 557 |
| 430 | 3300048928 | Ga0496125_0006238 | Ga0496125_0006238_8041_9729 | 557 |
| 431 | 3300048928 | Ga0496125_0043469 | Ga0496125_0043469_2084_3772 | 557 |
| 432 | 3300049571 | Ga0501034_0010823 | Ga0501034_0010823_2790_4472 | 557 |
| 433 | 3300049571 | Ga0501034_0121234 | Ga0501034_0121234_239_1927 | 557 |
| 434 | 3300049572 | Ga0501036_0098707 | Ga0501036_0098707_585_2270 | 557 |
| 435 | 3300049573 | Ga0501037_0063279 | Ga0501037_0063279_755_2440 | 557 |
| 436 | 3300049574 | Ga0501038_0030194 | Ga0501038_0030194_191_1876 | 557 |
| 437 | 3300049578 | Ga0501042_0002441 | Ga0501042_0002441_6508_8193 | 557 |
| 438 | 3300049580 | Ga0501046_0038684 | Ga0501046_0038684_1357_3042 | 557 |
| 439 | 3300049582 | Ga0501048_0002442 | Ga0501048_0002442_877_2562 | 557 |
| 440 | 3300049585 | Ga0501069_0003890 | Ga0501069_0003890_4025_5707 | 557 |
| 441 | 3300049586 | Ga0501070_0001332 | Ga0501070_0001332_20364_22052 | 557 |
| 442 | 3300049587 | Ga0501071_0000654 | Ga0501071_0000654_45_1733 | 557 |
| 443 | 3300049591 | Ga0501075_0049787 | Ga0501075_0049787_1006_2691 | 557 |
| 444 | 3300049592 | Ga0501076_0019672 | Ga0501076_0019672_2783_4468 | 557 |
| 445 | 3300049742 | Ga0501080_0012985 | Ga0501080_0012985_3802_5484 | 557 |
| 446 | 3300049742 | Ga0501080_0018519 | Ga0501080_0018519_1261_2943 | 557 |
| 447 | 3300049822 | Ga0501035_0039322 | Ga0501035_0039322_1450_3135 | 557 |
| 448 | 3300049823 | Ga0501044_0173282 | Ga0501044_0173282_229_1911 | 557 |
| 449 | 3300050510 | nmdc:mga06r32_33846_c1 | nmdc:mga06r32_33846_c1_542_2224 | 557 |
| 450 | 3300050511 | nmdc:mga08y16_26425_c1 | nmdc:mga08y16_26425_c1_2836_4518 | 557 |
| 451 | 3300050512 | nmdc:mga0n895_6199_c1 | nmdc:mga0n895_6199_c1_8168_9850 | 557 |
| 452 | 3300050513 | nmdc:mga0rr50_12402_c1 | nmdc:mga0rr50_12402_c1_895_2577 | 557 |
| 453 | 3300050514 | nmdc:mga08x19_3272_c1 | nmdc:mga08x19_3272_c1_4261_5943 | 557 |
| 454 | 3300053140 | Ga0500573_0002056 | Ga0500573_0002056_98_1786 | 557 |
| 455 | 3300060353 | Ga0501082_0009581 | Ga0501082_0009581_1907_3589 | 557 |
| 456 | 3300061719 | Ga0466962_0014488 | Ga0466962_0014488_2066_3748 | 557 |
| 457 | 3300061734 | Ga0530510_0096225 | Ga0530510_0096225_408_2093 | 557 |
| 458 | iso_pu_bacteria | 2728369276 | 2729906650 | 557 |
| 459 | iso_pu_bacteria | 2811994880 | 2812364394 | 557 |
| 460 | 3300005336 | Ga0070680_100041296 | Ga0070680_1000412962 | 558 |
| 461 | 3300005458 | Ga0070681_10000092 | Ga0070681_1000009256 | 558 |
| 462 | 3300005530 | Ga0070679_100000009 | Ga0070679_100000009170 | 558 |
| 463 | 3300005530 | Ga0070679_100040593 | Ga0070679_1000405932 | 558 |
| 464 | 3300025912 | Ga0207707_10000174 | Ga0207707_1000017456 | 558 |
| 465 | 3300025921 | Ga0207652_10000070 | Ga0207652_100000708 | 558 |
| 466 | 3300044765 | Ga0466970_0017761 | Ga0466970_0017761_1858_3549 | 558 |
| 467 | 3300049586 | Ga0501070_0072478 | Ga0501070_0072478_584_2281 | 558 |
| 468 | 3300049741 | Ga0501079_0001234 | Ga0501079_0001234_1395_3092 | 558 |
| 469 | 3300049823 | Ga0501044_0035379 | Ga0501044_0035379_1252_2949 | 558 |
| 470 | 3300005985 | Ga0081539_10000238 | Ga0081539_1000023892 | 559 |
| 471 | 3300013105 | Ga0157369_10079172 | Ga0157369_100791721 | 559 |
| 472 | 3300002077 | JGI24744J21845_10003351 | JGI24744J21845_100033513 | 561 |
| 473 | 3300002239 | JGI24034J26672_10002339 | JGI24034J26672_100023394 | 561 |
| 474 | 3300002244 | JGI24742J22300_10004839 | JGI24742J22300_100048391 | 561 |
| 475 | 3300005328 | Ga0070676_10010227 | Ga0070676_100102273 | 561 |
| 476 | 3300005334 | Ga0068869_100022252 | Ga0068869_1000222523 | 561 |
| 477 | 3300005337 | Ga0070682_100030501 | Ga0070682_1000305011 | 561 |
| 478 | 3300005338 | Ga0068868_100007142 | Ga0068868_1000071426 | 561 |
| 479 | 3300005339 | Ga0070660_100044982 | Ga0070660_1000449822 | 561 |
| 480 | 3300005340 | Ga0070689_100056454 | Ga0070689_1000564542 | 561 |
| 481 | 3300005341 | Ga0070691_10001503 | Ga0070691_100015036 | 561 |
| 482 | 3300005343 | Ga0070687_100043954 | Ga0070687_1000439542 | 561 |
| 483 | 3300005347 | Ga0070668_100012150 | Ga0070668_1000121507 | 561 |
| 484 | 3300005353 | Ga0070669_100020467 | Ga0070669_1000204672 | 561 |
| 485 | 3300005355 | Ga0070671_100025657 | Ga0070671_1000256572 | 561 |
| 486 | 3300005365 | Ga0070688_100011461 | Ga0070688_1000114613 | 561 |
| 487 | 3300005366 | Ga0070659_100101810 | Ga0070659_1001018102 | 561 |
| 488 | 3300005406 | Ga0070703_10013806 | Ga0070703_100138062 | 561 |
| 489 | 3300005435 | Ga0070714_100089560 | Ga0070714_1000895601 | 561 |
| 490 | 3300005437 | Ga0070710_10001526 | Ga0070710_100015266 | 561 |
| 491 | 3300005438 | Ga0070701_10001376 | Ga0070701_100013764 | 561 |
| 492 | 3300005441 | Ga0070700_100035827 | Ga0070700_1000358271 | 561 |
| 493 | 3300005444 | Ga0070694_100003044 | Ga0070694_1000030446 | 561 |
| 494 | 3300005455 | Ga0070663_100008709 | Ga0070663_1000087095 | 561 |
| 495 | 3300005456 | Ga0070678_100003051 | Ga0070678_1000030516 | 561 |
| 496 | 3300005459 | Ga0068867_100018245 | Ga0068867_1000182455 | 561 |
| 497 | 3300005466 | Ga0070685_10016348 | Ga0070685_100163482 | 561 |
| 498 | 3300005539 | Ga0068853_100015450 | Ga0068853_1000154503 | 561 |
| 499 | 3300005546 | Ga0070696_100055789 | Ga0070696_1000557891 | 561 |
| 500 | 3300005547 | Ga0070693_100004959 | Ga0070693_1000049593 | 561 |
| 501 | 3300005548 | Ga0070665_100059230 | Ga0070665_1000592304 | 561 |
| 502 | 3300005549 | Ga0070704_100011383 | Ga0070704_1000113831 | 561 |
| 503 | 3300005578 | Ga0068854_100003477 | Ga0068854_1000034776 | 561 |
| 504 | 3300005614 | Ga0068856_100048778 | Ga0068856_1000487781 | 561 |
| 505 | 3300005615 | Ga0070702_100003129 | Ga0070702_1000031296 | 561 |
| 506 | 3300005718 | Ga0068866_10001286 | Ga0068866_1000128610 | 561 |
| 507 | 3300005842 | Ga0068858_100012623 | Ga0068858_1000126234 | 561 |
| 508 | 3300005843 | Ga0068860_100039609 | Ga0068860_1000396094 | 561 |
| 509 | 3300006163 | Ga0070715_10001773 | Ga0070715_100017733 | 561 |
| 510 | 3300006173 | Ga0070716_100007313 | Ga0070716_1000073133 | 561 |
| 511 | 3300006175 | Ga0070712_100017360 | Ga0070712_1000173601 | 561 |
| 512 | 3300006237 | Ga0097621_100016649 | Ga0097621_1000166495 | 561 |
| 513 | 3300006881 | Ga0068865_100005382 | Ga0068865_1000053828 | 561 |
| 514 | 3300009092 | Ga0105250_10018818 | Ga0105250_100188182 | 561 |
| 515 | 3300009093 | Ga0105240_10194768 | Ga0105240_101947681 | 561 |
| 516 | 3300009098 | Ga0105245_10006958 | Ga0105245_100069584 | 561 |
| 517 | 3300009101 | Ga0105247_10003161 | Ga0105247_100031616 | 561 |
| 518 | 3300009148 | Ga0105243_10011970 | Ga0105243_100119706 | 561 |
| 519 | 3300009174 | Ga0105241_10031704 | Ga0105241_100317042 | 561 |
| 520 | 3300009176 | Ga0105242_10013303 | Ga0105242_100133033 | 561 |
| 521 | 3300009177 | Ga0105248_10148538 | Ga0105248_101485383 | 561 |
| 522 | 3300009545 | Ga0105237_10132497 | Ga0105237_101324971 | 561 |
| 523 | 3300009551 | Ga0105238_10052842 | Ga0105238_100528423 | 561 |
| 524 | 3300010375 | Ga0105239_10015491 | Ga0105239_100154917 | 561 |
| 525 | 3300013296 | Ga0157374_10051438 | Ga0157374_100514382 | 561 |
| 526 | 3300013297 | Ga0157378_10023725 | Ga0157378_100237251 | 561 |
| 527 | 3300013307 | Ga0157372_10073041 | Ga0157372_100730411 | 561 |
| 528 | 3300014745 | Ga0157377_10027722 | Ga0157377_100277223 | 561 |
| 529 | 3300014969 | Ga0157376_10035368 | Ga0157376_100353683 | 561 |
| 530 | 3300017792 | Ga0163161_10015432 | Ga0163161_100154321 | 561 |
| 531 | 3300025898 | Ga0207692_10002768 | Ga0207692_100027683 | 561 |
| 532 | 3300025899 | Ga0207642_10000683 | Ga0207642_100006838 | 561 |
| 533 | 3300025900 | Ga0207710_10003996 | Ga0207710_100039964 | 561 |
| 534 | 3300025901 | Ga0207688_10006738 | Ga0207688_100067387 | 561 |
| 535 | 3300025904 | Ga0207647_10046366 | Ga0207647_100463662 | 561 |
| 536 | 3300025906 | Ga0207699_10037346 | Ga0207699_100373462 | 561 |
| 537 | 3300025914 | Ga0207671_10118140 | Ga0207671_101181401 | 561 |
| 538 | 3300025915 | Ga0207693_10014595 | Ga0207693_100145951 | 561 |
| 539 | 3300025918 | Ga0207662_10016120 | Ga0207662_100161203 | 561 |
| 540 | 3300025919 | Ga0207657_10026242 | Ga0207657_100262424 | 561 |
| 541 | 3300025923 | Ga0207681_10114770 | Ga0207681_101147701 | 561 |
| 542 | 3300025924 | Ga0207694_10083319 | Ga0207694_100833192 | 561 |
| 543 | 3300025927 | Ga0207687_10004540 | Ga0207687_100045405 | 561 |
| 544 | 3300025931 | Ga0207644_10035876 | Ga0207644_100358763 | 561 |
| 545 | 3300025933 | Ga0207706_10058426 | Ga0207706_100584262 | 561 |
| 546 | 3300025934 | Ga0207686_10009538 | Ga0207686_100095381 | 561 |
| 547 | 3300025935 | Ga0207709_10058672 | Ga0207709_100586721 | 561 |
| 548 | 3300025936 | Ga0207670_10037759 | Ga0207670_100377592 | 561 |
| 549 | 3300025937 | Ga0207669_10003377 | Ga0207669_100033778 | 561 |
| 550 | 3300025938 | Ga0207704_10015741 | Ga0207704_100157412 | 561 |
| 551 | 3300025939 | Ga0207665_10005671 | Ga0207665_100056717 | 561 |
| 552 | 3300025940 | Ga0207691_10036370 | Ga0207691_100363702 | 561 |
| 553 | 3300025942 | Ga0207689_10068601 | Ga0207689_100686012 | 561 |
| 554 | 3300025949 | Ga0207667_10150832 | Ga0207667_101508323 | 561 |
| 555 | 3300025961 | Ga0207712_10009304 | Ga0207712_100093044 | 561 |
| 556 | 3300025972 | Ga0207668_10083760 | Ga0207668_100837601 | 561 |
| 557 | 3300025981 | Ga0207640_10013306 | Ga0207640_100133064 | 561 |
| 558 | 3300025986 | Ga0207658_10011153 | Ga0207658_100111535 | 561 |
| 559 | 3300026023 | Ga0207677_10006998 | Ga0207677_100069986 | 561 |
| 560 | 3300026041 | Ga0207639_10016960 | Ga0207639_100169602 | 561 |
| 561 | 3300026067 | Ga0207678_10024989 | Ga0207678_100249892 | 561 |
| 562 | 3300026075 | Ga0207708_10015633 | Ga0207708_100156333 | 561 |
| 563 | 3300026078 | Ga0207702_10021660 | Ga0207702_100216602 | 561 |
| 564 | 3300026089 | Ga0207648_10015144 | Ga0207648_100151447 | 561 |
| 565 | 3300026121 | Ga0207683_10007032 | Ga0207683_100070326 | 561 |
| 566 | 3300028380 | Ga0268265_10133273 | Ga0268265_101332731 | 561 |
| 567 | 3300035691 | Ga0373931_0002731 | Ga0373931_0002731_3147_4832 | 561 |
| 568 | 3300048903 | Ga0496100_0008594 | Ga0496100_0008594_2145_3830 | 561 |
| 569 | 3300048904 | Ga0496101_0004916 | Ga0496101_0004916_3795_5480 | 561 |
| 570 | 3300048905 | Ga0496102_0020077 | Ga0496102_0020077_2713_4398 | 561 |
| 571 | 3300048907 | Ga0496104_0172295 | Ga0496104_0172295_342_2027 | 561 |
| 572 | 3300048909 | Ga0496106_0010749 | Ga0496106_0010749_1169_2854 | 561 |
| 573 | 3300048917 | Ga0496114_0004810 | Ga0496114_0004810_4813_6498 | 561 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8szz-assembly1.cif.gz_T | cryoem structure of computationally designed nanocage o32-zl4 | 0.8293 | 257 | 310 |
| 4abm-assembly1.cif.gz_B | crystal structure of chmp4b hairpin | 0.823 | 253 | 310 |
| 5zxd-assembly1.cif.gz_A | crystal structure of atp-bound human abcf1 | 0.8067 | 5 | 552 |
| 5zxd-assembly1.cif.gz_A | crystal structure of atp-bound human abcf1 | 0.7751 | 5 | 552 |
| 6r84-assembly1.cif.gz_A | yeast vms1 (q295l)-60s ribosomal subunit complex (pre-state with arb1) | 0.7734 | 7 | 547 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57982_1_74_1.10.287.10 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9664 | 93 | 133 | 1.10.287.10 |
| af_A0A1D6DXQ6_8_144_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9415 | 4 | 62 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9147 | 2 | 62 | 3.40.50.300 |
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.903 | 3 | 62 | 3.40.50.300 |
| af_C0P4H6_339_588_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.855 | 301 | 548 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535J7C1-F1-model_v4 | ABC-F family ATP-binding cassette domain-containing protein | 0.9596 | 1 | 551 |
GO:0005524
GO:0016887 |
| AF-A0A535J7C1-F1-model_v4 | ABC-F family ATP-binding cassette domain-containing protein | 0.9561 | 1 | 551 |
GO:0005524
GO:0016887 |
| AF-A0A3D3KW32-F1-model_v4 | ABC transporter | 0.9298 | 1 | 335 |
GO:0005524
GO:0016887 |
| AF-A0A3D3KW32-F1-model_v4 | ABC transporter | 0.9271 | 1 | 335 |
GO:0005524
GO:0016887 |
| AF-A0A7V8LI36-F1-model_v4 | deleted | 0.9224 | 2 | 560 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar