F465205

General Info

Members Datasets Scaffolds Average Seq Length
573 306 543 189

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_1185876|Ga0395901_1185876_107_679
Length 181
Sequence MNLILFGPPAAGKGTQAKRLVAERGMVQLSTGDMLRAARTSGSELGKRVAAIMDAGSLVSDEIVIALIEERLPEAEAAGGAIFDGFPRTVAQAEALDAMLARRGQQIDRVVRLKVDDEFEQEGRADDNPESFKVRLTAYNTQTAPLLPFYRSQGKLVEVDGMAPIEAVAKSIDAALQEEDA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
15 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
16 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
17 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
18 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
19 2818991435 Caulobacter henricii 536 Isolate Unclassified
20 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
21 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
22 2849560528 Caulobacter zeae 410 Isolate Unclassified
23 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
24 2851153111 Caulobacter radicis 736 Isolate Unclassified
25 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
26 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
27 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
28 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
29 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
176 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
177 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
272 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
275 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
276 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
279 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
280 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
284 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
290 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
291 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
296 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
297 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
298 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
299 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
300 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
301 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
304 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
305 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.59
Metatranscriptomes 0.17
Isolates 5.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26
Nodule 0
Rhizoplane 3.32
Rhizosphere 62.48
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1001243 3300003773 Bacteria 10661
2 Ga0055524_1018359 3300003775 Bacteria 2431
3 Ga0055536_1005404 3300003781 Bacteria 6259
4 Ga0055536_1041318 3300003781 Bacteria 1090
5 Ga0055536_1042951 3300003781 Bacteria 1053
6 Ga0055528_1011497 3300003790 Bacteria 3509
7 Ga0055530_10012430 3300003791 Bacteria 2969
8 Ga0055530_10043136 3300003791 Bacteria 1090
9 Ga0055531_10004281 3300003794 Bacteria 8764
10 Ga0055531_10008562 3300003794 Bacteria 5369
11 Ga0055531_10019251 3300003794 Bacteria 2773
12 Ga0055531_10023189 3300003794 Bacteria 2337
13 Ga0065165_1000506 3300005262 Bacteria 60005
14 Ga0065165_1001803 3300005262 Bacteria 21053
15 Ga0065165_1037942 3300005262 Bacteria 1456
16 Ga0070658_10074114 3300005327 Bacteria 2791
17 Ga0070658_10538954 3300005327 Bacteria 1010
18 Ga0070676_10276975 3300005328 Bacteria 1129
19 Ga0070666_10033323 3300005335 Bacteria 3408
20 Ga0068868_100866726 3300005338 Bacteria 819
21 Ga0070660_100172670 3300005339 Bacteria 1746
22 Ga0070668_100005674 3300005347 Bacteria 9250
23 Ga0070668_100045743 3300005347 Bacteria 3358
24 Ga0070671_100006755 3300005355 Bacteria 9181
25 Ga0070671_100039967 3300005355 Bacteria 3894
26 Ga0070659_100026036 3300005366 Bacteria 4499
27 Ga0070667_100006266 3300005367 Bacteria 9889
28 Ga0070667_100013914 3300005367 Bacteria 6652
29 Ga0070667_100017440 3300005367 Bacteria 5951
30 Ga0070667_100889347 3300005367 Bacteria 829
31 Ga0070662_100559064 3300005457 Bacteria 959
32 Ga0070681_10015119 3300005458 Bacteria 7677
33 Ga0070679_100036715 3300005530 Bacteria 4863
34 Ga0068853_100126785 3300005539 Bacteria 2281
35 Ga0068853_100543764 3300005539 Bacteria 1100
36 Ga0070665_100000121 3300005548 Bacteria 147683
37 Ga0070665_100006341 3300005548 Bacteria 12070
38 Ga0070665_100033382 3300005548 Bacteria 5178
39 Ga0070665_100048252 3300005548 Bacteria 4275
40 Ga0070665_100257376 3300005548 Bacteria 1747
41 Ga0070665_100390889 3300005548 Bacteria 1399
42 Ga0068855_100085341 3300005563 Bacteria 3653
43 Ga0068855_100620669 3300005563 Bacteria 1164
44 Ga0068855_100647109 3300005563 Bacteria 1135
45 Ga0068855_100720375 3300005563 Bacteria 1066
46 Ga0068855_100860872 3300005563 Bacteria 960
47 Ga0070664_101298900 3300005564 Bacteria 687
48 Ga0068857_100196681 3300005577 Bacteria 1837
49 Ga0068856_100127771 3300005614 Bacteria 2545
50 Ga0068859_100001281 3300005617 Bacteria 25688
51 Ga0068859_100056400 3300005617 Bacteria 3954
52 Ga0068864_100000263 3300005618 Bacteria 47003
53 Ga0068864_100047770 3300005618 Bacteria 3678
54 Ga0068864_100576791 3300005618 Bacteria 1090
55 Ga0068861_100385776 3300005719 Bacteria 1239
56 Ga0068863_100000694 3300005841 Bacteria 33782
57 Ga0068863_100004023 3300005841 Bacteria 14519
58 Ga0068863_100066653 3300005841 Bacteria 3405
59 Ga0068863_100267964 3300005841 Bacteria 1652
60 Ga0068858_100000270 3300005842 Bacteria 55629
61 Ga0068858_100007271 3300005842 Bacteria 10730
62 Ga0068858_100028881 3300005842 Bacteria 5150
63 Ga0068860_100001684 3300005843 Bacteria 23610
64 Ga0068860_100010284 3300005843 Bacteria 9258
65 Ga0068862_100007110 3300005844 Bacteria 9298
66 Ga0068862_100105908 3300005844 Bacteria 2465
67 Ga0068862_100111265 3300005844 Bacteria 2404
68 Ga0070717_10499906 3300006028 Bacteria 1099
69 Ga0075368_10192113 3300006042 Bacteria 862
70 Ga0075364_10001038 3300006051 Bacteria 14772
71 Ga0075362_10047558 3300006177 Bacteria 1911
72 Ga0075362_10049211 3300006177 Bacteria 1882
73 Ga0075362_10314675 3300006177 Bacteria 779
74 Ga0075367_10005954 3300006178 Bacteria 6120
75 Ga0075369_10006831 3300006186 Bacteria 4333
76 Ga0075366_10061263 3300006195 Bacteria 2236
77 Ga0075366_10167308 3300006195 Bacteria 1333
78 Ga0075366_10351649 3300006195 Bacteria 904
79 Ga0075370_10057413 3300006353 Bacteria 2212
80 Ga0075370_10112122 3300006353 Bacteria 1584
81 Ga0075370_10254806 3300006353 Bacteria 1040
82 Ga0075370_10332165 3300006353 Bacteria 906
83 Ga0075370_10406156 3300006353 Bacteria 817
84 Ga0068865_100065752 3300006881 Bacteria 2556
85 Ga0097620_100001281 3300006931 Bacteria 25688
86 Ga0097620_100056401 3300006931 Bacteria 3954
87 Ga0105251_10105626 3300009011 Bacteria 1286
88 Ga0105250_10033094 3300009092 Bacteria 2075
89 Ga0105240_10000798 3300009093 Bacteria 57073
90 Ga0105240_10024975 3300009093 Bacteria 7865
91 Ga0105240_10067893 3300009093 Bacteria 4418
92 Ga0105240_10116281 3300009093 Bacteria 3227
93 Ga0105245_10429531 3300009098 Bacteria 1326
94 Ga0105247_10084038 3300009101 Bacteria 2011
95 Ga0105248_10006540 3300009177 Bacteria 12777
96 Ga0105248_10090304 3300009177 Bacteria 3449
97 Ga0105248_10106187 3300009177 Bacteria 3166
98 Ga0105248_10246345 3300009177 Bacteria 2012
99 Ga0105248_10521734 3300009177 Bacteria 1339
100 Ga0105248_10992774 3300009177 Bacteria 948
101 Ga0105238_10011964 3300009551 Bacteria 8743
102 Ga0105238_10048857 3300009551 Bacteria 4262
103 Ga0105238_10348511 3300009551 Bacteria 1470
104 Ga0105238_10682133 3300009551 Bacteria 1039
105 Ga0105238_10772830 3300009551 Bacteria 975
106 Ga0105238_10970546 3300009551 Bacteria 870
107 Ga0105249_10010200 3300009553 Bacteria 8253
108 Ga0105249_10122540 3300009553 Bacteria 2473
109 Ga0105239_10417733 3300010375 Bacteria 1519
110 Ga0105239_10731919 3300010375 Bacteria 1132
111 Ga0105239_11221154 3300010375 Bacteria 866
112 Ga0157373_10106116 3300013100 Bacteria 1975
113 Ga0157373_10108516 3300013100 Bacteria 1952
114 Ga0157371_10436342 3300013102 Bacteria 962
115 Ga0157370_10157162 3300013104 Bacteria 2115
116 Ga0157369_10032567 3300013105 Bacteria 5731
117 Ga0157374_10158724 3300013296 Bacteria 2202
118 Ga0157374_10301971 3300013296 Bacteria 1584
119 Ga0157374_11348988 3300013296 Bacteria 736
120 Ga0163162_10362915 3300013306 Bacteria 1581
121 Ga0157372_10881984 3300013307 Bacteria 1038
122 Ga0157372_11942397 3300013307 Bacteria 676
123 Ga0157375_10152156 3300013308 Bacteria 2450
124 Ga0163163_10018256 3300014325 Bacteria 6562
125 Ga0163163_10044151 3300014325 Bacteria 4372
126 Ga0163163_10128008 3300014325 Bacteria 2578
127 Ga0163163_10928626 3300014325 Bacteria 933
128 Ga0157380_10152211 3300014326 Bacteria 2001
129 Ga0157379_10009879 3300014968 Bacteria 8312
130 Ga0157379_10009954 3300014968 Bacteria 8282
131 Ga0157379_10091647 3300014968 Bacteria 2726
132 Ga0157379_11568247 3300014968 Bacteria 642
133 Ga0157376_11354898 3300014969 Bacteria 742
134 Ga0183365_10006 3300015684 Bacteria 225936
135 Ga0163161_10382901 3300017792 Bacteria 1125
136 Ga0163161_10502387 3300017792 Bacteria 988
137 Ga0213872_10252414 3300021361 Bacteria 743
138 Ga0213874_10035067 3300021377 Bacteria 1472
139 Ga0213876_10000244 3300021384 Bacteria 51875
140 Ga0213876_10082372 3300021384 Bacteria 1702
141 Ga0209148_1011285 3300025254 Bacteria 1665
142 Ga0209148_1030272 3300025254 Bacteria 812
143 Ga0209565_1000925 3300025263 Bacteria 15538
144 Ga0209673_1002524 3300025273 Bacteria 12545
145 Ga0209673_1048428 3300025273 Bacteria 1144
146 Ga0209675_1002569 3300025291 Bacteria 9211
147 Ga0209676_1004317 3300025292 Bacteria 7996
148 Ga0209676_1005649 3300025292 Bacteria 6445
149 Ga0209676_1005783 3300025292 Bacteria 6325
150 Ga0209564_1024927 3300025295 Bacteria 2029
151 Ga0209564_1052431 3300025295 Bacteria 981
152 Ga0209564_1065116 3300025295 Bacteria 790
153 Ga0209758_1002168 3300025297 Bacteria 20636
154 Ga0209758_1023258 3300025297 Bacteria 2809
155 Ga0209758_1033931 3300025297 Bacteria 2040
156 Ga0209050_1000161 3300025298 Bacteria 155713
157 Ga0209050_1009513 3300025298 Bacteria 4958
158 Ga0209050_1013483 3300025298 Bacteria 3621
159 Ga0209050_1018221 3300025298 Bacteria 2740
160 Ga0209050_1037358 3300025298 Bacteria 1402
161 Ga0209256_1009609 3300025299 Bacteria 4207
162 Ga0209256_1010029 3300025299 Bacteria 4044
163 Ga0209256_1014151 3300025299 Bacteria 2897
164 Ga0209051_1000877 3300025303 Bacteria 30359
165 Ga0209257_1000252 3300025304 Bacteria 123718
166 Ga0209257_1000284 3300025304 Bacteria 112773
167 Ga0209257_1000976 3300025304 Bacteria 38920
168 Ga0209257_1001464 3300025304 Bacteria 27851
169 Ga0207697_10153609 3300025315 Bacteria 1002
170 Ga0207710_10047340 3300025900 Bacteria 1922
171 Ga0207680_10061087 3300025903 Bacteria 2297
172 Ga0207645_10545013 3300025907 Bacteria 787
173 Ga0207705_10004936 3300025909 Bacteria 10013
174 Ga0207705_10466472 3300025909 Bacteria 980
175 Ga0207705_10471179 3300025909 Bacteria 975
176 Ga0207707_10123641 3300025912 Bacteria 2262
177 Ga0207695_10005806 3300025913 Bacteria 16245
178 Ga0207695_10035813 3300025913 Bacteria 5375
179 Ga0207695_10051068 3300025913 Bacteria 4344
180 Ga0207695_11132025 3300025913 Bacteria 663
181 Ga0207671_10237842 3300025914 Bacteria 1430
182 Ga0207660_10000537 3300025917 Bacteria 25426
183 Ga0207657_10025002 3300025919 Bacteria 5517
184 Ga0207657_10095108 3300025919 Bacteria 2479
185 Ga0207657_10124486 3300025919 Bacteria 2118
186 Ga0207652_10002134 3300025921 Bacteria 16964
187 Ga0207681_10208266 3300025923 Bacteria 1506
188 Ga0207694_10013350 3300025924 Bacteria 6186
189 Ga0207694_10072687 3300025924 Bacteria 2689
190 Ga0207694_10096124 3300025924 Bacteria 2343
191 Ga0207650_10000883 3300025925 Bacteria 22684
192 Ga0207650_10350933 3300025925 Bacteria 1214
193 Ga0207687_10558591 3300025927 Bacteria 961
194 Ga0207644_10085476 3300025931 Bacteria 2340
195 Ga0207644_10129068 3300025931 Bacteria 1933
196 Ga0207690_10008954 3300025932 Bacteria 5941
197 Ga0207690_10016460 3300025932 Bacteria 4498
198 Ga0207704_10057117 3300025938 Bacteria 2395
199 Ga0207711_10001469 3300025941 Bacteria 21980
200 Ga0207711_10011223 3300025941 Bacteria 7445
201 Ga0207711_10021858 3300025941 Bacteria 5344
202 Ga0207711_10033019 3300025941 Bacteria 4378
203 Ga0207711_10066025 3300025941 Bacteria 3128
204 Ga0207711_10340537 3300025941 Bacteria 1388
205 Ga0207711_10567749 3300025941 Bacteria 1058
206 Ga0207689_10165591 3300025942 Bacteria 1821
207 Ga0207667_10015066 3300025949 Bacteria 8794
208 Ga0207667_10340455 3300025949 Bacteria 1531
209 Ga0207667_10555143 3300025949 Bacteria 1161
210 Ga0207651_10156314 3300025960 Bacteria 1782
211 Ga0207712_10000998 3300025961 Bacteria 20156
212 Ga0207712_10100769 3300025961 Bacteria 2147
213 Ga0207712_10123570 3300025961 Bacteria 1962
214 Ga0207668_10000363 3300025972 Bacteria 28976
215 Ga0207668_10000571 3300025972 Bacteria 23129
216 Ga0207668_10018567 3300025972 Bacteria 4380
217 Ga0207658_10001253 3300025986 Bacteria 20099
218 Ga0207658_10015649 3300025986 Bacteria 5207
219 Ga0207658_10033313 3300025986 Bacteria 3674
220 Ga0207658_10177740 3300025986 Bacteria 1759
221 Ga0207703_10000133 3300026035 Bacteria 90055
222 Ga0207703_10003217 3300026035 Bacteria 13733
223 Ga0207703_10019152 3300026035 Bacteria 5346
224 Ga0207703_10532415 3300026035 Bacteria 1106
225 Ga0207639_10257917 3300026041 Bacteria 1523
226 Ga0207639_10706926 3300026041 Bacteria 935
227 Ga0207678_10115733 3300026067 Bacteria 2287
228 Ga0207641_10000168 3300026088 Bacteria 92126
229 Ga0207641_10005884 3300026088 Bacteria 10409
230 Ga0207641_10007468 3300026088 Bacteria 9094
231 Ga0207641_10268475 3300026088 Bacteria 1600
232 Ga0207676_10000247 3300026095 Bacteria 47010
233 Ga0207676_10005933 3300026095 Bacteria 8622
234 Ga0207676_10272170 3300026095 Bacteria 1534
235 Ga0207676_10332343 3300026095 Bacteria 1399
236 Ga0207675_100415594 3300026118 Bacteria 1328
237 Ga0207683_10740073 3300026121 Bacteria 912
238 Ga0268266_10000106 3300028379 Bacteria 175109
239 Ga0268266_10001264 3300028379 Bacteria 30909
240 Ga0268266_10018893 3300028379 Bacteria 5871
241 Ga0268266_10042635 3300028379 Bacteria 3877
242 Ga0268266_10082808 3300028379 Bacteria 2799
243 Ga0268265_10004922 3300028380 Bacteria 9184
244 Ga0268265_10043663 3300028380 Bacteria 3334
245 Ga0268264_10000383 3300028381 Bacteria 63883
246 Ga0268264_10124404 3300028381 Bacteria 2277
247 Ga0265318_10062053 3300028577 Bacteria 1392
248 Ga0307517_10012557 3300028786 Bacteria 11610
249 Ga0307517_10118324 3300028786 Bacteria 1972
250 Ga0307517_10226581 3300028786 Bacteria 1128
251 Ga0307515_10173473 3300028794 Bacteria 2137
252 Ga0265338_10115127 3300028800 Bacteria 2156
253 Ga0265338_10280502 3300028800 Bacteria 1218
254 Ga0265320_10057316 3300031240 Bacteria 1869
255 Ga0265327_10005226 3300031251 Bacteria 10946
256 Ga0307513_10000162 3300031456 Bacteria 96000
257 Ga0307513_10002446 3300031456 Bacteria 25748
258 Ga0307513_10009092 3300031456 Bacteria 12594
259 Ga0307408_100276229 3300031548 Bacteria 1397
260 Ga0265314_10160976 3300031711 Bacteria 1366
261 Ga0265342_10226644 3300031712 Bacteria 1005
262 Ga0307413_10105886 3300031824 Bacteria 1870
263 Ga0307413_10466008 3300031824 Bacteria 1006
264 Ga0307413_10647645 3300031824 Bacteria 871
265 Ga0307406_10019633 3300031901 Bacteria 3969
266 Ga0307412_10011065 3300031911 Bacteria 5214
267 Ga0307412_10374705 3300031911 Bacteria 1150
268 Ga0307414_10018511 3300032004 Bacteria 4291
269 Ga0307414_10039430 3300032004 Bacteria 3181
270 Ga0307414_10153736 3300032004 Bacteria 1818
271 Ga0307414_10197205 3300032004 Bacteria 1634
272 Ga0307414_10294725 3300032004 Bacteria 1369
273 Ga0307414_10522799 3300032004 Bacteria 1053
274 Ga0307414_10607419 3300032004 Bacteria 981
275 Ga0307414_11109718 3300032004 Bacteria 730
276 Ga0307411_10075136 3300032005 Bacteria 2306
277 Ga0307510_10028447 3300033180 Bacteria 6383
278 Ga0373946_0011042 3300035171 Bacteria 3359
279 Ga0373935_0515643 3300035692 Bacteria 869
280 Ga0373927_0000479 3300035695 Bacteria 30749
281 Ga0373925_0000023 3300037068 Bacteria 158881
282 Ga0373925_0277644 3300037068 Bacteria 1349
283 Ga0395899_0000105 3300037312 Bacteria 146163
284 Ga0395899_0019425 3300037312 Bacteria 5163
285 Ga0395899_0141621 3300037312 Bacteria 1710
286 Ga0395900_0004844 3300037418 Bacteria 14179
287 Ga0395900_0103443 3300037418 Bacteria 2925
288 Ga0395900_0236305 3300037418 Bacteria 1835
289 Ga0395900_0263078 3300037418 Bacteria 1722
290 Ga0395898_0081730 3300037466 Bacteria 3115
291 Ga0395898_0191073 3300037466 Bacteria 1956
292 Ga0395898_0204351 3300037466 Bacteria 1885
293 Ga0395898_0426203 3300037466 Bacteria 1264
294 Ga0395898_0464708 3300037466 Bacteria 1204
295 Ga0395898_0952116 3300037466 Bacteria 795
296 Ga0395905_0004157 3300037471 Bacteria 15144
297 Ga0395905_0050580 3300037471 Bacteria 3893
298 Ga0395905_0071485 3300037471 Bacteria 3253
299 Ga0395905_0466801 3300037471 Bacteria 1161
300 Ga0395905_0730104 3300037471 Bacteria 893
301 Ga0395905_0928586 3300037471 Bacteria 773
302 Ga0395905_1101583 3300037471 Bacteria 697
303 Ga0436364_0207421 3300037853 Bacteria 1969
304 Ga0395901_0048250 3300038443 Bacteria 4422
305 Ga0395901_0200384 3300038443 Bacteria 2092
306 Ga0395901_0251617 3300038443 Bacteria 1840
307 Ga0395901_1185876 3300038443 Bacteria 730
308 Ga0436365_0376847 3300039437 Bacteria 89580
309 Ga0436361_0278754 3300039447 Bacteria 1484
310 Ga0436363_0782763 3300039450 Bacteria 3184
311 Ga0439465_0075665 3300041413 Bacteria 1134
312 Ga0451802_0446311 3300041460 Bacteria 800
313 Ga0451804_0369730 3300041463 Bacteria 955
314 Ga0451849_0750964 3300041505 Bacteria 1529
315 Ga0439441_010814 3300042001 Bacteria 1538
316 Ga0439446_0018383 3300042156 Bacteria 1958
317 Ga0466969_0002862 3300044656 Bacteria 9217
318 Ga0466969_0067732 3300044656 Bacteria 1722
319 Ga0466966_0001452 3300044684 Bacteria 15233
320 Ga0466961_0000659 3300044693 Bacteria 21720
321 Ga0466971_0000901 3300044719 Bacteria 12185
322 Ga0466957_0020507 3300044842 Bacteria 3889
323 Ga0466959_0000162 3300045049 Bacteria 44052
324 Ga0466959_0111158 3300045049 Bacteria 1955
325 Ga0466958_0000155 3300045836 Bacteria 24034
326 Ga0495627_000399 3300046453 Bacteria 38947
327 Ga0495590_0003932 3300046457 Bacteria 6042
328 Ga0495638_0029467 3300046460 Bacteria 3539
329 Ga0495638_0033790 3300046460 Bacteria 3269
330 Ga0495638_0060245 3300046460 Bacteria 2348
331 Ga0495638_0111514 3300046460 Bacteria 1624
332 Ga0495638_0138693 3300046460 Bacteria 1421
333 Ga0495650_0000269 3300046471 Bacteria 99675
334 Ga0495650_0133542 3300046471 Bacteria 903
335 Ga0495583_0000650 3300046506 Bacteria 45814
336 Ga0495583_0019160 3300046506 Bacteria 3579
337 Ga0495606_0005780 3300046507 Bacteria 11694
338 Ga0495606_0149726 3300046507 Bacteria 1371
339 Ga0495610_0000225 3300046512 Bacteria 60452
340 Ga0495610_0022193 3300046512 Bacteria 3477
341 Ga0495610_0042727 3300046512 Bacteria 2264
342 Ga0495616_0025486 3300046513 Bacteria 3159
343 Ga0495616_0138684 3300046513 Bacteria 1109
344 Ga0495620_0070846 3300046515 Bacteria 1427
345 Ga0495628_0265188 3300046516 Bacteria 1279
346 Ga0495631_0004192 3300046518 Bacteria 7709
347 Ga0495632_0104743 3300046519 Bacteria 1331
348 Ga0495637_0008865 3300046520 Bacteria 4923
349 Ga0495637_0026004 3300046520 Bacteria 2633
350 Ga0495637_0125503 3300046520 Bacteria 984
351 Ga0495637_0182290 3300046520 Bacteria 778
352 Ga0495643_0038603 3300046522 Bacteria 2614
353 Ga0495648_0014211 3300046524 Bacteria 5839
354 Ga0495648_0074622 3300046524 Bacteria 1953
355 Ga0495642_0033215 3300046528 Bacteria 2074
356 Ga0495642_0123335 3300046528 Bacteria 1112
357 Ga0495654_0000123 3300046530 Bacteria 86159
358 Ga0495654_0061031 3300046530 Bacteria 1811
359 Ga0495609_0029409 3300046538 Bacteria 2502
360 Ga0495597_0001666 3300046542 Bacteria 15467
361 Ga0495597_0039203 3300046542 Bacteria 2122
362 Ga0495622_0054775 3300046557 Bacteria 1850
363 Ga0495633_0000510 3300046558 Bacteria 39075
364 Ga0495668_0001504 3300046616 Bacteria 22287
365 Ga0495668_0010366 3300046616 Bacteria 5641
366 Ga0495668_0010401 3300046616 Bacteria 5629
367 Ga0495668_0065748 3300046616 Bacteria 1996
368 Ga0495668_0068933 3300046616 Bacteria 1945
369 Ga0495668_0151846 3300046616 Bacteria 1268
370 Ga0495668_0219373 3300046616 Bacteria 1041
371 Ga0495668_0244560 3300046616 Bacteria 982
372 Ga0495611_0065080 3300046648 Bacteria 1661
373 Ga0495625_0001925 3300046660 Bacteria 23466
374 Ga0495625_0024878 3300046660 Bacteria 4547
375 Ga0495625_0051073 3300046660 Bacteria 2965
376 Ga0495625_0068124 3300046660 Bacteria 2502
377 Ga0495625_0189563 3300046660 Bacteria 1363
378 Ga0495625_0275001 3300046660 Bacteria 1085
379 Ga0495625_0296831 3300046660 Bacteria 1035
380 Ga0495669_0000044 3300046684 Bacteria 85633
381 Ga0495669_0036788 3300046684 Bacteria 2165
382 Ga0495669_0042439 3300046684 Bacteria 2022
383 Ga0495670_0123843 3300046691 Bacteria 1344
384 Ga0495671_0093898 3300046692 Bacteria 1468
385 Ga0495660_0063433 3300046810 Bacteria 1978
386 Ga0495674_0231731 3300047319 Bacteria 1524
387 Ga0495672_0000439 3300047320 Bacteria 49666
388 Ga0495687_071476 3300047443 Bacteria 1390
389 Ga0495677_0043988 3300047445 Bacteria 1637
390 Ga0495673_0000189 3300047469 Bacteria 99018
391 Ga0495673_0006882 3300047469 Bacteria 6626
392 Ga0495673_0053806 3300047469 Bacteria 1753
393 Ga0495681_0152280 3300047470 Bacteria 969
394 Ga0495686_0015147 3300047472 Bacteria 5280
395 Ga0495686_0114998 3300047472 Bacteria 1609
396 Ga0495686_0222995 3300047472 Bacteria 1071
397 Ga0495593_0008408 3300047673 Bacteria 6002
398 Ga0496100_0464933 3300048903 Bacteria 971
399 Ga0496101_0224762 3300048904 Bacteria 1458
400 Ga0496102_0089384 3300048905 Bacteria 2849
401 Ga0496103_0378481 3300048906 Bacteria 910
402 Ga0496104_0562732 3300048907 Bacteria 1051
403 Ga0496106_0691747 3300048909 Bacteria 813
404 Ga0496106_0733398 3300048909 Bacteria 786
405 Ga0496107_0000073 3300048910 Bacteria 48489
406 Ga0496107_0385901 3300048910 Bacteria 1042
407 Ga0496109_0147307 3300048912 Bacteria 2203
408 Ga0496112_0060193 3300048915 Bacteria 3742
409 Ga0496112_0526731 3300048915 Bacteria 1116
410 Ga0496115_0001049 3300048918 Bacteria 20043
411 Ga0496115_0003309 3300048918 Bacteria 11572
412 Ga0496115_0034445 3300048918 Bacteria 4002
413 Ga0496115_0151099 3300048918 Bacteria 1918
414 Ga0496115_0302127 3300048918 Bacteria 1311
415 Ga0496116_0023211 3300048919 Bacteria 4626
416 Ga0496117_0010638 3300048920 Bacteria 8344
417 Ga0496118_0018740 3300048921 Bacteria 6219
418 Ga0496119_0023232 3300048922 Bacteria 4407
419 Ga0496121_0000946 3300048924 Bacteria 52586
420 Ga0496121_0023808 3300048924 Bacteria 5879
421 Ga0496122_0247556 3300048925 Bacteria 1000
422 Ga0496124_0022787 3300048927 Bacteria 5733
423 Ga0496124_0682174 3300048927 Bacteria 654
424 Ga0496125_0011137 3300048928 Bacteria 9019
425 Ga0496125_0037701 3300048928 Bacteria 4199
426 Ga0496126_0035984 3300048929 Bacteria 4634
427 Ga0495678_005745 3300049459 Bacteria 6741
428 Ga0495682_0070402 3300049460 Bacteria 1259
429 Ga0501319_012596 3300049535 Bacteria 694
430 Ga0501033_0104352 3300049570 Bacteria 2066
431 Ga0501034_0071097 3300049571 Bacteria 3490
432 Ga0501034_0101906 3300049571 Bacteria 2864
433 Ga0501034_0258674 3300049571 Bacteria 1684
434 Ga0501034_0281204 3300049571 Bacteria 1603
435 Ga0501034_0386710 3300049571 Bacteria 1323
436 Ga0501034_0593323 3300049571 Bacteria 1014
437 Ga0501037_0402260 3300049573 Bacteria 939
438 Ga0501037_0574844 3300049573 Bacteria 759
439 Ga0501043_0279923 3300049579 Bacteria 1279
440 Ga0501043_0396106 3300049579 Bacteria 1044
441 Ga0501047_0020305 3300049581 Bacteria 6380
442 Ga0501047_0049812 3300049581 Bacteria 4044
443 Ga0501047_0125576 3300049581 Bacteria 2446
444 Ga0501047_0179783 3300049581 Bacteria 1982
445 Ga0501047_0533573 3300049581 Bacteria 999
446 Ga0501047_0735517 3300049581 Bacteria 803
447 Ga0501238_001704 3300049671 Bacteria 2563
448 Ga0501035_0184904 3300049822 Bacteria 1794
449 Ga0501044_0004107 3300049823 Bacteria 16325
450 Ga0501044_0050685 3300049823 Bacteria 4282
451 Ga0501044_0515535 3300049823 Bacteria 1096
452 nmdc:mga03683_30587_c1 3300050489 Bacteria 2155
453 nmdc:mga03n38_209390_c1 3300050490 Bacteria 1013
454 nmdc:mga00v17_992_c1 3300050491 Bacteria 15172
455 nmdc:mga0yw44_138177_c1 3300050492 Bacteria 1582
456 nmdc:mga0k408_145439_c1 3300050493 Bacteria 1411
457 nmdc:mga0k408_223668_c1 3300050493 Bacteria 1124
458 nmdc:mga0k408_3470_c1 3300050493 Bacteria 8345
459 nmdc:mga06z11_38086_c1 3300050494 Bacteria 2386
460 nmdc:mga04h51_89032_c1 3300050495 Bacteria 1108
461 nmdc:mga07m45_108841_c1 3300050496 Bacteria 1595
462 nmdc:mga07m45_22251_c1 3300050496 Bacteria 3460
463 nmdc:mga07m45_39413_c1 3300050496 Bacteria 2640
464 nmdc:mga0sz30_128998_c1 3300050516 Bacteria 1114
465 nmdc:mga0sz30_13472_c1 3300050516 Bacteria 3202
466 Ga0500635_0000205 3300053080 Bacteria 29287
467 Ga0500635_0001613 3300053080 Bacteria 5434
468 Ga0500578_0000459 3300053086 Bacteria 49572
469 Ga0500578_0138581 3300053086 Bacteria 1522
470 Ga0500578_0220246 3300053086 Bacteria 1154
471 Ga0500643_001398 3300053087 Bacteria 13944
472 Ga0500643_002694 3300053087 Bacteria 8926
473 Ga0500643_007387 3300053087 Bacteria 4440
474 Ga0500643_036788 3300053087 Bacteria 1461
475 Ga0500644_0000193 3300053088 Bacteria 37831
476 Ga0500646_0095781 3300053090 Bacteria 925
477 Ga0500647_0023161 3300053091 Bacteria 2911
478 Ga0500647_0147864 3300053091 Bacteria 1098
479 Ga0500583_0029440 3300053092 Bacteria 2394
480 Ga0500651_0061927 3300053093 Bacteria 2336
481 Ga0500651_0227669 3300053093 Bacteria 1091
482 Ga0500566_0018488 3300053094 Bacteria 4092
483 Ga0500566_0174425 3300053094 Bacteria 1108
484 Ga0500641_0000731 3300053096 Bacteria 11909
485 Ga0500641_0001231 3300053096 Bacteria 9101
486 Ga0500641_0038698 3300053096 Bacteria 1918
487 Ga0500555_000830 3300053103 Bacteria 11035
488 Ga0500556_0001077 3300053104 Bacteria 13785
489 Ga0500556_0241631 3300053104 Bacteria 711
490 Ga0500562_002626 3300053108 Bacteria 4473
491 Ga0500562_018272 3300053108 Bacteria 1810
492 Ga0500562_022322 3300053108 Bacteria 1649
493 Ga0500562_037042 3300053108 Bacteria 1294
494 Ga0500569_000209 3300053109 Bacteria 9331
495 Ga0500572_044848 3300053111 Bacteria 1298
496 Ga0500594_0003661 3300053118 Bacteria 3387
497 Ga0500595_003695 3300053119 Bacteria 7065
498 Ga0500595_015498 3300053119 Bacteria 2859
499 Ga0500607_031666 3300053121 Bacteria 2908
500 Ga0500608_001997 3300053122 Bacteria 7304
501 Ga0500614_002054 3300053123 Bacteria 4602
502 Ga0500618_000395 3300053125 Bacteria 30005
503 Ga0500642_0185585 3300053130 Bacteria 971
504 Ga0500655_041988 3300053133 Bacteria 899
505 Ga0500658_0000930 3300053134 Bacteria 11933
506 Ga0500559_0000113 3300053136 Bacteria 63512
507 Ga0500559_0001398 3300053136 Bacteria 13721
508 Ga0500559_0040062 3300053136 Bacteria 2039
509 Ga0500559_0135916 3300053136 Bacteria 1149
510 Ga0500559_0167498 3300053136 Bacteria 1033
511 Ga0500564_004939 3300053138 Bacteria 5401
512 Ga0500568_0073341 3300053139 Bacteria 1308
513 Ga0500568_0241294 3300053139 Bacteria 659
514 Ga0500573_0090345 3300053140 Bacteria 1731
515 Ga0500573_0097621 3300053140 Bacteria 1655
516 Ga0500577_0233309 3300053142 Bacteria 798
517 Ga0500590_027355 3300053148 Bacteria 2957
518 Ga0500603_007841 3300053150 Bacteria 2351
519 Ga0500616_0117876 3300053153 Bacteria 1272
520 Ga0500619_011768 3300053154 Bacteria 2263
521 Ga0500622_0003777 3300053156 Bacteria 9878
522 Ga0500622_0019916 3300053156 Bacteria 3562
523 Ga0500622_0119841 3300053156 Bacteria 1277
524 Ga0500622_0173573 3300053156 Bacteria 1001
525 Ga0500638_294175 3300053162 Bacteria 630
526 Ga0500639_263981 3300053163 Bacteria 678
527 Ga0500636_0011953 3300053177 Bacteria 5085
528 Ga0500636_0044836 3300053177 Bacteria 2608
529 Ga0500636_0151117 3300053177 Bacteria 1275
530 Ga0500637_0011054 3300053178 Bacteria 4648
531 Ga0500637_0022917 3300053178 Bacteria 3408
532 Ga0500576_098563 3300053725 Bacteria 1198
533 Ga0500611_002965 3300053727 Bacteria 2112
534 Ga0500625_033878 3300053729 Bacteria 2422
535 Ga0500645_018026 3300053730 Bacteria 2207
536 Ga0500645_033117 3300053730 Bacteria 1547
537 Ga0500645_041961 3300053730 Bacteria 1350
538 Ga0500645_051447 3300053730 Bacteria 1201
539 Ga0500645_054586 3300053730 Bacteria 1162
540 Ga0500552_015017 3300053733 Bacteria 1030
541 Ga0500596_002676 3300053735 Bacteria 3494
542 Ga0500661_031656 3300055283 Bacteria 933
543 Ga0466962_0000714 3300061719 Bacteria 14806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10881984 Ga0157372_108819841 179
2 3300038443 Ga0395901_1185876 Ga0395901_1185876_107_679 179
3 iso_pu_bacteria 2928972540 2928974673 182
4 iso_pu_bacteria 2941485952 2941486956 182
5 iso_pu_bacteria 2977240413 2977242287 182
6 iso_pu_bacteria 2643221663 2644352431 183
7 3300046558 Ga0495633_0000510 Ga0495633_0000510_36995_37549 184
8 iso_pu_bacteria 2510917020 2511120790 185
9 iso_pu_bacteria 2582581279 2585150070 185
10 iso_pu_bacteria 2582581280 2585155407 185
11 iso_pu_bacteria 2582581293 2585199191 185
12 iso_pu_bacteria 2585428106 2587919525 185
13 iso_pu_bacteria 2643221545 2643747975 185
14 iso_pu_bacteria 2643221552 2643781688 185
15 iso_pu_bacteria 2643221574 2643884724 185
16 iso_pu_bacteria 2643221583 2643926337 185
17 iso_pu_bacteria 2643221584 2643931628 185
18 iso_pu_bacteria 2643221598 2643997904 185
19 iso_pu_bacteria 2643221640 2644226544 185
20 iso_pu_bacteria 2643221642 2644236032 185
21 iso_pu_bacteria 2643221691 2644507922 185
22 iso_pu_bacteria 2643221699 2644548384 185
23 iso_pu_bacteria 2643221699 2644553152 185
24 iso_pu_bacteria 2739367756 2739792117 185
25 iso_pu_bacteria 2791355048 2792463731 185
26 iso_pu_bacteria 2818991435 2819536844 185
27 iso_pu_bacteria 2818991454 2819646005 185
28 iso_pu_bacteria 2843744320 2843747105 185
29 iso_pu_bacteria 2849560528 2849560644 185
30 iso_pu_bacteria 2849573788 2849578485 185
31 iso_pu_bacteria 2851153111 2851154272 185
32 iso_pu_bacteria 2898329390 2898331324 185
33 iso_pu_bacteria 2928531327 2928535734 185
34 3300003781 Ga0055536_1005404 Ga0055536_10054047 186
35 3300003794 Ga0055531_10023189 Ga0055531_100231893 186
36 3300006028 Ga0070717_10499906 Ga0070717_104999062 186
37 3300006353 Ga0075370_10057413 Ga0075370_100574131 186
38 3300013102 Ga0157371_10436342 Ga0157371_104363422 186
39 3300013104 Ga0157370_10157162 Ga0157370_101571623 186
40 3300013105 Ga0157369_10032567 Ga0157369_100325675 186
41 3300014969 Ga0157376_11354898 Ga0157376_113548981 186
42 3300015684 Ga0183365_10006 Ga0183365_1000626 186
43 3300017792 Ga0163161_10502387 Ga0163161_105023871 186
44 3300025292 Ga0209676_1004317 Ga0209676_10043178 186
45 3300025298 Ga0209050_1018221 Ga0209050_10182212 186
46 3300025304 Ga0209257_1000284 Ga0209257_1000284109 186
47 3300031901 Ga0307406_10019633 Ga0307406_100196334 186
48 3300031911 Ga0307412_10011065 Ga0307412_100110654 186
49 3300032004 Ga0307414_10153736 Ga0307414_101537362 186
50 3300032004 Ga0307414_10294725 Ga0307414_102947252 186
51 3300041463 Ga0451804_0369730 Ga0451804_0369730_288_854 186
52 3300044656 Ga0466969_0002862 Ga0466969_0002862_5982_6542 186
53 3300044684 Ga0466966_0001452 Ga0466966_0001452_14482_15042 186
54 3300044693 Ga0466961_0000659 Ga0466961_0000659_17884_18444 186
55 3300044719 Ga0466971_0000901 Ga0466971_0000901_7672_8232 186
56 3300044842 Ga0466957_0020507 Ga0466957_0020507_3207_3767 186
57 3300045049 Ga0466959_0000162 Ga0466959_0000162_13027_13587 186
58 3300045836 Ga0466958_0000155 Ga0466958_0000155_5610_6170 186
59 3300046616 Ga0495668_0065748 Ga0495668_0065748_875_1435 186
60 3300046616 Ga0495668_0219373 Ga0495668_0219373_204_764 186
61 3300046616 Ga0495668_0244560 Ga0495668_0244560_131_691 186
62 3300048919 Ga0496116_0023211 Ga0496116_0023211_3353_3913 186
63 3300048928 Ga0496125_0011137 Ga0496125_0011137_6528_7088 186
64 3300049535 Ga0501319_012596 Ga0501319_012596_30_590 186
65 3300049571 Ga0501034_0071097 Ga0501034_0071097_750_1310 186
66 3300049571 Ga0501034_0386710 Ga0501034_0386710_286_846 186
67 3300053080 Ga0500635_0001613 Ga0500635_0001613_1985_2545 186
68 3300053093 Ga0500651_0227669 Ga0500651_0227669_456_1016 186
69 3300053119 Ga0500595_015498 Ga0500595_015498_1914_2492 186
70 3300053136 Ga0500559_0167498 Ga0500559_0167498_259_819 186
71 3300053156 Ga0500622_0019916 Ga0500622_0019916_1584_2144 186
72 3300061719 Ga0466962_0000714 Ga0466962_0000714_11487_12047 186
73 3300005327 Ga0070658_10074114 Ga0070658_100741142 187
74 3300005327 Ga0070658_10538954 Ga0070658_105389541 187
75 3300025909 Ga0207705_10466472 Ga0207705_104664722 187
76 3300025941 Ga0207711_10001469 Ga0207711_1000146927 187
77 3300026041 Ga0207639_10257917 Ga0207639_102579172 187
78 3300032004 Ga0307414_10039430 Ga0307414_100394302 187
79 3300032004 Ga0307414_10197205 Ga0307414_101972052 187
80 3300032004 Ga0307414_10522799 Ga0307414_105227992 187
81 3300032004 Ga0307414_11109718 Ga0307414_111097181 187
82 3300041460 Ga0451802_0446311 Ga0451802_0446311_102_665 187
83 3300049570 Ga0501033_0104352 Ga0501033_0104352_1035_1598 187
84 3300049571 Ga0501034_0101906 Ga0501034_0101906_2223_2786 187
85 3300049573 Ga0501037_0402260 Ga0501037_0402260_157_720 187
86 3300049581 Ga0501047_0049812 Ga0501047_0049812_1250_1813 187
87 3300053096 Ga0500641_0001231 Ga0500641_0001231_4990_5553 187
88 3300053104 Ga0500556_0241631 Ga0500556_0241631_13_576 187
89 3300053108 Ga0500562_022322 Ga0500562_022322_397_960 187
90 3300053139 Ga0500568_0073341 Ga0500568_0073341_112_675 187
91 3300053139 Ga0500568_0241294 Ga0500568_0241294_65_628 187
92 3300053140 Ga0500573_0090345 Ga0500573_0090345_360_923 187
93 3300053153 Ga0500616_0117876 Ga0500616_0117876_130_693 187
94 3300053730 Ga0500645_018026 Ga0500645_018026_164_727 187
95 3300053730 Ga0500645_051447 Ga0500645_051447_475_1038 187
96 3300005328 Ga0070676_10276975 Ga0070676_102769752 188
97 3300005338 Ga0068868_100866726 Ga0068868_1008667262 188
98 3300005539 Ga0068853_100543764 Ga0068853_1005437642 188
99 3300005548 Ga0070665_100390889 Ga0070665_1003908892 188
100 3300005563 Ga0068855_100720375 Ga0068855_1007203752 188
101 3300005564 Ga0070664_101298900 Ga0070664_1012989001 188
102 3300009551 Ga0105238_10682133 Ga0105238_106821332 188
103 3300013296 Ga0157374_10301971 Ga0157374_103019713 188
104 3300025254 Ga0209148_1011285 Ga0209148_10112852 188
105 3300025907 Ga0207645_10545013 Ga0207645_105450131 188
106 3300025949 Ga0207667_10555143 Ga0207667_105551432 188
107 3300026041 Ga0207639_10706926 Ga0207639_107069262 188
108 3300028800 Ga0265338_10115127 Ga0265338_101151272 188
109 3300031824 Ga0307413_10647645 Ga0307413_106476452 188
110 3300032005 Ga0307411_10075136 Ga0307411_100751362 188
111 3300037312 Ga0395899_0019425 Ga0395899_0019425_2617_3189 188
112 3300037418 Ga0395900_0004844 Ga0395900_0004844_6435_7007 188
113 3300037418 Ga0395900_0263078 Ga0395900_0263078_281_847 188
114 3300037466 Ga0395898_0081730 Ga0395898_0081730_1022_1594 188
115 3300037466 Ga0395898_0426203 Ga0395898_0426203_271_837 188
116 3300037471 Ga0395905_0004157 Ga0395905_0004157_1389_1955 188
117 3300037471 Ga0395905_0050580 Ga0395905_0050580_533_1105 188
118 3300038443 Ga0395901_0251617 Ga0395901_0251617_704_1276 188
119 3300049581 Ga0501047_0533573 Ga0501047_0533573_226_792 188
120 3300053091 Ga0500647_0023161 Ga0500647_0023161_982_1554 188
121 3300053136 Ga0500559_0000113 Ga0500559_0000113_48332_48904 188
122 3300053162 Ga0500638_294175 Ga0500638_294175_38_610 188
123 3300053177 Ga0500636_0044836 Ga0500636_0044836_1424_1996 188
124 3300003773 Ga0055537_1001243 Ga0055537_100124319 189
125 3300003775 Ga0055524_1018359 Ga0055524_10183594 189
126 3300003781 Ga0055536_1041318 Ga0055536_10413182 189
127 3300003781 Ga0055536_1042951 Ga0055536_10429512 189
128 3300003790 Ga0055528_1011497 Ga0055528_10114973 189
129 3300003791 Ga0055530_10012430 Ga0055530_100124302 189
130 3300003791 Ga0055530_10043136 Ga0055530_100431362 189
131 3300003794 Ga0055531_10004281 Ga0055531_100042816 189
132 3300003794 Ga0055531_10008562 Ga0055531_100085624 189
133 3300003794 Ga0055531_10019251 Ga0055531_100192514 189
134 3300005262 Ga0065165_1000506 Ga0065165_10005065 189
135 3300005262 Ga0065165_1001803 Ga0065165_10018036 189
136 3300005262 Ga0065165_1037942 Ga0065165_10379422 189
137 3300005335 Ga0070666_10033323 Ga0070666_100333232 189
138 3300005339 Ga0070660_100172670 Ga0070660_1001726702 189
139 3300005347 Ga0070668_100005674 Ga0070668_10000567411 189
140 3300005347 Ga0070668_100045743 Ga0070668_1000457434 189
141 3300005355 Ga0070671_100006755 Ga0070671_1000067553 189
142 3300005355 Ga0070671_100039967 Ga0070671_1000399672 189
143 3300005366 Ga0070659_100026036 Ga0070659_1000260362 189
144 3300005367 Ga0070667_100006266 Ga0070667_10000626613 189
145 3300005367 Ga0070667_100013914 Ga0070667_1000139148 189
146 3300005367 Ga0070667_100017440 Ga0070667_1000174405 189
147 3300005367 Ga0070667_100889347 Ga0070667_1008893471 189
148 3300005457 Ga0070662_100559064 Ga0070662_1005590642 189
149 3300005458 Ga0070681_10015119 Ga0070681_100151191 189
150 3300005530 Ga0070679_100036715 Ga0070679_1000367155 189
151 3300005539 Ga0068853_100126785 Ga0068853_1001267853 189
152 3300005548 Ga0070665_100000121 Ga0070665_100000121148 189
153 3300005548 Ga0070665_100006341 Ga0070665_10000634116 189
154 3300005548 Ga0070665_100033382 Ga0070665_1000333823 189
155 3300005548 Ga0070665_100048252 Ga0070665_1000482525 189
156 3300005548 Ga0070665_100257376 Ga0070665_1002573762 189
157 3300005563 Ga0068855_100085341 Ga0068855_1000853412 189
158 3300005563 Ga0068855_100620669 Ga0068855_1006206692 189
159 3300005563 Ga0068855_100647109 Ga0068855_1006471092 189
160 3300005563 Ga0068855_100860872 Ga0068855_1008608721 189
161 3300005577 Ga0068857_100196681 Ga0068857_1001966811 189
162 3300005614 Ga0068856_100127771 Ga0068856_1001277712 189
163 3300005617 Ga0068859_100001281 Ga0068859_10000128121 189
164 3300005617 Ga0068859_100056400 Ga0068859_1000564002 189
165 3300005618 Ga0068864_100000263 Ga0068864_10000026345 189
166 3300005618 Ga0068864_100047770 Ga0068864_1000477703 189
167 3300005618 Ga0068864_100576791 Ga0068864_1005767912 189
168 3300005719 Ga0068861_100385776 Ga0068861_1003857762 189
169 3300005841 Ga0068863_100000694 Ga0068863_10000069416 189
170 3300005841 Ga0068863_100004023 Ga0068863_10000402317 189
171 3300005841 Ga0068863_100066653 Ga0068863_1000666532 189
172 3300005841 Ga0068863_100267964 Ga0068863_1002679642 189
173 3300005842 Ga0068858_100000270 Ga0068858_10000027048 189
174 3300005842 Ga0068858_100007271 Ga0068858_10000727117 189
175 3300005842 Ga0068858_100028881 Ga0068858_1000288813 189
176 3300005843 Ga0068860_100001684 Ga0068860_10000168421 189
177 3300005843 Ga0068860_100010284 Ga0068860_10001028412 189
178 3300005844 Ga0068862_100007110 Ga0068862_1000071105 189
179 3300005844 Ga0068862_100105908 Ga0068862_1001059081 189
180 3300005844 Ga0068862_100111265 Ga0068862_1001112653 189
181 3300006042 Ga0075368_10192113 Ga0075368_101921132 189
182 3300006051 Ga0075364_10001038 Ga0075364_100010382 189
183 3300006177 Ga0075362_10047558 Ga0075362_100475581 189
184 3300006177 Ga0075362_10049211 Ga0075362_100492113 189
185 3300006177 Ga0075362_10314675 Ga0075362_103146751 189
186 3300006178 Ga0075367_10005954 Ga0075367_100059547 189
187 3300006186 Ga0075369_10006831 Ga0075369_100068313 189
188 3300006195 Ga0075366_10061263 Ga0075366_100612632 189
189 3300006195 Ga0075366_10167308 Ga0075366_101673082 189
190 3300006195 Ga0075366_10351649 Ga0075366_103516491 189
191 3300006353 Ga0075370_10112122 Ga0075370_101121222 189
192 3300006353 Ga0075370_10254806 Ga0075370_102548061 189
193 3300006353 Ga0075370_10332165 Ga0075370_103321651 189
194 3300006353 Ga0075370_10406156 Ga0075370_104061561 189
195 3300006881 Ga0068865_100065752 Ga0068865_1000657523 189
196 3300006931 Ga0097620_100001281 Ga0097620_10000128121 189
197 3300006931 Ga0097620_100056401 Ga0097620_1000564012 189
198 3300009011 Ga0105251_10105626 Ga0105251_101056262 189
199 3300009092 Ga0105250_10033094 Ga0105250_100330942 189
200 3300009093 Ga0105240_10000798 Ga0105240_1000079825 189
201 3300009093 Ga0105240_10024975 Ga0105240_100249756 189
202 3300009093 Ga0105240_10067893 Ga0105240_100678935 189
203 3300009093 Ga0105240_10116281 Ga0105240_101162812 189
204 3300009098 Ga0105245_10429531 Ga0105245_104295312 189
205 3300009101 Ga0105247_10084038 Ga0105247_100840383 189
206 3300009177 Ga0105248_10006540 Ga0105248_1000654012 189
207 3300009177 Ga0105248_10090304 Ga0105248_100903042 189
208 3300009177 Ga0105248_10106187 Ga0105248_101061873 189
209 3300009177 Ga0105248_10246345 Ga0105248_102463452 189
210 3300009177 Ga0105248_10521734 Ga0105248_105217342 189
211 3300009177 Ga0105248_10992774 Ga0105248_109927741 189
212 3300009551 Ga0105238_10011964 Ga0105238_100119648 189
213 3300009551 Ga0105238_10048857 Ga0105238_100488575 189
214 3300009551 Ga0105238_10348511 Ga0105238_103485112 189
215 3300009551 Ga0105238_10772830 Ga0105238_107728301 189
216 3300009551 Ga0105238_10970546 Ga0105238_109705462 189
217 3300009553 Ga0105249_10010200 Ga0105249_100102009 189
218 3300009553 Ga0105249_10122540 Ga0105249_101225402 189
219 3300010375 Ga0105239_10417733 Ga0105239_104177332 189
220 3300010375 Ga0105239_10731919 Ga0105239_107319192 189
221 3300010375 Ga0105239_11221154 Ga0105239_112211541 189
222 3300013100 Ga0157373_10106116 Ga0157373_101061162 189
223 3300013100 Ga0157373_10108516 Ga0157373_101085162 189
224 3300013296 Ga0157374_10158724 Ga0157374_101587242 189
225 3300013296 Ga0157374_11348988 Ga0157374_113489882 189
226 3300013306 Ga0163162_10362915 Ga0163162_103629152 189
227 3300013307 Ga0157372_11942397 Ga0157372_119423971 189
228 3300013308 Ga0157375_10152156 Ga0157375_101521563 189
229 3300014325 Ga0163163_10018256 Ga0163163_100182567 189
230 3300014325 Ga0163163_10044151 Ga0163163_100441514 189
231 3300014325 Ga0163163_10128008 Ga0163163_101280083 189
232 3300014325 Ga0163163_10928626 Ga0163163_109286262 189
233 3300014326 Ga0157380_10152211 Ga0157380_101522112 189
234 3300014968 Ga0157379_10009879 Ga0157379_100098799 189
235 3300014968 Ga0157379_10009954 Ga0157379_100099544 189
236 3300014968 Ga0157379_10091647 Ga0157379_100916472 189
237 3300014968 Ga0157379_11568247 Ga0157379_115682471 189
238 3300017792 Ga0163161_10382901 Ga0163161_103829012 189
239 3300021361 Ga0213872_10252414 Ga0213872_102524141 189
240 3300021377 Ga0213874_10035067 Ga0213874_100350672 189
241 3300021384 Ga0213876_10000244 Ga0213876_100002446 189
242 3300021384 Ga0213876_10082372 Ga0213876_100823722 189
243 3300025254 Ga0209148_1030272 Ga0209148_10302722 189
244 3300025263 Ga0209565_1000925 Ga0209565_100092521 189
245 3300025273 Ga0209673_1002524 Ga0209673_10025248 189
246 3300025273 Ga0209673_1048428 Ga0209673_10484282 189
247 3300025291 Ga0209675_1002569 Ga0209675_10025695 189
248 3300025292 Ga0209676_1005649 Ga0209676_100564911 189
249 3300025292 Ga0209676_1005783 Ga0209676_100578311 189
250 3300025295 Ga0209564_1024927 Ga0209564_10249271 189
251 3300025295 Ga0209564_1052431 Ga0209564_10524311 189
252 3300025295 Ga0209564_1065116 Ga0209564_10651161 189
253 3300025297 Ga0209758_1002168 Ga0209758_100216826 189
254 3300025297 Ga0209758_1023258 Ga0209758_10232581 189
255 3300025297 Ga0209758_1033931 Ga0209758_10339312 189
256 3300025298 Ga0209050_1000161 Ga0209050_1000161108 189
257 3300025298 Ga0209050_1009513 Ga0209050_10095134 189
258 3300025298 Ga0209050_1013483 Ga0209050_10134831 189
259 3300025298 Ga0209050_1037358 Ga0209050_10373582 189
260 3300025299 Ga0209256_1009609 Ga0209256_10096095 189
261 3300025299 Ga0209256_1010029 Ga0209256_10100293 189
262 3300025299 Ga0209256_1014151 Ga0209256_10141513 189
263 3300025303 Ga0209051_1000877 Ga0209051_10008774 189
264 3300025304 Ga0209257_1000252 Ga0209257_100025268 189
265 3300025304 Ga0209257_1000976 Ga0209257_100097630 189
266 3300025304 Ga0209257_1001464 Ga0209257_100146429 189
267 3300025315 Ga0207697_10153609 Ga0207697_101536092 189
268 3300025900 Ga0207710_10047340 Ga0207710_100473403 189
269 3300025903 Ga0207680_10061087 Ga0207680_100610872 189
270 3300025909 Ga0207705_10004936 Ga0207705_100049366 189
271 3300025909 Ga0207705_10471179 Ga0207705_104711792 189
272 3300025912 Ga0207707_10123641 Ga0207707_101236411 189
273 3300025913 Ga0207695_10005806 Ga0207695_1000580615 189
274 3300025913 Ga0207695_10035813 Ga0207695_100358135 189
275 3300025913 Ga0207695_10051068 Ga0207695_100510684 189
276 3300025913 Ga0207695_11132025 Ga0207695_111320251 189
277 3300025914 Ga0207671_10237842 Ga0207671_102378422 189
278 3300025917 Ga0207660_10000537 Ga0207660_1000053727 189
279 3300025919 Ga0207657_10025002 Ga0207657_100250022 189
280 3300025919 Ga0207657_10095108 Ga0207657_100951082 189
281 3300025919 Ga0207657_10124486 Ga0207657_101244861 189
282 3300025921 Ga0207652_10002134 Ga0207652_100021344 189
283 3300025923 Ga0207681_10208266 Ga0207681_102082662 189
284 3300025924 Ga0207694_10013350 Ga0207694_100133507 189
285 3300025924 Ga0207694_10072687 Ga0207694_100726872 189
286 3300025924 Ga0207694_10096124 Ga0207694_100961243 189
287 3300025925 Ga0207650_10000883 Ga0207650_1000088314 189
288 3300025925 Ga0207650_10350933 Ga0207650_103509332 189
289 3300025927 Ga0207687_10558591 Ga0207687_105585912 189
290 3300025931 Ga0207644_10085476 Ga0207644_100854763 189
291 3300025931 Ga0207644_10129068 Ga0207644_101290682 189
292 3300025932 Ga0207690_10008954 Ga0207690_100089548 189
293 3300025932 Ga0207690_10016460 Ga0207690_100164602 189
294 3300025938 Ga0207704_10057117 Ga0207704_100571173 189
295 3300025941 Ga0207711_10011223 Ga0207711_100112234 189
296 3300025941 Ga0207711_10021858 Ga0207711_100218587 189
297 3300025941 Ga0207711_10033019 Ga0207711_100330195 189
298 3300025941 Ga0207711_10066025 Ga0207711_100660253 189
299 3300025941 Ga0207711_10340537 Ga0207711_103405372 189
300 3300025941 Ga0207711_10567749 Ga0207711_105677492 189
301 3300025942 Ga0207689_10165591 Ga0207689_101655912 189
302 3300025949 Ga0207667_10015066 Ga0207667_1001506617 189
303 3300025949 Ga0207667_10340455 Ga0207667_103404552 189
304 3300025960 Ga0207651_10156314 Ga0207651_101563142 189
305 3300025961 Ga0207712_10000998 Ga0207712_100009982 189
306 3300025961 Ga0207712_10100769 Ga0207712_101007693 189
307 3300025961 Ga0207712_10123570 Ga0207712_101235702 189
308 3300025972 Ga0207668_10000363 Ga0207668_1000036311 189
309 3300025972 Ga0207668_10000571 Ga0207668_1000057124 189
310 3300025972 Ga0207668_10018567 Ga0207668_100185672 189
311 3300025986 Ga0207658_10001253 Ga0207658_1000125312 189
312 3300025986 Ga0207658_10015649 Ga0207658_100156495 189
313 3300025986 Ga0207658_10033313 Ga0207658_100333134 189
314 3300025986 Ga0207658_10177740 Ga0207658_101777402 189
315 3300026035 Ga0207703_10000133 Ga0207703_1000013380 189
316 3300026035 Ga0207703_10003217 Ga0207703_100032175 189
317 3300026035 Ga0207703_10019152 Ga0207703_100191527 189
318 3300026035 Ga0207703_10532415 Ga0207703_105324152 189
319 3300026067 Ga0207678_10115733 Ga0207678_101157332 189
320 3300026088 Ga0207641_10000168 Ga0207641_1000016876 189
321 3300026088 Ga0207641_10005884 Ga0207641_100058846 189
322 3300026088 Ga0207641_10007468 Ga0207641_100074688 189
323 3300026088 Ga0207641_10268475 Ga0207641_102684752 189
324 3300026095 Ga0207676_10000247 Ga0207676_1000024745 189
325 3300026095 Ga0207676_10005933 Ga0207676_100059332 189
326 3300026095 Ga0207676_10272170 Ga0207676_102721702 189
327 3300026095 Ga0207676_10332343 Ga0207676_103323432 189
328 3300026118 Ga0207675_100415594 Ga0207675_1004155942 189
329 3300026121 Ga0207683_10740073 Ga0207683_107400732 189
330 3300028379 Ga0268266_10000106 Ga0268266_1000010616 189
331 3300028379 Ga0268266_10001264 Ga0268266_1000126410 189
332 3300028379 Ga0268266_10018893 Ga0268266_100188935 189
333 3300028379 Ga0268266_10042635 Ga0268266_100426354 189
334 3300028379 Ga0268266_10082808 Ga0268266_100828084 189
335 3300028380 Ga0268265_10004922 Ga0268265_100049225 189
336 3300028380 Ga0268265_10043663 Ga0268265_100436632 189
337 3300028381 Ga0268264_10000383 Ga0268264_1000038323 189
338 3300028381 Ga0268264_10124404 Ga0268264_101244042 189
339 3300028577 Ga0265318_10062053 Ga0265318_100620532 189
340 3300028786 Ga0307517_10012557 Ga0307517_1001255710 189
341 3300028786 Ga0307517_10118324 Ga0307517_101183243 189
342 3300028786 Ga0307517_10226581 Ga0307517_102265812 189
343 3300028794 Ga0307515_10173473 Ga0307515_101734732 189
344 3300028800 Ga0265338_10280502 Ga0265338_102805021 189
345 3300031240 Ga0265320_10057316 Ga0265320_100573163 189
346 3300031251 Ga0265327_10005226 Ga0265327_1000522620 189
347 3300031456 Ga0307513_10000162 Ga0307513_1000016225 189
348 3300031456 Ga0307513_10002446 Ga0307513_1000244622 189
349 3300031456 Ga0307513_10009092 Ga0307513_100090922 189
350 3300031548 Ga0307408_100276229 Ga0307408_1002762292 189
351 3300031711 Ga0265314_10160976 Ga0265314_101609762 189
352 3300031712 Ga0265342_10226644 Ga0265342_102266442 189
353 3300031824 Ga0307413_10105886 Ga0307413_101058862 189
354 3300031824 Ga0307413_10466008 Ga0307413_104660081 189
355 3300031911 Ga0307412_10374705 Ga0307412_103747052 189
356 3300032004 Ga0307414_10018511 Ga0307414_100185112 189
357 3300032004 Ga0307414_10607419 Ga0307414_106074192 189
358 3300033180 Ga0307510_10028447 Ga0307510_100284478 189
359 3300035171 Ga0373946_0011042 Ga0373946_0011042_161_733 189
360 3300035692 Ga0373935_0515643 Ga0373935_0515643_145_717 189
361 3300035695 Ga0373927_0000479 Ga0373927_0000479_18985_19557 189
362 3300037068 Ga0373925_0000023 Ga0373925_0000023_5080_5652 189
363 3300037068 Ga0373925_0277644 Ga0373925_0277644_155_727 189
364 3300037312 Ga0395899_0000105 Ga0395899_0000105_132424_132996 189
365 3300037312 Ga0395899_0141621 Ga0395899_0141621_311_883 189
366 3300037418 Ga0395900_0103443 Ga0395900_0103443_2165_2734 189
367 3300037418 Ga0395900_0236305 Ga0395900_0236305_602_1174 189
368 3300037466 Ga0395898_0191073 Ga0395898_0191073_531_1100 189
369 3300037466 Ga0395898_0204351 Ga0395898_0204351_972_1544 189
370 3300037466 Ga0395898_0464708 Ga0395898_0464708_24_596 189
371 3300037466 Ga0395898_0952116 Ga0395898_0952116_169_741 189
372 3300037471 Ga0395905_0071485 Ga0395905_0071485_2342_2914 189
373 3300037471 Ga0395905_0466801 Ga0395905_0466801_259_834 189
374 3300037471 Ga0395905_0730104 Ga0395905_0730104_219_791 189
375 3300037471 Ga0395905_0928586 Ga0395905_0928586_35_604 189
376 3300037471 Ga0395905_1101583 Ga0395905_1101583_14_583 189
377 3300037853 Ga0436364_0207421 Ga0436364_0207421_1347_1928 189
378 3300038443 Ga0395901_0048250 Ga0395901_0048250_2127_2696 189
379 3300038443 Ga0395901_0200384 Ga0395901_0200384_1250_1822 189
380 3300039437 Ga0436365_0376847 Ga0436365_0376847_18543_19115 189
381 3300039447 Ga0436361_0278754 Ga0436361_0278754_158_730 189
382 3300039450 Ga0436363_0782763 Ga0436363_0782763_531_1103 189
383 3300041413 Ga0439465_0075665 Ga0439465_0075665_384_953 189
384 3300041505 Ga0451849_0750964 Ga0451849_0750964_352_921 189
385 3300042001 Ga0439441_010814 Ga0439441_010814_676_1245 189
386 3300042156 Ga0439446_0018383 Ga0439446_0018383_642_1211 189
387 3300044656 Ga0466969_0067732 Ga0466969_0067732_700_1272 189
388 3300045049 Ga0466959_0111158 Ga0466959_0111158_1211_1783 189
389 3300046453 Ga0495627_000399 Ga0495627_000399_13414_13983 189
390 3300046457 Ga0495590_0003932 Ga0495590_0003932_564_1133 189
391 3300046460 Ga0495638_0029467 Ga0495638_0029467_2728_3297 189
392 3300046460 Ga0495638_0033790 Ga0495638_0033790_2457_3026 189
393 3300046460 Ga0495638_0060245 Ga0495638_0060245_1404_2081 189
394 3300046460 Ga0495638_0111514 Ga0495638_0111514_155_724 189
395 3300046460 Ga0495638_0138693 Ga0495638_0138693_150_719 189
396 3300046471 Ga0495650_0000269 Ga0495650_0000269_4228_4797 189
397 3300046471 Ga0495650_0133542 Ga0495650_0133542_217_786 189
398 3300046506 Ga0495583_0000650 Ga0495583_0000650_22381_22950 189
399 3300046506 Ga0495583_0019160 Ga0495583_0019160_493_1065 189
400 3300046507 Ga0495606_0005780 Ga0495606_0005780_7924_8493 189
401 3300046507 Ga0495606_0149726 Ga0495606_0149726_44_616 189
402 3300046512 Ga0495610_0000225 Ga0495610_0000225_59363_59932 189
403 3300046512 Ga0495610_0022193 Ga0495610_0022193_119_688 189
404 3300046512 Ga0495610_0042727 Ga0495610_0042727_1008_1577 189
405 3300046513 Ga0495616_0025486 Ga0495616_0025486_1704_2273 189
406 3300046513 Ga0495616_0138684 Ga0495616_0138684_464_1033 189
407 3300046515 Ga0495620_0070846 Ga0495620_0070846_85_654 189
408 3300046516 Ga0495628_0265188 Ga0495628_0265188_244_813 189
409 3300046518 Ga0495631_0004192 Ga0495631_0004192_2202_2771 189
410 3300046519 Ga0495632_0104743 Ga0495632_0104743_675_1244 189
411 3300046520 Ga0495637_0008865 Ga0495637_0008865_2982_3551 189
412 3300046520 Ga0495637_0026004 Ga0495637_0026004_1249_1818 189
413 3300046520 Ga0495637_0125503 Ga0495637_0125503_45_614 189
414 3300046520 Ga0495637_0182290 Ga0495637_0182290_102_671 189
415 3300046522 Ga0495643_0038603 Ga0495643_0038603_310_882 189
416 3300046524 Ga0495648_0014211 Ga0495648_0014211_240_809 189
417 3300046524 Ga0495648_0074622 Ga0495648_0074622_171_740 189
418 3300046528 Ga0495642_0033215 Ga0495642_0033215_1209_1781 189
419 3300046528 Ga0495642_0123335 Ga0495642_0123335_252_824 189
420 3300046530 Ga0495654_0000123 Ga0495654_0000123_3887_4456 189
421 3300046530 Ga0495654_0061031 Ga0495654_0061031_259_831 189
422 3300046538 Ga0495609_0029409 Ga0495609_0029409_1661_2233 189
423 3300046542 Ga0495597_0001666 Ga0495597_0001666_6196_6768 189
424 3300046542 Ga0495597_0039203 Ga0495597_0039203_102_671 189
425 3300046557 Ga0495622_0054775 Ga0495622_0054775_211_783 189
426 3300046616 Ga0495668_0001504 Ga0495668_0001504_7665_8234 189
427 3300046616 Ga0495668_0010366 Ga0495668_0010366_4320_4889 189
428 3300046616 Ga0495668_0010401 Ga0495668_0010401_931_1500 189
429 3300046616 Ga0495668_0068933 Ga0495668_0068933_613_1185 189
430 3300046616 Ga0495668_0151846 Ga0495668_0151846_451_1023 189
431 3300046648 Ga0495611_0065080 Ga0495611_0065080_254_826 189
432 3300046660 Ga0495625_0001925 Ga0495625_0001925_765_1334 189
433 3300046660 Ga0495625_0024878 Ga0495625_0024878_1597_2268 189
434 3300046660 Ga0495625_0051073 Ga0495625_0051073_189_761 189
435 3300046660 Ga0495625_0068124 Ga0495625_0068124_1381_1950 189
436 3300046660 Ga0495625_0189563 Ga0495625_0189563_530_1099 189
437 3300046660 Ga0495625_0275001 Ga0495625_0275001_471_1040 189
438 3300046660 Ga0495625_0296831 Ga0495625_0296831_126_695 189
439 3300046684 Ga0495669_0000044 Ga0495669_0000044_72736_73308 189
440 3300046684 Ga0495669_0036788 Ga0495669_0036788_472_1044 189
441 3300046684 Ga0495669_0042439 Ga0495669_0042439_856_1428 189
442 3300046691 Ga0495670_0123843 Ga0495670_0123843_100_669 189
443 3300046692 Ga0495671_0093898 Ga0495671_0093898_653_1222 189
444 3300046810 Ga0495660_0063433 Ga0495660_0063433_148_717 189
445 3300047319 Ga0495674_0231731 Ga0495674_0231731_359_928 189
446 3300047320 Ga0495672_0000439 Ga0495672_0000439_34669_35238 189
447 3300047443 Ga0495687_071476 Ga0495687_071476_806_1378 189
448 3300047445 Ga0495677_0043988 Ga0495677_0043988_155_727 189
449 3300047469 Ga0495673_0000189 Ga0495673_0000189_88241_88810 189
450 3300047469 Ga0495673_0006882 Ga0495673_0006882_1112_1681 189
451 3300047469 Ga0495673_0053806 Ga0495673_0053806_148_717 189
452 3300047470 Ga0495681_0152280 Ga0495681_0152280_267_836 189
453 3300047472 Ga0495686_0015147 Ga0495686_0015147_4115_4684 189
454 3300047472 Ga0495686_0114998 Ga0495686_0114998_843_1412 189
455 3300047472 Ga0495686_0222995 Ga0495686_0222995_176_745 189
456 3300047673 Ga0495593_0008408 Ga0495593_0008408_4493_5065 189
457 3300048903 Ga0496100_0464933 Ga0496100_0464933_228_800 189
458 3300048904 Ga0496101_0224762 Ga0496101_0224762_11_583 189
459 3300048905 Ga0496102_0089384 Ga0496102_0089384_230_802 189
460 3300048906 Ga0496103_0378481 Ga0496103_0378481_291_863 189
461 3300048907 Ga0496104_0562732 Ga0496104_0562732_11_583 189
462 3300048909 Ga0496106_0691747 Ga0496106_0691747_83_655 189
463 3300048909 Ga0496106_0733398 Ga0496106_0733398_33_605 189
464 3300048910 Ga0496107_0000073 Ga0496107_0000073_37653_38222 189
465 3300048910 Ga0496107_0385901 Ga0496107_0385901_346_918 189
466 3300048912 Ga0496109_0147307 Ga0496109_0147307_1420_1992 189
467 3300048915 Ga0496112_0060193 Ga0496112_0060193_1005_1577 189
468 3300048915 Ga0496112_0526731 Ga0496112_0526731_403_975 189
469 3300048918 Ga0496115_0001049 Ga0496115_0001049_2004_2576 189
470 3300048918 Ga0496115_0003309 Ga0496115_0003309_6360_6932 189
471 3300048918 Ga0496115_0034445 Ga0496115_0034445_3216_3785 189
472 3300048918 Ga0496115_0151099 Ga0496115_0151099_613_1188 189
473 3300048918 Ga0496115_0302127 Ga0496115_0302127_101_673 189
474 3300048920 Ga0496117_0010638 Ga0496117_0010638_2426_2998 189
475 3300048921 Ga0496118_0018740 Ga0496118_0018740_4789_5361 189
476 3300048922 Ga0496119_0023232 Ga0496119_0023232_858_1430 189
477 3300048924 Ga0496121_0000946 Ga0496121_0000946_20414_20986 189
478 3300048924 Ga0496121_0023808 Ga0496121_0023808_243_812 189
479 3300048925 Ga0496122_0247556 Ga0496122_0247556_49_618 189
480 3300048927 Ga0496124_0022787 Ga0496124_0022787_5018_5587 189
481 3300048927 Ga0496124_0682174 Ga0496124_0682174_25_597 189
482 3300048928 Ga0496125_0037701 Ga0496125_0037701_1639_2208 189
483 3300048929 Ga0496126_0035984 Ga0496126_0035984_1549_2118 189
484 3300049459 Ga0495678_005745 Ga0495678_005745_6150_6719 189
485 3300049460 Ga0495682_0070402 Ga0495682_0070402_304_876 189
486 3300049571 Ga0501034_0258674 Ga0501034_0258674_414_986 189
487 3300049571 Ga0501034_0281204 Ga0501034_0281204_347_925 189
488 3300049571 Ga0501034_0593323 Ga0501034_0593323_252_821 189
489 3300049573 Ga0501037_0574844 Ga0501037_0574844_172_744 189
490 3300049579 Ga0501043_0279923 Ga0501043_0279923_148_720 189
491 3300049579 Ga0501043_0396106 Ga0501043_0396106_458_1027 189
492 3300049581 Ga0501047_0020305 Ga0501047_0020305_2457_3029 189
493 3300049581 Ga0501047_0125576 Ga0501047_0125576_1814_2383 189
494 3300049581 Ga0501047_0179783 Ga0501047_0179783_903_1475 189
495 3300049581 Ga0501047_0735517 Ga0501047_0735517_37_609 189
496 3300049671 Ga0501238_001704 Ga0501238_001704_1456_2025 189
497 3300049822 Ga0501035_0184904 Ga0501035_0184904_530_1102 189
498 3300049823 Ga0501044_0004107 Ga0501044_0004107_11851_12420 189
499 3300049823 Ga0501044_0050685 Ga0501044_0050685_3385_3954 189
500 3300049823 Ga0501044_0515535 Ga0501044_0515535_148_717 189
501 3300050489 nmdc:mga03683_30587_c1 nmdc:mga03683_30587_c1_324_893 189
502 3300050490 nmdc:mga03n38_209390_c1 nmdc:mga03n38_209390_c1_256_834 189
503 3300050491 nmdc:mga00v17_992_c1 nmdc:mga00v17_992_c1_3788_4360 189
504 3300050492 nmdc:mga0yw44_138177_c1 nmdc:mga0yw44_138177_c1_366_944 189
505 3300050493 nmdc:mga0k408_145439_c1 nmdc:mga0k408_145439_c1_696_1268 189
506 3300050493 nmdc:mga0k408_223668_c1 nmdc:mga0k408_223668_c1_380_949 189
507 3300050493 nmdc:mga0k408_3470_c1 nmdc:mga0k408_3470_c1_5122_5691 189
508 3300050494 nmdc:mga06z11_38086_c1 nmdc:mga06z11_38086_c1_620_1192 189
509 3300050495 nmdc:mga04h51_89032_c1 nmdc:mga04h51_89032_c1_147_719 189
510 3300050496 nmdc:mga07m45_108841_c1 nmdc:mga07m45_108841_c1_383_952 189
511 3300050496 nmdc:mga07m45_22251_c1 nmdc:mga07m45_22251_c1_2645_3217 189
512 3300050496 nmdc:mga07m45_39413_c1 nmdc:mga07m45_39413_c1_670_1239 189
513 3300050516 nmdc:mga0sz30_128998_c1 nmdc:mga0sz30_128998_c1_502_1071 189
514 3300050516 nmdc:mga0sz30_13472_c1 nmdc:mga0sz30_13472_c1_2388_2960 189
515 3300053080 Ga0500635_0000205 Ga0500635_0000205_15923_16495 189
516 3300053086 Ga0500578_0000459 Ga0500578_0000459_25435_26004 189
517 3300053086 Ga0500578_0138581 Ga0500578_0138581_425_997 189
518 3300053086 Ga0500578_0220246 Ga0500578_0220246_350_919 189
519 3300053087 Ga0500643_001398 Ga0500643_001398_8588_9172 189
520 3300053087 Ga0500643_002694 Ga0500643_002694_4251_4829 189
521 3300053087 Ga0500643_007387 Ga0500643_007387_2874_3446 189
522 3300053087 Ga0500643_036788 Ga0500643_036788_578_1147 189
523 3300053088 Ga0500644_0000193 Ga0500644_0000193_23395_23964 189
524 3300053090 Ga0500646_0095781 Ga0500646_0095781_175_744 189
525 3300053091 Ga0500647_0147864 Ga0500647_0147864_92_664 189
526 3300053092 Ga0500583_0029440 Ga0500583_0029440_390_962 189
527 3300053093 Ga0500651_0061927 Ga0500651_0061927_336_908 189
528 3300053094 Ga0500566_0018488 Ga0500566_0018488_3319_3891 189
529 3300053094 Ga0500566_0174425 Ga0500566_0174425_489_1061 189
530 3300053096 Ga0500641_0000731 Ga0500641_0000731_4033_4617 189
531 3300053096 Ga0500641_0038698 Ga0500641_0038698_397_966 189
532 3300053103 Ga0500555_000830 Ga0500555_000830_6070_6642 189
533 3300053104 Ga0500556_0001077 Ga0500556_0001077_5015_5584 189
534 3300053108 Ga0500562_002626 Ga0500562_002626_1924_2493 189
535 3300053108 Ga0500562_018272 Ga0500562_018272_713_1300 189
536 3300053108 Ga0500562_037042 Ga0500562_037042_193_762 189
537 3300053109 Ga0500569_000209 Ga0500569_000209_6881_7453 189
538 3300053111 Ga0500572_044848 Ga0500572_044848_444_1016 189
539 3300053118 Ga0500594_0003661 Ga0500594_0003661_2430_2999 189
540 3300053119 Ga0500595_003695 Ga0500595_003695_1284_1856 189
541 3300053121 Ga0500607_031666 Ga0500607_031666_903_1475 189
542 3300053122 Ga0500608_001997 Ga0500608_001997_5371_5943 189
543 3300053123 Ga0500614_002054 Ga0500614_002054_1112_1684 189
544 3300053125 Ga0500618_000395 Ga0500618_000395_3467_4036 189
545 3300053130 Ga0500642_0185585 Ga0500642_0185585_52_624 189
546 3300053133 Ga0500655_041988 Ga0500655_041988_132_701 189
547 3300053134 Ga0500658_0000930 Ga0500658_0000930_4177_4746 189
548 3300053136 Ga0500559_0001398 Ga0500559_0001398_11379_11948 189
549 3300053136 Ga0500559_0040062 Ga0500559_0040062_506_1081 189
550 3300053136 Ga0500559_0135916 Ga0500559_0135916_467_1036 189
551 3300053138 Ga0500564_004939 Ga0500564_004939_1961_2530 189
552 3300053140 Ga0500573_0097621 Ga0500573_0097621_809_1381 189
553 3300053142 Ga0500577_0233309 Ga0500577_0233309_126_698 189
554 3300053148 Ga0500590_027355 Ga0500590_027355_591_1163 189
555 3300053150 Ga0500603_007841 Ga0500603_007841_172_744 189
556 3300053154 Ga0500619_011768 Ga0500619_011768_1029_1601 189
557 3300053156 Ga0500622_0003777 Ga0500622_0003777_916_1503 189
558 3300053156 Ga0500622_0119841 Ga0500622_0119841_676_1245 189
559 3300053156 Ga0500622_0173573 Ga0500622_0173573_319_888 189
560 3300053163 Ga0500639_263981 Ga0500639_263981_81_653 189
561 3300053177 Ga0500636_0011953 Ga0500636_0011953_643_1215 189
562 3300053177 Ga0500636_0151117 Ga0500636_0151117_138_710 189
563 3300053178 Ga0500637_0011054 Ga0500637_0011054_2655_3227 189
564 3300053178 Ga0500637_0022917 Ga0500637_0022917_2773_3345 189
565 3300053725 Ga0500576_098563 Ga0500576_098563_82_654 189
566 3300053727 Ga0500611_002965 Ga0500611_002965_460_1029 189
567 3300053729 Ga0500625_033878 Ga0500625_033878_211_783 189
568 3300053730 Ga0500645_033117 Ga0500645_033117_342_911 189
569 3300053730 Ga0500645_041961 Ga0500645_041961_463_1050 189
570 3300053730 Ga0500645_054586 Ga0500645_054586_436_1008 189
571 3300053733 Ga0500552_015017 Ga0500552_015017_200_772 189
572 3300053735 Ga0500596_002676 Ga0500596_002676_607_1179 189
573 3300055283 Ga0500661_031656 Ga0500661_031656_61_630 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

5

155

0.99

PF13207

AAA_17

AAA domain

6

133

0.88

PF13671

AAA_33

AAA domain

3

148

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3adk-assembly1.cif.gz_A refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution 0.9021 2 189
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.8967 1 188
1dvr-assembly1.cif.gz_B structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp 0.8961 1 185
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.8936 1 188
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.8877 1 188
ID Description Score Start End Superfamily
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.941 2 125 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8914 1 188 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8824 1 188 3.40.50.300
af_A5PMF1_372_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8739 3 186 3.40.50.300
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8729 3 186 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A257JJB3-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9676 1 186 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A7S3TAL3-F1-model_v4 Adenylate kinase 0.9587 2 127 GO:0005524
GO:0006139
GO:0019205
AF-A0A7X8ZT69-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9553 1 123 GO:0005524
GO:0005737
GO:0050145
AF-A0A7Z9L6Z8-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9537 1 186 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A257JJB3-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9526 1 186 GO:0004017
GO:0005524
GO:0005737
GO:0044209

Feature Viewer

pLDDT pTM Quality
91.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map