F465246

General Info

Members Datasets Scaffolds Average Seq Length
573 357 572 96

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0107661|Ga0501069_0107661_1063_1395
Length 110
Sequence MSESRKQYDYAFKAGAVRIVLETGQTVAQVARELDVNERTLAGWVQAAREGPEVGPDSGGRLLSRGKHGGGRELSKDAEIRRLRAEVEELRMERDVLKRSVVLWVKEATK

Samples

Sample ID Description Type Environment
1 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
115 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
116 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
243 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
244 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
255 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
256 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
257 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
267 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
268 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
269 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
270 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
271 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
272 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
273 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
274 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
287 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
352 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1.57
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.24
Nodule 0
Rhizoplane 5.41
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1011574 3300000531 Bacteria 544
2 LJQas_1001486 3300000549 Bacteria 3494
3 JGI24736J21556_1014596 3300001904 Bacteria 1264
4 JGI24741J21665_1014894 3300001915 Bacteria 1291
5 JGI24741J21665_1015450 3300001915 Bacteria 1260
6 JGI24752J21851_1009146 3300001976 Bacteria 1292
7 JGI24740J21852_10042187 3300001979 Bacteria 1369
8 JGI24740J21852_10174428 3300001979 Bacteria 533
9 JGI24739J22299_10058528 3300001989 Bacteria 1223
10 JGI24735J21928_10183692 3300002067 Bacteria 605
11 JGI24738J21930_10014229 3300002075 Bacteria 1709
12 JGI24749J21850_1013375 3300002076 Bacteria 1152
13 JGI24744J21845_10004331 3300002077 Bacteria 2929
14 JGI24744J21845_10090658 3300002077 Bacteria 561
15 JGI24033J26618_1007147 3300002155 Bacteria 1264
16 JGI24034J26672_10007726 3300002239 Bacteria 1565
17 JGI24751J29686_10024078 3300002459 Bacteria 1262
18 JGI24751J29686_10094652 3300002459 Bacteria 622
19 rootH1_10053897 3300003323 Unclassified 1474
20 rootH1_10252916 3300003323 Bacteria 2005
21 Ga0065712_10031799 3300005290 Bacteria 893
22 Ga0070658_10333962 3300005327 Bacteria 1296
23 Ga0070658_10620771 3300005327 Bacteria 937
24 Ga0070683_100395030 3300005329 Bacteria 1319
25 Ga0070683_100411502 3300005329 Bacteria 1290
26 Ga0070690_100965611 3300005330 Bacteria 670
27 Ga0070670_101945290 3300005331 Bacteria 542
28 Ga0070677_10415026 3300005333 Bacteria 712
29 Ga0068869_100105382 3300005334 Bacteria 2138
30 Ga0068869_100298511 3300005334 Bacteria 1300
31 Ga0068869_100538371 3300005334 Bacteria 979
32 Ga0070680_100253346 3300005336 Bacteria 1488
33 Ga0070680_100259674 3300005336 Bacteria 1469
34 Ga0070682_100229574 3300005337 Bacteria 1326
35 Ga0070682_100441202 3300005337 Bacteria 995
36 Ga0070682_100854148 3300005337 Bacteria 744
37 Ga0070682_101955858 3300005337 Bacteria 515
38 Ga0068868_100260641 3300005338 Bacteria 1462
39 Ga0068868_102237611 3300005338 Bacteria 521
40 Ga0070660_101336127 3300005339 Bacteria 608
41 Ga0070689_101114961 3300005340 Bacteria 706
42 Ga0070691_10508364 3300005341 Bacteria 697
43 Ga0070661_101098424 3300005344 Bacteria 663
44 Ga0070661_101733463 3300005344 Bacteria 529
45 Ga0070668_100220973 3300005347 Bacteria 1562
46 Ga0070671_101581393 3300005355 Bacteria 581
47 Ga0070674_100139031 3300005356 Bacteria 1820
48 Ga0070673_100618149 3300005364 Bacteria 989
49 Ga0070688_100124208 3300005365 Bacteria 1733
50 Ga0070659_100353607 3300005366 Bacteria 1233
51 Ga0070659_101487605 3300005366 Bacteria 603
52 Ga0070667_100157980 3300005367 Bacteria 1995
53 Ga0070667_100494532 3300005367 Bacteria 1121
54 Ga0070703_10407137 3300005406 Bacteria 593
55 Ga0070709_10032131 3300005434 Bacteria 3163
56 Ga0070709_10323464 3300005434 Bacteria 1132
57 Ga0070714_100344906 3300005435 Bacteria 1397
58 Ga0070713_100736471 3300005436 Bacteria 942
59 Ga0070713_101628720 3300005436 Unclassified 626
60 Ga0070710_10131788 3300005437 Bacteria 1525
61 Ga0070710_10202979 3300005437 Bacteria 1253
62 Ga0070701_10051684 3300005438 Bacteria 2132
63 Ga0070711_100091075 3300005439 Bacteria 2197
64 Ga0070711_100138873 3300005439 Bacteria 1819
65 Ga0070711_100140716 3300005439 Bacteria 1809
66 Ga0070711_100233973 3300005439 Bacteria 1434
67 Ga0070705_100830986 3300005440 Bacteria 737
68 Ga0070700_100512744 3300005441 Bacteria 925
69 Ga0070694_101047112 3300005444 Bacteria 679
70 Ga0070708_100251683 3300005445 Bacteria 1660
71 Ga0070663_100156641 3300005455 Bacteria 1750
72 Ga0070678_100264314 3300005456 Bacteria 1448
73 Ga0070678_102034088 3300005456 Bacteria 544
74 Ga0070681_10217925 3300005458 Bacteria 1824
75 Ga0070685_10212452 3300005466 Bacteria 1263
76 Ga0070706_100936928 3300005467 Bacteria 799
77 Ga0070707_100781035 3300005468 Bacteria 919
78 Ga0070707_102185678 3300005468 Bacteria 521
79 Ga0070698_100357972 3300005471 Bacteria 1391
80 Ga0070698_100897934 3300005471 Bacteria 832
81 Ga0070698_101815416 3300005471 Bacteria 562
82 Ga0070699_100250318 3300005518 Bacteria 1583
83 Ga0070699_100391354 3300005518 Bacteria 1256
84 Ga0070679_100325143 3300005530 Bacteria 1487
85 Ga0070679_100679167 3300005530 Bacteria 972
86 Ga0070684_100177227 3300005535 Bacteria 1937
87 Ga0070684_101056549 3300005535 Bacteria 763
88 Ga0070684_101354972 3300005535 Bacteria 670
89 Ga0070697_100135953 3300005536 Bacteria 2064
90 Ga0070697_100255784 3300005536 Bacteria 1498
91 Ga0070697_100918061 3300005536 Bacteria 777
92 Ga0068853_100689144 3300005539 Bacteria 974
93 Ga0070672_101224727 3300005543 Bacteria 669
94 Ga0070672_101929395 3300005543 Bacteria 532
95 Ga0070672_102179744 3300005543 Bacteria 500
96 Ga0070696_100272272 3300005546 Bacteria 1288
97 Ga0070696_100645344 3300005546 Bacteria 858
98 Ga0070665_101676125 3300005548 Bacteria 643
99 Ga0070665_101840314 3300005548 Bacteria 612
100 Ga0070704_101109899 3300005549 Bacteria 719
101 Ga0068855_100479377 3300005563 Bacteria 1354
102 Ga0068855_101129371 3300005563 Bacteria 818
103 Ga0070664_100402418 3300005564 Bacteria 1252
104 Ga0068857_100397824 3300005577 Bacteria 1281
105 Ga0068857_100937161 3300005577 Bacteria 831
106 Ga0068856_100502880 3300005614 Bacteria 1233
107 Ga0068856_100891110 3300005614 Bacteria 908
108 Ga0070702_101215703 3300005615 Bacteria 608
109 Ga0068852_100206930 3300005616 Bacteria 1859
110 Ga0068852_100326940 3300005616 Bacteria 1491
111 Ga0068852_102761088 3300005616 Bacteria 510
112 Ga0068859_100841444 3300005617 Bacteria 1004
113 Ga0068859_102255135 3300005617 Bacteria 601
114 Ga0068851_10719631 3300005834 Bacteria 615
115 Ga0068870_11391173 3300005840 Bacteria 514
116 Ga0068863_102220838 3300005841 Bacteria 559
117 Ga0068860_102153739 3300005843 Bacteria 579
118 Ga0081455_10782811 3300005937 Bacteria 600
119 Ga0081539_10014068 3300005985 Bacteria 5955
120 Ga0070717_10471921 3300006028 Bacteria 1132
121 Ga0070717_11062494 3300006028 Bacteria 737
122 Ga0075365_10011120 3300006038 Bacteria 5280
123 Ga0075365_10159281 3300006038 Bacteria 1572
124 Ga0075365_10349796 3300006038 Bacteria 1042
125 Ga0075365_10992522 3300006038 Bacteria 592
126 Ga0075365_11031371 3300006038 Bacteria 579
127 Ga0075368_10088339 3300006042 Bacteria 1266
128 Ga0075363_100196243 3300006048 Bacteria 1152
129 Ga0075364_10353011 3300006051 Bacteria 1002
130 Ga0070715_10087964 3300006163 Bacteria 1423
131 Ga0070715_10756686 3300006163 Bacteria 586
132 Ga0070712_100185010 3300006175 Bacteria 1626
133 Ga0070712_100226901 3300006175 Bacteria 1481
134 Ga0070712_100262758 3300006175 Bacteria 1384
135 Ga0070712_101579374 3300006175 Bacteria 574
136 Ga0070712_101778353 3300006175 Bacteria 540
137 Ga0075362_10003608 3300006177 Bacteria 5443
138 Ga0075369_10170199 3300006186 Bacteria 1000
139 Ga0097621_101364032 3300006237 Bacteria 671
140 Ga0075370_10046227 3300006353 Bacteria 2463
141 Ga0068871_101217842 3300006358 Bacteria 706
142 Ga0075428_101260186 3300006844 Bacteria 778
143 Ga0075428_102453156 3300006844 Bacteria 535
144 Ga0075431_100461742 3300006847 Bacteria 1264
145 Ga0075434_102513383 3300006871 Bacteria 516
146 Ga0068865_100365800 3300006881 Bacteria 1172
147 Ga0068865_100842986 3300006881 Bacteria 794
148 Ga0068865_101564622 3300006881 Bacteria 592
149 Ga0097620_100841345 3300006931 Bacteria 1004
150 Ga0097620_102254798 3300006931 Bacteria 601
151 Ga0099795_10027278 3300007788 Bacteria 1931
152 Ga0105251_10060771 3300009011 Bacteria 1778
153 Ga0105244_10054841 3300009036 Bacteria 2021
154 Ga0105244_10402920 3300009036 Bacteria 629
155 Ga0105250_10044883 3300009092 Bacteria 1772
156 Ga0105240_11066111 3300009093 Bacteria 861
157 Ga0105240_11261216 3300009093 Bacteria 781
158 Ga0111539_10755061 3300009094 Bacteria 1132
159 Ga0105245_10536725 3300009098 Bacteria 1190
160 Ga0105245_11536163 3300009098 Bacteria 717
161 Ga0105245_12117638 3300009098 Bacteria 616
162 Ga0105247_10001194 3300009101 Bacteria 19309
163 Ga0105247_10090321 3300009101 Bacteria 1943
164 Ga0105247_10144205 3300009101 Bacteria 1563
165 Ga0105247_10953698 3300009101 Bacteria 666
166 Ga0105247_11320091 3300009101 Bacteria 580
167 Ga0105247_11375329 3300009101 Bacteria 570
168 Ga0114129_12583789 3300009147 Bacteria 606
169 Ga0105243_10040584 3300009148 Bacteria 3635
170 Ga0105243_10216123 3300009148 Bacteria 1691
171 Ga0105243_10515441 3300009148 Bacteria 1136
172 Ga0105241_11729418 3300009174 Bacteria 608
173 Ga0105241_12500541 3300009174 Bacteria 517
174 Ga0105242_10225814 3300009176 Bacteria 1676
175 Ga0105242_12004301 3300009176 Bacteria 621
176 Ga0105248_10410065 3300009177 Bacteria 1526
177 Ga0105248_10823755 3300009177 Bacteria 1047
178 Ga0105237_12059341 3300009545 Bacteria 580
179 Ga0105238_11295325 3300009551 Bacteria 754
180 Ga0105238_11318210 3300009551 Bacteria 748
181 Ga0105238_11900665 3300009551 Bacteria 628
182 Ga0105249_10291308 3300009553 Bacteria 1634
183 Ga0105249_11971766 3300009553 Bacteria 657
184 Ga0105249_12246313 3300009553 Bacteria 618
185 Ga0105249_12401354 3300009553 Bacteria 600
186 Ga0099796_10061715 3300010159 Bacteria 1330
187 Ga0105239_10334387 3300010375 Bacteria 1709
188 Ga0105239_10525534 3300010375 Bacteria 1346
189 Ga0105239_11750252 3300010375 Bacteria 720
190 Ga0105246_10644604 3300011119 Bacteria 921
191 Ga0105246_10938471 3300011119 Bacteria 779
192 Ga0157320_1041544 3300012481 Bacteria 500
193 Ga0157329_1015323 3300012491 Bacteria 661
194 Ga0157338_1068680 3300012515 Bacteria 548
195 Ga0157373_10145383 3300013100 Bacteria 1668
196 Ga0157371_10228013 3300013102 Bacteria 1338
197 Ga0157371_11139426 3300013102 Bacteria 599
198 Ga0157370_10289117 3300013104 Bacteria 1514
199 Ga0157370_11334386 3300013104 Bacteria 646
200 Ga0157369_10116917 3300013105 Bacteria 2831
201 Ga0157369_10731174 3300013105 Bacteria 1019
202 Ga0157369_11486388 3300013105 Bacteria 689
203 Ga0157378_10275727 3300013297 Bacteria 1619
204 Ga0157378_12158829 3300013297 Bacteria 608
205 Ga0163162_10124140 3300013306 Bacteria 2687
206 Ga0163162_12471429 3300013306 Bacteria 597
207 Ga0163162_12914471 3300013306 Bacteria 550
208 Ga0157372_11920749 3300013307 Bacteria 680
209 Ga0157375_11181100 3300013308 Bacteria 897
210 Ga0157375_11192929 3300013308 Bacteria 893
211 Ga0163163_10213060 3300014325 Bacteria 1981
212 Ga0163163_12977207 3300014325 Bacteria 528
213 Ga0157380_11075039 3300014326 Bacteria 842
214 Ga0157380_12276950 3300014326 Bacteria 606
215 Ga0157380_12959500 3300014326 Bacteria 541
216 Ga0157377_11772043 3300014745 Bacteria 500
217 Ga0157379_11486759 3300014968 Bacteria 659
218 Ga0157379_12185832 3300014968 Bacteria 549
219 Ga0157376_11599279 3300014969 Bacteria 686
220 Ga0157376_12352288 3300014969 Bacteria 572
221 Ga0163161_10220237 3300017792 Bacteria 1469
222 Ga0163161_10640764 3300017792 Bacteria 880
223 Ga0163161_10750994 3300017792 Bacteria 816
224 Ga0206356_11099645 3300020070 Bacteria 1310
225 Ga0206351_10127246 3300020077 Bacteria 1459
226 Ga0206351_10824162 3300020077 Bacteria 970
227 Ga0206350_10662476 3300020080 Bacteria 2269
228 Ga0206353_11968452 3300020082 Bacteria 1142
229 Ga0154015_1150379 3300020610 Bacteria 2342
230 Ga0154015_1608420 3300020610 Bacteria 1822
231 Ga0154015_1700357 3300020610 Bacteria 1469
232 Ga0213872_10098707 3300021361 Bacteria 1303
233 Ga0213875_10074650 3300021388 Bacteria 1582
234 Ga0224712_10087822 3300022467 Bacteria 1296
235 Ga0207672_1007470 3300025223 Bacteria 638
236 Ga0207638_1000153 3300025227 Bacteria 1478
237 Ga0207697_10081555 3300025315 Bacteria 1363
238 Ga0207656_10332155 3300025321 Bacteria 756
239 Ga0207656_10556789 3300025321 Bacteria 584
240 Ga0207696_1088706 3300025711 Bacteria 849
241 Ga0207655_1220770 3300025728 Bacteria 553
242 Ga0207713_1072531 3300025735 Bacteria 1267
243 Ga0207653_10037231 3300025885 Bacteria 1586
244 Ga0207682_10054880 3300025893 Bacteria 1656
245 Ga0207692_10156620 3300025898 Bacteria 1309
246 Ga0207692_10160095 3300025898 Bacteria 1297
247 Ga0207642_10489724 3300025899 Bacteria 751
248 Ga0207710_10000174 3300025900 Bacteria 65752
249 Ga0207710_10112322 3300025900 Bacteria 1295
250 Ga0207710_10193742 3300025900 Bacteria 1001
251 Ga0207688_10082089 3300025901 Bacteria 1842
252 Ga0207688_10137274 3300025901 Bacteria 1437
253 Ga0207680_11011083 3300025903 Bacteria 595
254 Ga0207647_10066317 3300025904 Bacteria 2189
255 Ga0207647_10103936 3300025904 Bacteria 1684
256 Ga0207685_10223007 3300025905 Bacteria 898
257 Ga0207699_10294836 3300025906 Bacteria 1131
258 Ga0207645_10040226 3300025907 Bacteria 2994
259 Ga0207705_10236433 3300025909 Bacteria 1391
260 Ga0207671_10287947 3300025914 Bacteria 1297
261 Ga0207693_10100059 3300025915 Bacteria 2273
262 Ga0207693_10173266 3300025915 Unclassified 1698
263 Ga0207693_10247518 3300025915 Bacteria 1399
264 Ga0207693_10254515 3300025915 Bacteria 1377
265 Ga0207693_10503343 3300025915 Bacteria 945
266 Ga0207663_10311884 3300025916 Bacteria 1179
267 Ga0207660_10737579 3300025917 Bacteria 804
268 Ga0207662_10071756 3300025918 Bacteria 2097
269 Ga0207657_10268813 3300025919 Bacteria 1356
270 Ga0207649_11217052 3300025920 Bacteria 595
271 Ga0207652_10346752 3300025921 Bacteria 1340
272 Ga0207652_10374969 3300025921 Bacteria 1284
273 Ga0207646_10137071 3300025922 Bacteria 2204
274 Ga0207681_10312639 3300025923 Bacteria 1246
275 Ga0207681_10910270 3300025923 Bacteria 737
276 Ga0207694_11047996 3300025924 Bacteria 690
277 Ga0207650_10571097 3300025925 Bacteria 949
278 Ga0207659_10309972 3300025926 Bacteria 1299
279 Ga0207687_10291042 3300025927 Bacteria 1313
280 Ga0207687_10801815 3300025927 Bacteria 803
281 Ga0207700_10337077 3300025928 Bacteria 1310
282 Ga0207700_10993153 3300025928 Bacteria 751
283 Ga0207664_10299382 3300025929 Bacteria 1415
284 Ga0207664_10307968 3300025929 Bacteria 1395
285 Ga0207644_10258521 3300025931 Bacteria 1391
286 Ga0207690_10277951 3300025932 Bacteria 1303
287 Ga0207690_10384609 3300025932 Bacteria 1116
288 Ga0207690_11673803 3300025932 Bacteria 532
289 Ga0207706_10132435 3300025933 Bacteria 2193
290 Ga0207706_11218745 3300025933 Bacteria 625
291 Ga0207686_10163131 3300025934 Bacteria 1564
292 Ga0207686_10248530 3300025934 Bacteria 1298
293 Ga0207686_11244904 3300025934 Bacteria 610
294 Ga0207709_10168136 3300025935 Bacteria 1536
295 Ga0207709_10229376 3300025935 Bacteria 1344
296 Ga0207709_10830388 3300025935 Bacteria 748
297 Ga0207670_10277341 3300025936 Bacteria 1305
298 Ga0207670_10693799 3300025936 Bacteria 842
299 Ga0207669_10214206 3300025937 Bacteria 1408
300 Ga0207669_10243578 3300025937 Bacteria 1334
301 Ga0207704_10248668 3300025938 Bacteria 1333
302 Ga0207704_10306501 3300025938 Bacteria 1219
303 Ga0207704_10522533 3300025938 Bacteria 960
304 Ga0207704_11988361 3300025938 Bacteria 500
305 Ga0207665_10038982 3300025939 Bacteria 3166
306 Ga0207691_10166282 3300025940 Bacteria 1933
307 Ga0207691_10580315 3300025940 Bacteria 950
308 Ga0207711_10343439 3300025941 Bacteria 1382
309 Ga0207711_10745126 3300025941 Bacteria 913
310 Ga0207711_11083111 3300025941 Bacteria 742
311 Ga0207689_10066870 3300025942 Bacteria 2954
312 Ga0207689_11580914 3300025942 Bacteria 546
313 Ga0207661_10946473 3300025944 Bacteria 793
314 Ga0207679_10086974 3300025945 Bacteria 2405
315 Ga0207667_10377234 3300025949 Bacteria 1445
316 Ga0207667_10740838 3300025949 Bacteria 983
317 Ga0207667_11762610 3300025949 Bacteria 584
318 Ga0207651_11219590 3300025960 Bacteria 675
319 Ga0207712_10304370 3300025961 Bacteria 1310
320 Ga0207712_11319545 3300025961 Bacteria 645
321 Ga0207668_10199084 3300025972 Bacteria 1593
322 Ga0207668_10628998 3300025972 Bacteria 937
323 Ga0207640_10275253 3300025981 Bacteria 1319
324 Ga0207658_10676048 3300025986 Bacteria 932
325 Ga0207658_11161765 3300025986 Bacteria 705
326 Ga0207658_11931440 3300025986 Bacteria 537
327 Ga0207677_10312747 3300026023 Bacteria 1302
328 Ga0207677_10350918 3300026023 Bacteria 1236
329 Ga0207639_11400179 3300026041 Bacteria 656
330 Ga0207639_11433245 3300026041 Bacteria 648
331 Ga0207678_10060982 3300026067 Bacteria 3243
332 Ga0207678_10126317 3300026067 Bacteria 2182
333 Ga0207708_10058563 3300026075 Bacteria 2939
334 Ga0207702_10417970 3300026078 Bacteria 1296
335 Ga0207702_10583315 3300026078 Bacteria 1096
336 Ga0207641_10419221 3300026088 Bacteria 1288
337 Ga0207641_11656468 3300026088 Bacteria 642
338 Ga0207648_10082259 3300026089 Bacteria 2808
339 Ga0207676_10388090 3300026095 Bacteria 1301
340 Ga0207674_10250405 3300026116 Bacteria 1719
341 Ga0207674_12219864 3300026116 Bacteria 512
342 Ga0207675_100120172 3300026118 Bacteria 2485
343 Ga0207683_10640147 3300026121 Bacteria 985
344 Ga0207683_12031967 3300026121 Bacteria 523
345 Ga0207698_10275068 3300026142 Bacteria 1554
346 Ga0207698_11333986 3300026142 Bacteria 732
347 Ga0209179_1017980 3300027512 Bacteria 1346
348 Ga0209813_10038555 3300027866 Bacteria 1445
349 Ga0268266_10355434 3300028379 Bacteria 1377
350 Ga0268265_10366655 3300028380 Bacteria 1320
351 Ga0268264_10415480 3300028381 Bacteria 1296
352 Ga0268264_12026609 3300028381 Bacteria 585
353 Ga0265326_10201441 3300028558 Bacteria 572
354 Ga0265334_10061749 3300028573 Bacteria 1411
355 Ga0265318_10044751 3300028577 Bacteria 1674
356 Ga0265336_10039803 3300028666 Bacteria 1440
357 Ga0265338_10071206 3300028800 Bacteria 2976
358 Ga0265338_10364433 3300028800 Bacteria 1036
359 Ga0265330_10033908 3300031235 Bacteria 2281
360 Ga0265332_10077431 3300031238 Bacteria 1412
361 Ga0265320_10113188 3300031240 Bacteria 1241
362 Ga0265325_10019975 3300031241 Bacteria 3696
363 Ga0265340_10098644 3300031247 Bacteria 1359
364 Ga0265339_10121880 3300031249 Bacteria 1339
365 Ga0265331_10153412 3300031250 Bacteria 1045
366 Ga0265327_10110587 3300031251 Bacteria 1313
367 Ga0265316_10256572 3300031344 Bacteria 1282
368 Ga0307513_10056093 3300031456 Bacteria 4209
369 Ga0307408_100236173 3300031548 Bacteria 1500
370 Ga0307408_100279968 3300031548 Bacteria 1389
371 Ga0265313_10045990 3300031595 Bacteria 2121
372 Ga0307514_10300690 3300031649 Bacteria 899
373 Ga0265314_10127269 3300031711 Bacteria 1593
374 Ga0265314_10150863 3300031711 Bacteria 1425
375 Ga0265342_10062355 3300031712 Bacteria 2194
376 Ga0307405_10851810 3300031731 Bacteria 767
377 Ga0307413_10724908 3300031824 Bacteria 828
378 Ga0307413_11089330 3300031824 Bacteria 689
379 Ga0307413_11922460 3300031824 Bacteria 532
380 Ga0307410_10095837 3300031852 Bacteria 2116
381 Ga0307410_11205264 3300031852 Bacteria 659
382 Ga0307406_10084547 3300031901 Bacteria 2119
383 Ga0307406_10285896 3300031901 Bacteria 1260
384 Ga0307407_10103387 3300031903 Bacteria 1773
385 Ga0307407_10191155 3300031903 Bacteria 1364
386 Ga0307412_10244790 3300031911 Bacteria 1389
387 Ga0307409_100012519 3300031995 Bacteria 5410
388 Ga0307409_100184205 3300031995 Bacteria 1852
389 Ga0307409_100356335 3300031995 Bacteria 1382
390 Ga0307409_101850884 3300031995 Bacteria 633
391 Ga0307416_100328512 3300032002 Bacteria 1535
392 Ga0307416_102323264 3300032002 Bacteria 636
393 Ga0307416_103614155 3300032002 Bacteria 517
394 Ga0307414_10447210 3300032004 Bacteria 1132
395 Ga0307414_10821845 3300032004 Bacteria 848
396 Ga0307411_10588495 3300032005 Bacteria 955
397 Ga0307411_12134295 3300032005 Bacteria 524
398 Ga0307415_100139650 3300032126 Bacteria 1848
399 Ga0307415_101676142 3300032126 Bacteria 612
400 Ga0373930_0033927 3300034816 Bacteria 1061
401 Ga0373948_0164388 3300034817 Bacteria 561
402 Ga0373950_0019818 3300034818 Bacteria 1178
403 Ga0373950_0117473 3300034818 Bacteria 586
404 Ga0373959_0023941 3300034820 Bacteria 1190
405 Ga0373938_0020755 3300034957 Bacteria 1326
406 Ga0373929_0014861 3300035085 Bacteria 1508
407 Ga0373940_0050572 3300035088 Bacteria 1166
408 Ga0373949_0028601 3300035090 Bacteria 1316
409 Ga0373952_0014194 3300035092 Bacteria 1591
410 Ga0373952_0021312 3300035092 Bacteria 1367
411 Ga0373932_0048120 3300035112 Bacteria 1255
412 Ga0373932_0125257 3300035112 Bacteria 861
413 Ga0373939_0015306 3300035114 Bacteria 2005
414 Ga0373939_0092926 3300035114 Bacteria 1022
415 Ga0373941_0038204 3300035115 Bacteria 1468
416 Ga0373960_0004501 3300035121 Bacteria 3200
417 Ga0373960_0234204 3300035121 Bacteria 661
418 Ga0373942_0068116 3300035207 Bacteria 1033
419 Ga0373961_0369529 3300035241 Bacteria 544
420 Ga0373962_0038247 3300035242 Bacteria 1342
421 Ga0373931_0052933 3300035691 Bacteria 2165
422 Ga0373931_0156019 3300035691 Bacteria 1334
423 Ga0395899_0934890 3300037312 Bacteria 527
424 Ga0395898_1034962 3300037466 Bacteria 756
425 Ga0436364_0124370 3300037853 Bacteria 1704
426 Ga0395901_0924865 3300038443 Bacteria 852
427 Ga0436365_0101565 3300039437 Bacteria 611
428 Ga0436361_0521444 3300039447 Bacteria 3558
429 Ga0436362_0656493 3300039453 Bacteria 1412
430 Ga0451793_0688899 3300041452 Bacteria 519
431 Ga0451800_0771541 3300041459 Bacteria 960
432 Ga0451806_714643 3300041462 Bacteria 562
433 Ga0451843_0348584 3300041509 Bacteria 1516
434 Ga0451843_0517588 3300041509 Bacteria 1063
435 Ga0451853_0183895 3300041512 Bacteria 808
436 Ga0439451_052650 3300042009 Bacteria 815
437 Ga0450902_043385 3300042137 Bacteria 767
438 Ga0439435_0018736 3300042436 Bacteria 1765
439 Ga0439440_0227707 3300042993 Bacteria 561
440 Ga0466972_0580419 3300044658 Bacteria 529
441 Ga0466958_0101224 3300045836 Bacteria 1792
442 Ga0495603_0108437 3300046455 Bacteria 1620
443 Ga0495590_0252187 3300046457 Bacteria 657
444 Ga0495629_1046103 3300046459 Bacteria 530
445 Ga0495641_0058220 3300046461 Bacteria 1748
446 Ga0495580_0171870 3300046472 Bacteria 1498
447 Ga0495580_0221368 3300046472 Bacteria 1300
448 Ga0495582_0088558 3300046473 Bacteria 1724
449 Ga0495639_0042681 3300046475 Bacteria 2047
450 Ga0495584_0081525 3300046491 Bacteria 1629
451 Ga0495594_0080833 3300046499 Bacteria 1814
452 Ga0495594_0147371 3300046499 Bacteria 1336
453 Ga0495616_0341366 3300046513 Bacteria 625
454 Ga0495620_0067948 3300046515 Bacteria 1465
455 Ga0495631_0314486 3300046518 Bacteria 666
456 Ga0495632_0523989 3300046519 Bacteria 510
457 Ga0495663_0222149 3300046525 Bacteria 664
458 Ga0495666_0060074 3300046526 Bacteria 1817
459 Ga0495665_0140667 3300046531 Bacteria 1261
460 Ga0495665_0424262 3300046531 Bacteria 673
461 Ga0495622_0268006 3300046557 Bacteria 749
462 Ga0495656_0559532 3300046615 Bacteria 610
463 Ga0495668_0131607 3300046616 Bacteria 1369
464 Ga0495647_0064966 3300046681 Bacteria 1448
465 Ga0495647_0590591 3300046681 Bacteria 521
466 Ga0495658_0101956 3300046683 Bacteria 1714
467 Ga0495658_0808464 3300046683 Bacteria 600
468 Ga0495669_0109460 3300046684 Bacteria 1289
469 Ga0495624_0565721 3300046690 Bacteria 678
470 Ga0495670_0103756 3300046691 Bacteria 1466
471 Ga0495671_0473169 3300046692 Bacteria 598
472 Ga0495581_0124860 3300047315 Bacteria 1498
473 Ga0495672_0121296 3300047320 Bacteria 1389
474 Ga0495676_0542327 3300047321 Bacteria 761
475 Ga0496100_0128028 3300048903 Bacteria 1785
476 Ga0496100_0430506 3300048903 Bacteria 1009
477 Ga0496100_0815144 3300048903 Bacteria 731
478 Ga0496101_0502506 3300048904 Bacteria 958
479 Ga0496101_0565774 3300048904 Unclassified 899
480 Ga0496102_0170430 3300048905 Bacteria 2049
481 Ga0496102_0170781 3300048905 Bacteria 2047
482 Ga0496102_0460512 3300048905 Bacteria 1192
483 Ga0496103_0103532 3300048906 Bacteria 1803
484 Ga0496103_0933924 3300048906 Bacteria 542
485 Ga0496104_0119740 3300048907 Bacteria 2527
486 Ga0496104_1238283 3300048907 Bacteria 649
487 Ga0496105_0262963 3300048908 Bacteria 1395
488 Ga0496106_0304444 3300048909 Bacteria 1278
489 Ga0496106_0456782 3300048909 Bacteria 1026
490 Ga0496109_0266152 3300048912 Bacteria 1615
491 Ga0496109_0383306 3300048912 Bacteria 1328
492 Ga0496109_0510361 3300048912 Bacteria 1135
493 Ga0496110_1412563 3300048913 Bacteria 605
494 Ga0496111_0065151 3300048914 Bacteria 2644
495 Ga0496111_0543060 3300048914 Bacteria 854
496 Ga0496112_0387234 3300048915 Bacteria 1338
497 Ga0496113_0121140 3300048916 Bacteria 2045
498 Ga0496114_0274377 3300048917 Bacteria 1486
499 Ga0496114_0720236 3300048917 Bacteria 874
500 Ga0496114_1554904 3300048917 Bacteria 549
501 Ga0496115_0170941 3300048918 Bacteria 1797
502 Ga0496115_0443914 3300048918 Bacteria 1049
503 Ga0496117_0110642 3300048920 Bacteria 1712
504 Ga0496118_0136348 3300048921 Bacteria 1565
505 Ga0496119_0371945 3300048922 Bacteria 687
506 Ga0496120_0446376 3300048923 Bacteria 564
507 Ga0496121_0024298 3300048924 Bacteria 5802
508 Ga0496124_0177563 3300048927 Bacteria 1642
509 Ga0496126_1287282 3300048929 Bacteria 533
510 Ga0501031_0078107 3300049568 Bacteria 2156
511 Ga0501031_0163849 3300049568 Bacteria 1453
512 Ga0501032_0132811 3300049569 Bacteria 1641
513 Ga0501032_0172144 3300049569 Bacteria 1419
514 Ga0501033_0031585 3300049570 Bacteria 3978
515 Ga0501033_0205047 3300049570 Bacteria 1407
516 Ga0501034_0302655 3300049571 Bacteria 1535
517 Ga0501034_0569652 3300049571 Bacteria 1040
518 Ga0501034_1394622 3300049571 Bacteria 576
519 Ga0501036_0146601 3300049572 Bacteria 1991
520 Ga0501037_0164713 3300049573 Bacteria 1579
521 Ga0501037_0167701 3300049573 Bacteria 1562
522 Ga0501038_0197053 3300049574 Bacteria 1618
523 Ga0501038_0458340 3300049574 Bacteria 979
524 Ga0501038_0777598 3300049574 Bacteria 713
525 Ga0501039_0179954 3300049575 Bacteria 1663
526 Ga0501039_0873613 3300049575 Bacteria 700
527 Ga0501043_0187526 3300049579 Bacteria 1609
528 Ga0501043_0259319 3300049579 Bacteria 1337
529 Ga0501046_0188801 3300049580 Bacteria 1538
530 Ga0501046_0682328 3300049580 Bacteria 725
531 Ga0501047_0203658 3300049581 Bacteria 1839
532 Ga0501047_0242088 3300049581 Bacteria 1654
533 Ga0501048_0181283 3300049582 Bacteria 1493
534 Ga0501069_0107661 3300049585 Bacteria 1585
535 Ga0501069_0143450 3300049585 Bacteria 1370
536 Ga0501070_0003549 3300049586 Bacteria 13490
537 Ga0501070_0142184 3300049586 Bacteria 1981
538 Ga0501070_0257124 3300049586 Bacteria 1428
539 Ga0501071_0566754 3300049587 Bacteria 873
540 Ga0501073_0192574 3300049589 Bacteria 1411
541 Ga0501073_0224335 3300049589 Bacteria 1298
542 Ga0501074_0207629 3300049590 Bacteria 1395
543 Ga0501074_0248316 3300049590 Bacteria 1265
544 Ga0501074_0563271 3300049590 Bacteria 806
545 Ga0501079_0277006 3300049741 Bacteria 1312
546 Ga0501079_0502158 3300049741 Bacteria 953
547 Ga0501080_0001972 3300049742 Bacteria 17716
548 Ga0501035_0021491 3300049822 Bacteria 5932
549 Ga0501035_0221432 3300049822 Bacteria 1615
550 Ga0501044_0037065 3300049823 Bacteria 5098
551 Ga0501044_0061790 3300049823 Bacteria 3831
552 Ga0501044_0321054 3300049823 Bacteria 1473
553 nmdc:mga03n38_42913_c1 3300050490 Bacteria 1980
554 nmdc:mga00v17_150467_c1 3300050491 Bacteria 1495
555 nmdc:mga00v17_488749_c1 3300050491 Bacteria 798
556 nmdc:mga00v17_78149_c1 3300050491 Bacteria 2062
557 nmdc:mga00v17_906517_c1 3300050491 Bacteria 558
558 nmdc:mga0yw44_129429_c1 3300050492 Bacteria 1633
559 nmdc:mga0yw44_157553_c1 3300050492 Bacteria 1485
560 nmdc:mga0yw44_22421_c1 3300050492 Bacteria 3541
561 nmdc:mga0yw44_237576_c1 3300050492 Bacteria 1211
562 nmdc:mga0yw44_268358_c1 3300050492 Bacteria 1139
563 nmdc:mga0yw44_777746_c1 3300050492 Bacteria 650
564 nmdc:mga06z11_136871_c1 3300050494 Bacteria 1381
565 nmdc:mga04h51_64247_c1 3300050495 Bacteria 1266
566 nmdc:mga07m45_53478_c2 3300050496 Bacteria 1305
567 nmdc:mga06r32_22384_c1 3300050510 Bacteria 5843
568 nmdc:mga0sz30_214203_c1 3300050516 Bacteria 856
569 Ga0495655_0108378 3300053083 Bacteria 831
570 Ga0500643_035625 3300053087 Bacteria 1490
571 Ga0500622_0027519 3300053156 Bacteria 2997
572 Ga0500622_0109273 3300053156 Bacteria 1353

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0569652 Ga0501034_0569652_354_644 76
2 3300049741 Ga0501079_0277006 Ga0501079_0277006_1051_1293 80
3 3300050491 nmdc:mga00v17_488749_c1 nmdc:mga00v17_488749_c1_497_739 80
4 3300005336 Ga0070680_100259674 Ga0070680_1002596742 81
5 3300005338 Ga0068868_102237611 Ga0068868_1022376112 82
6 3300005436 Ga0070713_101628720 Ga0070713_1016287201 82
7 3300005440 Ga0070705_100830986 Ga0070705_1008309861 82
8 3300006175 Ga0070712_101579374 Ga0070712_1015793741 82
9 3300006881 Ga0068865_101564622 Ga0068865_1015646221 82
10 3300025898 Ga0207692_10160095 Ga0207692_101600952 82
11 3300025915 Ga0207693_10503343 Ga0207693_105033432 82
12 3300031731 Ga0307405_10851810 Ga0307405_108518101 83
13 3300031824 Ga0307413_10724908 Ga0307413_107249082 83
14 3300031852 Ga0307410_10095837 Ga0307410_100958373 83
15 3300031901 Ga0307406_10084547 Ga0307406_100845472 83
16 3300031903 Ga0307407_10191155 Ga0307407_101911553 83
17 3300031995 Ga0307409_100012519 Ga0307409_1000125195 83
18 3300032002 Ga0307416_103614155 Ga0307416_1036141552 83
19 3300032004 Ga0307414_10447210 Ga0307414_104472102 83
20 3300032005 Ga0307411_12134295 Ga0307411_121342951 83
21 3300014325 Ga0163163_12977207 Ga0163163_129772071 84
22 3300009094 Ga0111539_10755061 Ga0111539_107550611 86
23 3300009147 Ga0114129_12583789 Ga0114129_125837891 86
24 3300028800 Ga0265338_10364433 Ga0265338_103644332 86
25 3300031238 Ga0265332_10077431 Ga0265332_100774312 86
26 3300031251 Ga0265327_10110587 Ga0265327_101105872 86
27 3300031711 Ga0265314_10150863 Ga0265314_101508632 86
28 3300005367 Ga0070667_100157980 Ga0070667_1001579802 87
29 3300006038 Ga0075365_10011120 Ga0075365_100111201 87
30 3300006038 Ga0075365_10159281 Ga0075365_101592813 87
31 3300006038 Ga0075365_11031371 Ga0075365_110313712 87
32 3300006042 Ga0075368_10088339 Ga0075368_100883392 87
33 3300006048 Ga0075363_100196243 Ga0075363_1001962431 87
34 3300006051 Ga0075364_10353011 Ga0075364_103530112 87
35 3300006177 Ga0075362_10003608 Ga0075362_100036081 87
36 3300006186 Ga0075369_10170199 Ga0075369_101701991 87
37 3300006353 Ga0075370_10046227 Ga0075370_100462273 87
38 3300014968 Ga0157379_11486759 Ga0157379_114867592 87
39 3300025986 Ga0207658_11931440 Ga0207658_119314401 87
40 3300027866 Ga0209813_10038555 Ga0209813_100385552 87
41 3300039437 Ga0436365_0101565 Ga0436365_0101565_78_383 87
42 3300041509 Ga0451843_0517588 Ga0451843_0517588_447_752 87
43 3300041512 Ga0451853_0183895 Ga0451853_0183895_66_371 87
44 3300048927 Ga0496124_0177563 Ga0496124_0177563_1239_1544 87
45 3300050490 nmdc:mga03n38_42913_c1 nmdc:mga03n38_42913_c1_1279_1596 87
46 3300050491 nmdc:mga00v17_150467_c1 nmdc:mga00v17_150467_c1_948_1253 87
47 3300050491 nmdc:mga00v17_78149_c1 nmdc:mga00v17_78149_c1_1087_1404 87
48 3300050492 nmdc:mga0yw44_129429_c1 nmdc:mga0yw44_129429_c1_1269_1574 87
49 3300050492 nmdc:mga0yw44_157553_c1 nmdc:mga0yw44_157553_c1_128_433 87
50 3300050492 nmdc:mga0yw44_22421_c1 nmdc:mga0yw44_22421_c1_3124_3429 87
51 3300050492 nmdc:mga0yw44_237576_c1 nmdc:mga0yw44_237576_c1_200_517 87
52 3300050494 nmdc:mga06z11_136871_c1 nmdc:mga06z11_136871_c1_993_1310 87
53 3300050495 nmdc:mga04h51_64247_c1 nmdc:mga04h51_64247_c1_906_1223 87
54 3300050496 nmdc:mga07m45_53478_c2 nmdc:mga07m45_53478_c2_83_400 87
55 3300050516 nmdc:mga0sz30_214203_c1 nmdc:mga0sz30_214203_c1_526_843 87
56 3300005441 Ga0070700_100512744 Ga0070700_1005127443 88
57 3300014969 Ga0157376_11599279 Ga0157376_115992791 88
58 3300031548 Ga0307408_100236173 Ga0307408_1002361733 89
59 3300031901 Ga0307406_10285896 Ga0307406_102858961 89
60 3300031995 Ga0307409_100356335 Ga0307409_1003563352 89
61 3300031995 Ga0307409_101850884 Ga0307409_1018508841 89
62 3300032002 Ga0307416_102323264 Ga0307416_1023232641 89
63 3300032126 Ga0307415_100139650 Ga0307415_1001396502 89
64 3300032126 Ga0307415_101676142 Ga0307415_1016761421 89
65 3300013105 Ga0157369_10731174 Ga0157369_107311742 90
66 3300003323 rootH1_10053897 rootH1_100538973 92
67 3300003323 rootH1_10252916 rootH1_102529161 92
68 iso_pu_bacteria 2791354901 2791917430 92
69 3300005337 Ga0070682_100441202 Ga0070682_1004412023 93
70 3300005434 Ga0070709_10323464 Ga0070709_103234642 93
71 3300005435 Ga0070714_100344906 Ga0070714_1003449061 93
72 3300005437 Ga0070710_10202979 Ga0070710_102029791 93
73 3300005439 Ga0070711_100140716 Ga0070711_1001407162 93
74 3300006028 Ga0070717_10471921 Ga0070717_104719211 93
75 3300006175 Ga0070712_100226901 Ga0070712_1002269012 93
76 3300025906 Ga0207699_10294836 Ga0207699_102948362 93
77 3300025915 Ga0207693_10254515 Ga0207693_102545152 93
78 3300025916 Ga0207663_10311884 Ga0207663_103118841 93
79 3300025928 Ga0207700_10337077 Ga0207700_103370772 93
80 3300025929 Ga0207664_10307968 Ga0207664_103079681 93
81 3300042436 Ga0439435_0018736 Ga0439435_0018736_1396_1680 93
82 3300045836 Ga0466958_0101224 Ga0466958_0101224_408_722 93
83 3300050510 nmdc:mga06r32_22384_c1 nmdc:mga06r32_22384_c1_5202_5489 93
84 3300009101 Ga0105247_10001194 Ga0105247_100011947 94
85 3300025900 Ga0207710_10000174 Ga0207710_1000017419 94
86 3300048904 Ga0496101_0565774 Ga0496101_0565774_496_786 94
87 3300048905 Ga0496102_0170430 Ga0496102_0170430_162_452 94
88 3300048906 Ga0496103_0103532 Ga0496103_0103532_1027_1317 94
89 3300048920 Ga0496117_0110642 Ga0496117_0110642_132_422 94
90 3300048921 Ga0496118_0136348 Ga0496118_0136348_174_464 94
91 3300048924 Ga0496121_0024298 Ga0496121_0024298_4740_5030 94
92 3300049587 Ga0501071_0566754 Ga0501071_0566754_254_538 94
93 3300005330 Ga0070690_100965611 Ga0070690_1009656112 95
94 3300005355 Ga0070671_101581393 Ga0070671_1015813932 95
95 3300005535 Ga0070684_101354972 Ga0070684_1013549721 95
96 3300005548 Ga0070665_101676125 Ga0070665_1016761252 95
97 3300005615 Ga0070702_101215703 Ga0070702_1012157032 95
98 3300006028 Ga0070717_11062494 Ga0070717_110624942 95
99 3300006175 Ga0070712_100185010 Ga0070712_1001850102 95
100 3300006881 Ga0068865_100365800 Ga0068865_1003658002 95
101 3300009098 Ga0105245_10536725 Ga0105245_105367252 95
102 3300009098 Ga0105245_12117638 Ga0105245_121176382 95
103 3300009101 Ga0105247_11375329 Ga0105247_113753292 95
104 3300009148 Ga0105243_10515441 Ga0105243_105154412 95
105 3300009176 Ga0105242_10225814 Ga0105242_102258142 95
106 3300009177 Ga0105248_10823755 Ga0105248_108237552 95
107 3300009551 Ga0105238_11318210 Ga0105238_113182102 95
108 3300009553 Ga0105249_11971766 Ga0105249_119717662 95
109 3300009553 Ga0105249_12246313 Ga0105249_122463132 95
110 3300010375 Ga0105239_10334387 Ga0105239_103343873 95
111 3300010375 Ga0105239_11750252 Ga0105239_117502522 95
112 3300013306 Ga0163162_12471429 Ga0163162_124714291 95
113 3300017792 Ga0163161_10640764 Ga0163161_106407641 95
114 3300025321 Ga0207656_10332155 Ga0207656_103321552 95
115 3300025915 Ga0207693_10173266 Ga0207693_101732663 95
116 3300025927 Ga0207687_10801815 Ga0207687_108018151 95
117 3300025932 Ga0207690_11673803 Ga0207690_116738031 95
118 3300025933 Ga0207706_11218745 Ga0207706_112187452 95
119 3300025934 Ga0207686_10163131 Ga0207686_101631312 95
120 3300025935 Ga0207709_10168136 Ga0207709_101681362 95
121 3300025936 Ga0207670_10693799 Ga0207670_106937992 95
122 3300025938 Ga0207704_10522533 Ga0207704_105225332 95
123 3300025941 Ga0207711_11083111 Ga0207711_110831112 95
124 3300037312 Ga0395899_0934890 Ga0395899_0934890_60_353 95
125 3300037466 Ga0395898_1034962 Ga0395898_1034962_60_353 95
126 3300038443 Ga0395901_0924865 Ga0395901_0924865_382_675 95
127 3300041452 Ga0451793_0688899 Ga0451793_0688899_130_417 95
128 3300042009 Ga0439451_052650 Ga0439451_052650_515_802 95
129 3300042137 Ga0450902_043385 Ga0450902_043385_199_492 95
130 3300046615 Ga0495656_0559532 Ga0495656_0559532_73_360 95
131 3300048903 Ga0496100_0430506 Ga0496100_0430506_708_995 95
132 3300048904 Ga0496101_0502506 Ga0496101_0502506_142_429 95
133 3300048905 Ga0496102_0170781 Ga0496102_0170781_79_366 95
134 3300048912 Ga0496109_0266152 Ga0496109_0266152_1221_1508 95
135 3300048914 Ga0496111_0543060 Ga0496111_0543060_91_381 95
136 3300048917 Ga0496114_0274377 Ga0496114_0274377_132_419 95
137 3300048917 Ga0496114_0720236 Ga0496114_0720236_504_791 95
138 3300049585 Ga0501069_0107661 Ga0501069_0107661_1063_1395 95
139 3300049590 Ga0501074_0563271 Ga0501074_0563271_45_377 95
140 3300049741 Ga0501079_0502158 Ga0501079_0502158_477_809 95
141 3300000531 CNBas_1011574 CNBas_10115741 96
142 3300000549 LJQas_1001486 LJQas_10014863 96
143 3300001904 JGI24736J21556_1014596 JGI24736J21556_10145961 96
144 3300001915 JGI24741J21665_1014894 JGI24741J21665_10148942 96
145 3300001915 JGI24741J21665_1015450 JGI24741J21665_10154502 96
146 3300001976 JGI24752J21851_1009146 JGI24752J21851_10091461 96
147 3300001979 JGI24740J21852_10042187 JGI24740J21852_100421872 96
148 3300001979 JGI24740J21852_10174428 JGI24740J21852_101744282 96
149 3300001989 JGI24739J22299_10058528 JGI24739J22299_100585281 96
150 3300002067 JGI24735J21928_10183692 JGI24735J21928_101836922 96
151 3300002075 JGI24738J21930_10014229 JGI24738J21930_100142293 96
152 3300002076 JGI24749J21850_1013375 JGI24749J21850_10133751 96
153 3300002077 JGI24744J21845_10004331 JGI24744J21845_100043312 96
154 3300002077 JGI24744J21845_10090658 JGI24744J21845_100906582 96
155 3300002155 JGI24033J26618_1007147 JGI24033J26618_10071472 96
156 3300002239 JGI24034J26672_10007726 JGI24034J26672_100077261 96
157 3300002459 JGI24751J29686_10024078 JGI24751J29686_100240782 96
158 3300002459 JGI24751J29686_10094652 JGI24751J29686_100946522 96
159 3300005290 Ga0065712_10031799 Ga0065712_100317991 96
160 3300005327 Ga0070658_10333962 Ga0070658_103339621 96
161 3300005327 Ga0070658_10620771 Ga0070658_106207712 96
162 3300005329 Ga0070683_100395030 Ga0070683_1003950302 96
163 3300005329 Ga0070683_100411502 Ga0070683_1004115021 96
164 3300005331 Ga0070670_101945290 Ga0070670_1019452901 96
165 3300005333 Ga0070677_10415026 Ga0070677_104150262 96
166 3300005334 Ga0068869_100105382 Ga0068869_1001053822 96
167 3300005334 Ga0068869_100298511 Ga0068869_1002985111 96
168 3300005334 Ga0068869_100538371 Ga0068869_1005383712 96
169 3300005336 Ga0070680_100253346 Ga0070680_1002533461 96
170 3300005337 Ga0070682_100229574 Ga0070682_1002295742 96
171 3300005337 Ga0070682_100854148 Ga0070682_1008541481 96
172 3300005337 Ga0070682_101955858 Ga0070682_1019558581 96
173 3300005338 Ga0068868_100260641 Ga0068868_1002606412 96
174 3300005339 Ga0070660_101336127 Ga0070660_1013361272 96
175 3300005340 Ga0070689_101114961 Ga0070689_1011149612 96
176 3300005341 Ga0070691_10508364 Ga0070691_105083641 96
177 3300005344 Ga0070661_101098424 Ga0070661_1010984242 96
178 3300005344 Ga0070661_101733463 Ga0070661_1017334631 96
179 3300005347 Ga0070668_100220973 Ga0070668_1002209732 96
180 3300005356 Ga0070674_100139031 Ga0070674_1001390312 96
181 3300005364 Ga0070673_100618149 Ga0070673_1006181492 96
182 3300005365 Ga0070688_100124208 Ga0070688_1001242083 96
183 3300005366 Ga0070659_100353607 Ga0070659_1003536072 96
184 3300005366 Ga0070659_101487605 Ga0070659_1014876051 96
185 3300005367 Ga0070667_100494532 Ga0070667_1004945323 96
186 3300005406 Ga0070703_10407137 Ga0070703_104071372 96
187 3300005434 Ga0070709_10032131 Ga0070709_100321314 96
188 3300005436 Ga0070713_100736471 Ga0070713_1007364712 96
189 3300005437 Ga0070710_10131788 Ga0070710_101317882 96
190 3300005438 Ga0070701_10051684 Ga0070701_100516843 96
191 3300005439 Ga0070711_100091075 Ga0070711_1000910752 96
192 3300005439 Ga0070711_100138873 Ga0070711_1001388734 96
193 3300005439 Ga0070711_100233973 Ga0070711_1002339732 96
194 3300005444 Ga0070694_101047112 Ga0070694_1010471122 96
195 3300005445 Ga0070708_100251683 Ga0070708_1002516833 96
196 3300005455 Ga0070663_100156641 Ga0070663_1001566411 96
197 3300005456 Ga0070678_100264314 Ga0070678_1002643142 96
198 3300005456 Ga0070678_102034088 Ga0070678_1020340882 96
199 3300005458 Ga0070681_10217925 Ga0070681_102179253 96
200 3300005466 Ga0070685_10212452 Ga0070685_102124522 96
201 3300005467 Ga0070706_100936928 Ga0070706_1009369282 96
202 3300005468 Ga0070707_100781035 Ga0070707_1007810352 96
203 3300005468 Ga0070707_102185678 Ga0070707_1021856781 96
204 3300005471 Ga0070698_100357972 Ga0070698_1003579723 96
205 3300005471 Ga0070698_100897934 Ga0070698_1008979342 96
206 3300005471 Ga0070698_101815416 Ga0070698_1018154161 96
207 3300005518 Ga0070699_100250318 Ga0070699_1002503181 96
208 3300005518 Ga0070699_100391354 Ga0070699_1003913541 96
209 3300005530 Ga0070679_100325143 Ga0070679_1003251431 96
210 3300005530 Ga0070679_100679167 Ga0070679_1006791672 96
211 3300005535 Ga0070684_100177227 Ga0070684_1001772273 96
212 3300005535 Ga0070684_101056549 Ga0070684_1010565491 96
213 3300005536 Ga0070697_100135953 Ga0070697_1001359532 96
214 3300005536 Ga0070697_100255784 Ga0070697_1002557842 96
215 3300005536 Ga0070697_100918061 Ga0070697_1009180612 96
216 3300005539 Ga0068853_100689144 Ga0068853_1006891441 96
217 3300005543 Ga0070672_101224727 Ga0070672_1012247271 96
218 3300005543 Ga0070672_101929395 Ga0070672_1019293952 96
219 3300005543 Ga0070672_102179744 Ga0070672_1021797441 96
220 3300005546 Ga0070696_100272272 Ga0070696_1002722722 96
221 3300005546 Ga0070696_100645344 Ga0070696_1006453442 96
222 3300005548 Ga0070665_101840314 Ga0070665_1018403141 96
223 3300005549 Ga0070704_101109899 Ga0070704_1011098991 96
224 3300005563 Ga0068855_100479377 Ga0068855_1004793772 96
225 3300005563 Ga0068855_101129371 Ga0068855_1011293712 96
226 3300005564 Ga0070664_100402418 Ga0070664_1004024181 96
227 3300005577 Ga0068857_100397824 Ga0068857_1003978241 96
228 3300005577 Ga0068857_100937161 Ga0068857_1009371612 96
229 3300005614 Ga0068856_100502880 Ga0068856_1005028802 96
230 3300005614 Ga0068856_100891110 Ga0068856_1008911102 96
231 3300005616 Ga0068852_100206930 Ga0068852_1002069301 96
232 3300005616 Ga0068852_100326940 Ga0068852_1003269401 96
233 3300005616 Ga0068852_102761088 Ga0068852_1027610881 96
234 3300005617 Ga0068859_100841444 Ga0068859_1008414441 96
235 3300005617 Ga0068859_102255135 Ga0068859_1022551351 96
236 3300005834 Ga0068851_10719631 Ga0068851_107196312 96
237 3300005840 Ga0068870_11391173 Ga0068870_113911732 96
238 3300005841 Ga0068863_102220838 Ga0068863_1022208382 96
239 3300005843 Ga0068860_102153739 Ga0068860_1021537392 96
240 3300005937 Ga0081455_10782811 Ga0081455_107828112 96
241 3300005985 Ga0081539_10014068 Ga0081539_100140685 96
242 3300006038 Ga0075365_10349796 Ga0075365_103497962 96
243 3300006038 Ga0075365_10992522 Ga0075365_109925222 96
244 3300006163 Ga0070715_10087964 Ga0070715_100879642 96
245 3300006163 Ga0070715_10756686 Ga0070715_107566861 96
246 3300006175 Ga0070712_100262758 Ga0070712_1002627582 96
247 3300006175 Ga0070712_101778353 Ga0070712_1017783532 96
248 3300006237 Ga0097621_101364032 Ga0097621_1013640321 96
249 3300006358 Ga0068871_101217842 Ga0068871_1012178422 96
250 3300006844 Ga0075428_101260186 Ga0075428_1012601861 96
251 3300006844 Ga0075428_102453156 Ga0075428_1024531561 96
252 3300006847 Ga0075431_100461742 Ga0075431_1004617422 96
253 3300006871 Ga0075434_102513383 Ga0075434_1025133832 96
254 3300006881 Ga0068865_100842986 Ga0068865_1008429861 96
255 3300006931 Ga0097620_100841345 Ga0097620_1008413452 96
256 3300006931 Ga0097620_102254798 Ga0097620_1022547982 96
257 3300007788 Ga0099795_10027278 Ga0099795_100272782 96
258 3300009011 Ga0105251_10060771 Ga0105251_100607712 96
259 3300009036 Ga0105244_10054841 Ga0105244_100548411 96
260 3300009036 Ga0105244_10402920 Ga0105244_104029202 96
261 3300009092 Ga0105250_10044883 Ga0105250_100448832 96
262 3300009093 Ga0105240_11066111 Ga0105240_110661112 96
263 3300009093 Ga0105240_11261216 Ga0105240_112612163 96
264 3300009098 Ga0105245_11536163 Ga0105245_115361632 96
265 3300009101 Ga0105247_10090321 Ga0105247_100903212 96
266 3300009101 Ga0105247_10144205 Ga0105247_101442051 96
267 3300009101 Ga0105247_10953698 Ga0105247_109536981 96
268 3300009101 Ga0105247_11320091 Ga0105247_113200911 96
269 3300009148 Ga0105243_10040584 Ga0105243_100405844 96
270 3300009148 Ga0105243_10216123 Ga0105243_102161232 96
271 3300009174 Ga0105241_11729418 Ga0105241_117294181 96
272 3300009174 Ga0105241_12500541 Ga0105241_125005411 96
273 3300009176 Ga0105242_12004301 Ga0105242_120043012 96
274 3300009177 Ga0105248_10410065 Ga0105248_104100652 96
275 3300009545 Ga0105237_12059341 Ga0105237_120593411 96
276 3300009551 Ga0105238_11295325 Ga0105238_112953252 96
277 3300009551 Ga0105238_11900665 Ga0105238_119006651 96
278 3300009553 Ga0105249_10291308 Ga0105249_102913081 96
279 3300009553 Ga0105249_12401354 Ga0105249_124013542 96
280 3300010159 Ga0099796_10061715 Ga0099796_100617151 96
281 3300010375 Ga0105239_10525534 Ga0105239_105255341 96
282 3300011119 Ga0105246_10644604 Ga0105246_106446042 96
283 3300011119 Ga0105246_10938471 Ga0105246_109384712 96
284 3300012481 Ga0157320_1041544 Ga0157320_10415442 96
285 3300012491 Ga0157329_1015323 Ga0157329_10153231 96
286 3300012515 Ga0157338_1068680 Ga0157338_10686801 96
287 3300013100 Ga0157373_10145383 Ga0157373_101453831 96
288 3300013102 Ga0157371_10228013 Ga0157371_102280131 96
289 3300013102 Ga0157371_11139426 Ga0157371_111394262 96
290 3300013104 Ga0157370_10289117 Ga0157370_102891173 96
291 3300013104 Ga0157370_11334386 Ga0157370_113343862 96
292 3300013105 Ga0157369_10116917 Ga0157369_101169174 96
293 3300013105 Ga0157369_11486388 Ga0157369_114863882 96
294 3300013297 Ga0157378_10275727 Ga0157378_102757271 96
295 3300013297 Ga0157378_12158829 Ga0157378_121588291 96
296 3300013306 Ga0163162_10124140 Ga0163162_101241403 96
297 3300013306 Ga0163162_12914471 Ga0163162_129144711 96
298 3300013307 Ga0157372_11920749 Ga0157372_119207492 96
299 3300013308 Ga0157375_11181100 Ga0157375_111811001 96
300 3300013308 Ga0157375_11192929 Ga0157375_111929292 96
301 3300014325 Ga0163163_10213060 Ga0163163_102130602 96
302 3300014326 Ga0157380_11075039 Ga0157380_110750391 96
303 3300014326 Ga0157380_12276950 Ga0157380_122769501 96
304 3300014326 Ga0157380_12959500 Ga0157380_129595002 96
305 3300014745 Ga0157377_11772043 Ga0157377_117720432 96
306 3300014968 Ga0157379_12185832 Ga0157379_121858322 96
307 3300014969 Ga0157376_12352288 Ga0157376_123522881 96
308 3300017792 Ga0163161_10220237 Ga0163161_102202371 96
309 3300017792 Ga0163161_10750994 Ga0163161_107509942 96
310 3300020070 Ga0206356_11099645 Ga0206356_110996452 96
311 3300020077 Ga0206351_10127246 Ga0206351_101272462 96
312 3300020077 Ga0206351_10824162 Ga0206351_108241621 96
313 3300020080 Ga0206350_10662476 Ga0206350_106624763 96
314 3300020082 Ga0206353_11968452 Ga0206353_119684522 96
315 3300020610 Ga0154015_1150379 Ga0154015_11503794 96
316 3300020610 Ga0154015_1608420 Ga0154015_16084202 96
317 3300020610 Ga0154015_1700357 Ga0154015_17003573 96
318 3300021361 Ga0213872_10098707 Ga0213872_100987072 96
319 3300021388 Ga0213875_10074650 Ga0213875_100746501 96
320 3300022467 Ga0224712_10087822 Ga0224712_100878221 96
321 3300025223 Ga0207672_1007470 Ga0207672_10074702 96
322 3300025227 Ga0207638_1000153 Ga0207638_10001533 96
323 3300025315 Ga0207697_10081555 Ga0207697_100815551 96
324 3300025321 Ga0207656_10556789 Ga0207656_105567891 96
325 3300025711 Ga0207696_1088706 Ga0207696_10887062 96
326 3300025728 Ga0207655_1220770 Ga0207655_12207702 96
327 3300025735 Ga0207713_1072531 Ga0207713_10725311 96
328 3300025885 Ga0207653_10037231 Ga0207653_100372312 96
329 3300025893 Ga0207682_10054880 Ga0207682_100548803 96
330 3300025898 Ga0207692_10156620 Ga0207692_101566202 96
331 3300025899 Ga0207642_10489724 Ga0207642_104897241 96
332 3300025900 Ga0207710_10112322 Ga0207710_101123221 96
333 3300025900 Ga0207710_10193742 Ga0207710_101937421 96
334 3300025901 Ga0207688_10082089 Ga0207688_100820892 96
335 3300025901 Ga0207688_10137274 Ga0207688_101372742 96
336 3300025903 Ga0207680_11011083 Ga0207680_110110831 96
337 3300025904 Ga0207647_10066317 Ga0207647_100663172 96
338 3300025904 Ga0207647_10103936 Ga0207647_101039362 96
339 3300025905 Ga0207685_10223007 Ga0207685_102230071 96
340 3300025907 Ga0207645_10040226 Ga0207645_100402263 96
341 3300025909 Ga0207705_10236433 Ga0207705_102364332 96
342 3300025914 Ga0207671_10287947 Ga0207671_102879471 96
343 3300025915 Ga0207693_10100059 Ga0207693_101000593 96
344 3300025915 Ga0207693_10247518 Ga0207693_102475182 96
345 3300025917 Ga0207660_10737579 Ga0207660_107375791 96
346 3300025918 Ga0207662_10071756 Ga0207662_100717562 96
347 3300025919 Ga0207657_10268813 Ga0207657_102688131 96
348 3300025920 Ga0207649_11217052 Ga0207649_112170521 96
349 3300025921 Ga0207652_10346752 Ga0207652_103467523 96
350 3300025921 Ga0207652_10374969 Ga0207652_103749691 96
351 3300025922 Ga0207646_10137071 Ga0207646_101370712 96
352 3300025923 Ga0207681_10312639 Ga0207681_103126392 96
353 3300025923 Ga0207681_10910270 Ga0207681_109102702 96
354 3300025924 Ga0207694_11047996 Ga0207694_110479961 96
355 3300025925 Ga0207650_10571097 Ga0207650_105710971 96
356 3300025926 Ga0207659_10309972 Ga0207659_103099722 96
357 3300025927 Ga0207687_10291042 Ga0207687_102910422 96
358 3300025928 Ga0207700_10993153 Ga0207700_109931532 96
359 3300025929 Ga0207664_10299382 Ga0207664_102993821 96
360 3300025931 Ga0207644_10258521 Ga0207644_102585212 96
361 3300025932 Ga0207690_10277951 Ga0207690_102779512 96
362 3300025932 Ga0207690_10384609 Ga0207690_103846091 96
363 3300025933 Ga0207706_10132435 Ga0207706_101324352 96
364 3300025934 Ga0207686_10248530 Ga0207686_102485302 96
365 3300025934 Ga0207686_11244904 Ga0207686_112449042 96
366 3300025935 Ga0207709_10229376 Ga0207709_102293762 96
367 3300025935 Ga0207709_10830388 Ga0207709_108303882 96
368 3300025936 Ga0207670_10277341 Ga0207670_102773412 96
369 3300025937 Ga0207669_10214206 Ga0207669_102142062 96
370 3300025937 Ga0207669_10243578 Ga0207669_102435782 96
371 3300025938 Ga0207704_10248668 Ga0207704_102486682 96
372 3300025938 Ga0207704_10306501 Ga0207704_103065012 96
373 3300025938 Ga0207704_11988361 Ga0207704_119883612 96
374 3300025939 Ga0207665_10038982 Ga0207665_100389823 96
375 3300025940 Ga0207691_10166282 Ga0207691_101662824 96
376 3300025940 Ga0207691_10580315 Ga0207691_105803152 96
377 3300025941 Ga0207711_10343439 Ga0207711_103434391 96
378 3300025941 Ga0207711_10745126 Ga0207711_107451261 96
379 3300025942 Ga0207689_10066870 Ga0207689_100668704 96
380 3300025942 Ga0207689_11580914 Ga0207689_115809141 96
381 3300025944 Ga0207661_10946473 Ga0207661_109464732 96
382 3300025945 Ga0207679_10086974 Ga0207679_100869742 96
383 3300025949 Ga0207667_10377234 Ga0207667_103772342 96
384 3300025949 Ga0207667_10740838 Ga0207667_107408382 96
385 3300025949 Ga0207667_11762610 Ga0207667_117626101 96
386 3300025960 Ga0207651_11219590 Ga0207651_112195901 96
387 3300025961 Ga0207712_10304370 Ga0207712_103043702 96
388 3300025961 Ga0207712_11319545 Ga0207712_113195452 96
389 3300025972 Ga0207668_10199084 Ga0207668_101990842 96
390 3300025972 Ga0207668_10628998 Ga0207668_106289981 96
391 3300025981 Ga0207640_10275253 Ga0207640_102752531 96
392 3300025986 Ga0207658_10676048 Ga0207658_106760481 96
393 3300025986 Ga0207658_11161765 Ga0207658_111617652 96
394 3300026023 Ga0207677_10312747 Ga0207677_103127471 96
395 3300026023 Ga0207677_10350918 Ga0207677_103509182 96
396 3300026041 Ga0207639_11400179 Ga0207639_114001791 96
397 3300026041 Ga0207639_11433245 Ga0207639_114332452 96
398 3300026067 Ga0207678_10060982 Ga0207678_100609823 96
399 3300026067 Ga0207678_10126317 Ga0207678_101263173 96
400 3300026075 Ga0207708_10058563 Ga0207708_100585633 96
401 3300026078 Ga0207702_10417970 Ga0207702_104179701 96
402 3300026078 Ga0207702_10583315 Ga0207702_105833152 96
403 3300026088 Ga0207641_10419221 Ga0207641_104192212 96
404 3300026088 Ga0207641_11656468 Ga0207641_116564682 96
405 3300026089 Ga0207648_10082259 Ga0207648_100822592 96
406 3300026095 Ga0207676_10388090 Ga0207676_103880902 96
407 3300026116 Ga0207674_10250405 Ga0207674_102504053 96
408 3300026116 Ga0207674_12219864 Ga0207674_122198642 96
409 3300026118 Ga0207675_100120172 Ga0207675_1001201721 96
410 3300026121 Ga0207683_10640147 Ga0207683_106401472 96
411 3300026121 Ga0207683_12031967 Ga0207683_120319671 96
412 3300026142 Ga0207698_10275068 Ga0207698_102750682 96
413 3300026142 Ga0207698_11333986 Ga0207698_113339862 96
414 3300027512 Ga0209179_1017980 Ga0209179_10179802 96
415 3300028379 Ga0268266_10355434 Ga0268266_103554341 96
416 3300028380 Ga0268265_10366655 Ga0268265_103666551 96
417 3300028381 Ga0268264_10415480 Ga0268264_104154801 96
418 3300028381 Ga0268264_12026609 Ga0268264_120266092 96
419 3300028558 Ga0265326_10201441 Ga0265326_102014411 96
420 3300028573 Ga0265334_10061749 Ga0265334_100617492 96
421 3300028577 Ga0265318_10044751 Ga0265318_100447513 96
422 3300028666 Ga0265336_10039803 Ga0265336_100398032 96
423 3300028800 Ga0265338_10071206 Ga0265338_100712065 96
424 3300031235 Ga0265330_10033908 Ga0265330_100339083 96
425 3300031240 Ga0265320_10113188 Ga0265320_101131882 96
426 3300031241 Ga0265325_10019975 Ga0265325_100199752 96
427 3300031247 Ga0265340_10098644 Ga0265340_100986442 96
428 3300031249 Ga0265339_10121880 Ga0265339_101218802 96
429 3300031250 Ga0265331_10153412 Ga0265331_101534122 96
430 3300031344 Ga0265316_10256572 Ga0265316_102565721 96
431 3300031456 Ga0307513_10056093 Ga0307513_100560934 96
432 3300031548 Ga0307408_100279968 Ga0307408_1002799683 96
433 3300031595 Ga0265313_10045990 Ga0265313_100459901 96
434 3300031649 Ga0307514_10300690 Ga0307514_103006902 96
435 3300031711 Ga0265314_10127269 Ga0265314_101272691 96
436 3300031712 Ga0265342_10062355 Ga0265342_100623552 96
437 3300031824 Ga0307413_11089330 Ga0307413_110893302 96
438 3300031824 Ga0307413_11922460 Ga0307413_119224602 96
439 3300031852 Ga0307410_11205264 Ga0307410_112052642 96
440 3300031903 Ga0307407_10103387 Ga0307407_101033872 96
441 3300031911 Ga0307412_10244790 Ga0307412_102447901 96
442 3300031995 Ga0307409_100184205 Ga0307409_1001842051 96
443 3300032002 Ga0307416_100328512 Ga0307416_1003285123 96
444 3300032004 Ga0307414_10821845 Ga0307414_108218452 96
445 3300032005 Ga0307411_10588495 Ga0307411_105884952 96
446 3300034816 Ga0373930_0033927 Ga0373930_0033927_35_325 96
447 3300034817 Ga0373948_0164388 Ga0373948_0164388_223_513 96
448 3300034818 Ga0373950_0019818 Ga0373950_0019818_790_1080 96
449 3300034818 Ga0373950_0117473 Ga0373950_0117473_83_373 96
450 3300034820 Ga0373959_0023941 Ga0373959_0023941_829_1119 96
451 3300034957 Ga0373938_0020755 Ga0373938_0020755_974_1264 96
452 3300035085 Ga0373929_0014861 Ga0373929_0014861_1022_1312 96
453 3300035088 Ga0373940_0050572 Ga0373940_0050572_104_394 96
454 3300035090 Ga0373949_0028601 Ga0373949_0028601_997_1287 96
455 3300035092 Ga0373952_0014194 Ga0373952_0014194_67_357 96
456 3300035092 Ga0373952_0021312 Ga0373952_0021312_974_1264 96
457 3300035112 Ga0373932_0048120 Ga0373932_0048120_928_1218 96
458 3300035112 Ga0373932_0125257 Ga0373932_0125257_205_495 96
459 3300035114 Ga0373939_0015306 Ga0373939_0015306_1529_1819 96
460 3300035114 Ga0373939_0092926 Ga0373939_0092926_138_428 96
461 3300035115 Ga0373941_0038204 Ga0373941_0038204_1048_1338 96
462 3300035121 Ga0373960_0004501 Ga0373960_0004501_666_956 96
463 3300035121 Ga0373960_0234204 Ga0373960_0234204_277_567 96
464 3300035207 Ga0373942_0068116 Ga0373942_0068116_666_956 96
465 3300035241 Ga0373961_0369529 Ga0373961_0369529_135_425 96
466 3300035242 Ga0373962_0038247 Ga0373962_0038247_1015_1305 96
467 3300035691 Ga0373931_0052933 Ga0373931_0052933_170_460 96
468 3300035691 Ga0373931_0156019 Ga0373931_0156019_130_420 96
469 3300037853 Ga0436364_0124370 Ga0436364_0124370_148_438 96
470 3300039447 Ga0436361_0521444 Ga0436361_0521444_1051_1341 96
471 3300039453 Ga0436362_0656493 Ga0436362_0656493_633_923 96
472 3300041459 Ga0451800_0771541 Ga0451800_0771541_644_934 96
473 3300041462 Ga0451806_714643 Ga0451806_714643_246_536 96
474 3300041509 Ga0451843_0348584 Ga0451843_0348584_926_1216 96
475 3300042993 Ga0439440_0227707 Ga0439440_0227707_101_391 96
476 3300044658 Ga0466972_0580419 Ga0466972_0580419_153_449 96
477 3300046455 Ga0495603_0108437 Ga0495603_0108437_1261_1554 96
478 3300046457 Ga0495590_0252187 Ga0495590_0252187_66_356 96
479 3300046459 Ga0495629_1046103 Ga0495629_1046103_11_301 96
480 3300046461 Ga0495641_0058220 Ga0495641_0058220_534_827 96
481 3300046472 Ga0495580_0171870 Ga0495580_0171870_1005_1298 96
482 3300046472 Ga0495580_0221368 Ga0495580_0221368_55_348 96
483 3300046473 Ga0495582_0088558 Ga0495582_0088558_1236_1529 96
484 3300046475 Ga0495639_0042681 Ga0495639_0042681_1403_1696 96
485 3300046491 Ga0495584_0081525 Ga0495584_0081525_173_463 96
486 3300046499 Ga0495594_0080833 Ga0495594_0080833_1140_1433 96
487 3300046499 Ga0495594_0147371 Ga0495594_0147371_105_395 96
488 3300046513 Ga0495616_0341366 Ga0495616_0341366_163_453 96
489 3300046515 Ga0495620_0067948 Ga0495620_0067948_378_668 96
490 3300046518 Ga0495631_0314486 Ga0495631_0314486_362_652 96
491 3300046519 Ga0495632_0523989 Ga0495632_0523989_210_500 96
492 3300046525 Ga0495663_0222149 Ga0495663_0222149_129_419 96
493 3300046526 Ga0495666_0060074 Ga0495666_0060074_1175_1468 96
494 3300046531 Ga0495665_0140667 Ga0495665_0140667_901_1194 96
495 3300046531 Ga0495665_0424262 Ga0495665_0424262_19_312 96
496 3300046557 Ga0495622_0268006 Ga0495622_0268006_77_370 96
497 3300046616 Ga0495668_0131607 Ga0495668_0131607_932_1222 96
498 3300046681 Ga0495647_0064966 Ga0495647_0064966_1100_1393 96
499 3300046681 Ga0495647_0590591 Ga0495647_0590591_120_413 96
500 3300046683 Ga0495658_0101956 Ga0495658_0101956_277_570 96
501 3300046683 Ga0495658_0808464 Ga0495658_0808464_239_529 96
502 3300046684 Ga0495669_0109460 Ga0495669_0109460_109_399 96
503 3300046690 Ga0495624_0565721 Ga0495624_0565721_53_346 96
504 3300046691 Ga0495670_0103756 Ga0495670_0103756_184_474 96
505 3300046692 Ga0495671_0473169 Ga0495671_0473169_284_574 96
506 3300047315 Ga0495581_0124860 Ga0495581_0124860_1157_1450 96
507 3300047320 Ga0495672_0121296 Ga0495672_0121296_86_376 96
508 3300047321 Ga0495676_0542327 Ga0495676_0542327_89_382 96
509 3300048903 Ga0496100_0128028 Ga0496100_0128028_1133_1423 96
510 3300048903 Ga0496100_0815144 Ga0496100_0815144_304_594 96
511 3300048905 Ga0496102_0460512 Ga0496102_0460512_732_1022 96
512 3300048906 Ga0496103_0933924 Ga0496103_0933924_119_409 96
513 3300048907 Ga0496104_0119740 Ga0496104_0119740_2128_2418 96
514 3300048907 Ga0496104_1238283 Ga0496104_1238283_310_603 96
515 3300048908 Ga0496105_0262963 Ga0496105_0262963_104_397 96
516 3300048909 Ga0496106_0304444 Ga0496106_0304444_932_1222 96
517 3300048909 Ga0496106_0456782 Ga0496106_0456782_68_433 96
518 3300048912 Ga0496109_0383306 Ga0496109_0383306_104_397 96
519 3300048912 Ga0496109_0510361 Ga0496109_0510361_704_994 96
520 3300048913 Ga0496110_1412563 Ga0496110_1412563_217_507 96
521 3300048914 Ga0496111_0065151 Ga0496111_0065151_2295_2585 96
522 3300048915 Ga0496112_0387234 Ga0496112_0387234_939_1229 96
523 3300048916 Ga0496113_0121140 Ga0496113_0121140_119_409 96
524 3300048917 Ga0496114_1554904 Ga0496114_1554904_84_374 96
525 3300048918 Ga0496115_0170941 Ga0496115_0170941_838_1128 96
526 3300048918 Ga0496115_0443914 Ga0496115_0443914_402_692 96
527 3300048922 Ga0496119_0371945 Ga0496119_0371945_329_619 96
528 3300048923 Ga0496120_0446376 Ga0496120_0446376_186_476 96
529 3300048929 Ga0496126_1287282 Ga0496126_1287282_122_412 96
530 3300049568 Ga0501031_0078107 Ga0501031_0078107_75_368 96
531 3300049568 Ga0501031_0163849 Ga0501031_0163849_108_398 96
532 3300049569 Ga0501032_0132811 Ga0501032_0132811_1002_1295 96
533 3300049569 Ga0501032_0172144 Ga0501032_0172144_135_425 96
534 3300049570 Ga0501033_0031585 Ga0501033_0031585_3637_3930 96
535 3300049570 Ga0501033_0205047 Ga0501033_0205047_76_366 96
536 3300049571 Ga0501034_0302655 Ga0501034_0302655_88_378 96
537 3300049571 Ga0501034_1394622 Ga0501034_1394622_140_433 96
538 3300049572 Ga0501036_0146601 Ga0501036_0146601_1590_1880 96
539 3300049573 Ga0501037_0164713 Ga0501037_0164713_267_557 96
540 3300049573 Ga0501037_0167701 Ga0501037_0167701_1213_1506 96
541 3300049574 Ga0501038_0197053 Ga0501038_0197053_1208_1501 96
542 3300049574 Ga0501038_0458340 Ga0501038_0458340_568_858 96
543 3300049574 Ga0501038_0777598 Ga0501038_0777598_169_459 96
544 3300049575 Ga0501039_0179954 Ga0501039_0179954_126_419 96
545 3300049575 Ga0501039_0873613 Ga0501039_0873613_302_592 96
546 3300049579 Ga0501043_0187526 Ga0501043_0187526_1120_1413 96
547 3300049579 Ga0501043_0259319 Ga0501043_0259319_986_1276 96
548 3300049580 Ga0501046_0188801 Ga0501046_0188801_209_499 96
549 3300049580 Ga0501046_0682328 Ga0501046_0682328_288_581 96
550 3300049581 Ga0501047_0203658 Ga0501047_0203658_1488_1781 96
551 3300049581 Ga0501047_0242088 Ga0501047_0242088_231_521 96
552 3300049582 Ga0501048_0181283 Ga0501048_0181283_675_965 96
553 3300049585 Ga0501069_0143450 Ga0501069_0143450_91_384 96
554 3300049586 Ga0501070_0003549 Ga0501070_0003549_1703_1993 96
555 3300049586 Ga0501070_0142184 Ga0501070_0142184_491_784 96
556 3300049586 Ga0501070_0257124 Ga0501070_0257124_34_336 96
557 3300049589 Ga0501073_0192574 Ga0501073_0192574_1048_1338 96
558 3300049589 Ga0501073_0224335 Ga0501073_0224335_109_399 96
559 3300049590 Ga0501074_0207629 Ga0501074_0207629_123_416 96
560 3300049590 Ga0501074_0248316 Ga0501074_0248316_54_347 96
561 3300049742 Ga0501080_0001972 Ga0501080_0001972_5913_6203 96
562 3300049822 Ga0501035_0021491 Ga0501035_0021491_4583_4873 96
563 3300049822 Ga0501035_0221432 Ga0501035_0221432_53_346 96
564 3300049823 Ga0501044_0037065 Ga0501044_0037065_339_629 96
565 3300049823 Ga0501044_0061790 Ga0501044_0061790_1953_2246 96
566 3300049823 Ga0501044_0321054 Ga0501044_0321054_920_1210 96
567 3300050491 nmdc:mga00v17_906517_c1 nmdc:mga00v17_906517_c1_131_421 96
568 3300050492 nmdc:mga0yw44_268358_c1 nmdc:mga0yw44_268358_c1_789_1079 96
569 3300050492 nmdc:mga0yw44_777746_c1 nmdc:mga0yw44_777746_c1_100_390 96
570 3300053083 Ga0495655_0108378 Ga0495655_0108378_120_410 96
571 3300053087 Ga0500643_035625 Ga0500643_035625_170_460 96
572 3300053156 Ga0500622_0027519 Ga0500622_0027519_77_367 96
573 3300053156 Ga0500622_0109273 Ga0500622_0109273_140_430 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

2

94

0.9

PF13384

HTH_23

Homeodomain-like domain

13

54

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pax-assembly1.cif.gz_A crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions 0.868 4 50
8b4h-assembly1.cif.gz_D ista transposase cleaved donor complex 0.855 7 45
1mdm-assembly1.cif.gz_A inhibited fragment of ets-1 and paired domain of pax5 bound to dna 0.8525 4 51
5vxn-assembly1.cif.gz_B structure of two rcsb dimers bound to two parallel dnas. 0.8383 13 53
1l3l-assembly2.cif.gz_C crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna 0.8318 13 53
ID Description Score Start End Superfamily
3f8mB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9162 25 52 1.10.10.10
af_A0A0P0Y3M7_58_149_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9081 6 46 1.10.472.10
af_O06371_1_115_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.88 11 46 1.10.10.60
6paxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.868 4 50 1.10.10.10
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8601 4 50 1.10.10.10
ID Description Score Start End GO Terms
AF-H0JKD6-F1-model_v4 Transposase of ISAar25, IS3 family, IS3 group, orfA 0.9677 1 48 GO:0003677
GO:0004803
GO:0006313
AF-A0A2A5B8Y1-F1-model_v4 Transposase 0.9597 1 46 GO:0003677
GO:0004803
GO:0006313
AF-F9PKP1-F1-model_v4 Transposase 0.9534 4 54 GO:0003677
GO:0004803
GO:0006313
AF-A0A6L5FCC8-F1-model_v4 Transposase 0.9496 1 54 GO:0003677
GO:0004803
GO:0006313
AF-A0A1X3L1X3-F1-model_v4 deleted 0.9487 1 56

Feature Viewer

pLDDT pTM Quality
90.62 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map