F465246
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 357 | 572 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0107661|Ga0501069_0107661_1063_1395 |
| Length | 110 |
| Sequence | MSESRKQYDYAFKAGAVRIVLETGQTVAQVARELDVNERTLAGWVQAAREGPEVGPDSGGRLLSRGKHGGGRELSKDAEIRRLRAEVEELRMERDVLKRSVVLWVKEATK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 115 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 116 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025227 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 212 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 270 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 271 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 272 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 273 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 274 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 275 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.25 |
| Metatranscriptomes | 1.57 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.24 |
| Nodule | 0 |
| Rhizoplane | 5.41 |
| Rhizosphere | 86.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1011574 | 3300000531 | Bacteria | 544 |
| 2 | LJQas_1001486 | 3300000549 | Bacteria | 3494 |
| 3 | JGI24736J21556_1014596 | 3300001904 | Bacteria | 1264 |
| 4 | JGI24741J21665_1014894 | 3300001915 | Bacteria | 1291 |
| 5 | JGI24741J21665_1015450 | 3300001915 | Bacteria | 1260 |
| 6 | JGI24752J21851_1009146 | 3300001976 | Bacteria | 1292 |
| 7 | JGI24740J21852_10042187 | 3300001979 | Bacteria | 1369 |
| 8 | JGI24740J21852_10174428 | 3300001979 | Bacteria | 533 |
| 9 | JGI24739J22299_10058528 | 3300001989 | Bacteria | 1223 |
| 10 | JGI24735J21928_10183692 | 3300002067 | Bacteria | 605 |
| 11 | JGI24738J21930_10014229 | 3300002075 | Bacteria | 1709 |
| 12 | JGI24749J21850_1013375 | 3300002076 | Bacteria | 1152 |
| 13 | JGI24744J21845_10004331 | 3300002077 | Bacteria | 2929 |
| 14 | JGI24744J21845_10090658 | 3300002077 | Bacteria | 561 |
| 15 | JGI24033J26618_1007147 | 3300002155 | Bacteria | 1264 |
| 16 | JGI24034J26672_10007726 | 3300002239 | Bacteria | 1565 |
| 17 | JGI24751J29686_10024078 | 3300002459 | Bacteria | 1262 |
| 18 | JGI24751J29686_10094652 | 3300002459 | Bacteria | 622 |
| 19 | rootH1_10053897 | 3300003323 | Unclassified | 1474 |
| 20 | rootH1_10252916 | 3300003323 | Bacteria | 2005 |
| 21 | Ga0065712_10031799 | 3300005290 | Bacteria | 893 |
| 22 | Ga0070658_10333962 | 3300005327 | Bacteria | 1296 |
| 23 | Ga0070658_10620771 | 3300005327 | Bacteria | 937 |
| 24 | Ga0070683_100395030 | 3300005329 | Bacteria | 1319 |
| 25 | Ga0070683_100411502 | 3300005329 | Bacteria | 1290 |
| 26 | Ga0070690_100965611 | 3300005330 | Bacteria | 670 |
| 27 | Ga0070670_101945290 | 3300005331 | Bacteria | 542 |
| 28 | Ga0070677_10415026 | 3300005333 | Bacteria | 712 |
| 29 | Ga0068869_100105382 | 3300005334 | Bacteria | 2138 |
| 30 | Ga0068869_100298511 | 3300005334 | Bacteria | 1300 |
| 31 | Ga0068869_100538371 | 3300005334 | Bacteria | 979 |
| 32 | Ga0070680_100253346 | 3300005336 | Bacteria | 1488 |
| 33 | Ga0070680_100259674 | 3300005336 | Bacteria | 1469 |
| 34 | Ga0070682_100229574 | 3300005337 | Bacteria | 1326 |
| 35 | Ga0070682_100441202 | 3300005337 | Bacteria | 995 |
| 36 | Ga0070682_100854148 | 3300005337 | Bacteria | 744 |
| 37 | Ga0070682_101955858 | 3300005337 | Bacteria | 515 |
| 38 | Ga0068868_100260641 | 3300005338 | Bacteria | 1462 |
| 39 | Ga0068868_102237611 | 3300005338 | Bacteria | 521 |
| 40 | Ga0070660_101336127 | 3300005339 | Bacteria | 608 |
| 41 | Ga0070689_101114961 | 3300005340 | Bacteria | 706 |
| 42 | Ga0070691_10508364 | 3300005341 | Bacteria | 697 |
| 43 | Ga0070661_101098424 | 3300005344 | Bacteria | 663 |
| 44 | Ga0070661_101733463 | 3300005344 | Bacteria | 529 |
| 45 | Ga0070668_100220973 | 3300005347 | Bacteria | 1562 |
| 46 | Ga0070671_101581393 | 3300005355 | Bacteria | 581 |
| 47 | Ga0070674_100139031 | 3300005356 | Bacteria | 1820 |
| 48 | Ga0070673_100618149 | 3300005364 | Bacteria | 989 |
| 49 | Ga0070688_100124208 | 3300005365 | Bacteria | 1733 |
| 50 | Ga0070659_100353607 | 3300005366 | Bacteria | 1233 |
| 51 | Ga0070659_101487605 | 3300005366 | Bacteria | 603 |
| 52 | Ga0070667_100157980 | 3300005367 | Bacteria | 1995 |
| 53 | Ga0070667_100494532 | 3300005367 | Bacteria | 1121 |
| 54 | Ga0070703_10407137 | 3300005406 | Bacteria | 593 |
| 55 | Ga0070709_10032131 | 3300005434 | Bacteria | 3163 |
| 56 | Ga0070709_10323464 | 3300005434 | Bacteria | 1132 |
| 57 | Ga0070714_100344906 | 3300005435 | Bacteria | 1397 |
| 58 | Ga0070713_100736471 | 3300005436 | Bacteria | 942 |
| 59 | Ga0070713_101628720 | 3300005436 | Unclassified | 626 |
| 60 | Ga0070710_10131788 | 3300005437 | Bacteria | 1525 |
| 61 | Ga0070710_10202979 | 3300005437 | Bacteria | 1253 |
| 62 | Ga0070701_10051684 | 3300005438 | Bacteria | 2132 |
| 63 | Ga0070711_100091075 | 3300005439 | Bacteria | 2197 |
| 64 | Ga0070711_100138873 | 3300005439 | Bacteria | 1819 |
| 65 | Ga0070711_100140716 | 3300005439 | Bacteria | 1809 |
| 66 | Ga0070711_100233973 | 3300005439 | Bacteria | 1434 |
| 67 | Ga0070705_100830986 | 3300005440 | Bacteria | 737 |
| 68 | Ga0070700_100512744 | 3300005441 | Bacteria | 925 |
| 69 | Ga0070694_101047112 | 3300005444 | Bacteria | 679 |
| 70 | Ga0070708_100251683 | 3300005445 | Bacteria | 1660 |
| 71 | Ga0070663_100156641 | 3300005455 | Bacteria | 1750 |
| 72 | Ga0070678_100264314 | 3300005456 | Bacteria | 1448 |
| 73 | Ga0070678_102034088 | 3300005456 | Bacteria | 544 |
| 74 | Ga0070681_10217925 | 3300005458 | Bacteria | 1824 |
| 75 | Ga0070685_10212452 | 3300005466 | Bacteria | 1263 |
| 76 | Ga0070706_100936928 | 3300005467 | Bacteria | 799 |
| 77 | Ga0070707_100781035 | 3300005468 | Bacteria | 919 |
| 78 | Ga0070707_102185678 | 3300005468 | Bacteria | 521 |
| 79 | Ga0070698_100357972 | 3300005471 | Bacteria | 1391 |
| 80 | Ga0070698_100897934 | 3300005471 | Bacteria | 832 |
| 81 | Ga0070698_101815416 | 3300005471 | Bacteria | 562 |
| 82 | Ga0070699_100250318 | 3300005518 | Bacteria | 1583 |
| 83 | Ga0070699_100391354 | 3300005518 | Bacteria | 1256 |
| 84 | Ga0070679_100325143 | 3300005530 | Bacteria | 1487 |
| 85 | Ga0070679_100679167 | 3300005530 | Bacteria | 972 |
| 86 | Ga0070684_100177227 | 3300005535 | Bacteria | 1937 |
| 87 | Ga0070684_101056549 | 3300005535 | Bacteria | 763 |
| 88 | Ga0070684_101354972 | 3300005535 | Bacteria | 670 |
| 89 | Ga0070697_100135953 | 3300005536 | Bacteria | 2064 |
| 90 | Ga0070697_100255784 | 3300005536 | Bacteria | 1498 |
| 91 | Ga0070697_100918061 | 3300005536 | Bacteria | 777 |
| 92 | Ga0068853_100689144 | 3300005539 | Bacteria | 974 |
| 93 | Ga0070672_101224727 | 3300005543 | Bacteria | 669 |
| 94 | Ga0070672_101929395 | 3300005543 | Bacteria | 532 |
| 95 | Ga0070672_102179744 | 3300005543 | Bacteria | 500 |
| 96 | Ga0070696_100272272 | 3300005546 | Bacteria | 1288 |
| 97 | Ga0070696_100645344 | 3300005546 | Bacteria | 858 |
| 98 | Ga0070665_101676125 | 3300005548 | Bacteria | 643 |
| 99 | Ga0070665_101840314 | 3300005548 | Bacteria | 612 |
| 100 | Ga0070704_101109899 | 3300005549 | Bacteria | 719 |
| 101 | Ga0068855_100479377 | 3300005563 | Bacteria | 1354 |
| 102 | Ga0068855_101129371 | 3300005563 | Bacteria | 818 |
| 103 | Ga0070664_100402418 | 3300005564 | Bacteria | 1252 |
| 104 | Ga0068857_100397824 | 3300005577 | Bacteria | 1281 |
| 105 | Ga0068857_100937161 | 3300005577 | Bacteria | 831 |
| 106 | Ga0068856_100502880 | 3300005614 | Bacteria | 1233 |
| 107 | Ga0068856_100891110 | 3300005614 | Bacteria | 908 |
| 108 | Ga0070702_101215703 | 3300005615 | Bacteria | 608 |
| 109 | Ga0068852_100206930 | 3300005616 | Bacteria | 1859 |
| 110 | Ga0068852_100326940 | 3300005616 | Bacteria | 1491 |
| 111 | Ga0068852_102761088 | 3300005616 | Bacteria | 510 |
| 112 | Ga0068859_100841444 | 3300005617 | Bacteria | 1004 |
| 113 | Ga0068859_102255135 | 3300005617 | Bacteria | 601 |
| 114 | Ga0068851_10719631 | 3300005834 | Bacteria | 615 |
| 115 | Ga0068870_11391173 | 3300005840 | Bacteria | 514 |
| 116 | Ga0068863_102220838 | 3300005841 | Bacteria | 559 |
| 117 | Ga0068860_102153739 | 3300005843 | Bacteria | 579 |
| 118 | Ga0081455_10782811 | 3300005937 | Bacteria | 600 |
| 119 | Ga0081539_10014068 | 3300005985 | Bacteria | 5955 |
| 120 | Ga0070717_10471921 | 3300006028 | Bacteria | 1132 |
| 121 | Ga0070717_11062494 | 3300006028 | Bacteria | 737 |
| 122 | Ga0075365_10011120 | 3300006038 | Bacteria | 5280 |
| 123 | Ga0075365_10159281 | 3300006038 | Bacteria | 1572 |
| 124 | Ga0075365_10349796 | 3300006038 | Bacteria | 1042 |
| 125 | Ga0075365_10992522 | 3300006038 | Bacteria | 592 |
| 126 | Ga0075365_11031371 | 3300006038 | Bacteria | 579 |
| 127 | Ga0075368_10088339 | 3300006042 | Bacteria | 1266 |
| 128 | Ga0075363_100196243 | 3300006048 | Bacteria | 1152 |
| 129 | Ga0075364_10353011 | 3300006051 | Bacteria | 1002 |
| 130 | Ga0070715_10087964 | 3300006163 | Bacteria | 1423 |
| 131 | Ga0070715_10756686 | 3300006163 | Bacteria | 586 |
| 132 | Ga0070712_100185010 | 3300006175 | Bacteria | 1626 |
| 133 | Ga0070712_100226901 | 3300006175 | Bacteria | 1481 |
| 134 | Ga0070712_100262758 | 3300006175 | Bacteria | 1384 |
| 135 | Ga0070712_101579374 | 3300006175 | Bacteria | 574 |
| 136 | Ga0070712_101778353 | 3300006175 | Bacteria | 540 |
| 137 | Ga0075362_10003608 | 3300006177 | Bacteria | 5443 |
| 138 | Ga0075369_10170199 | 3300006186 | Bacteria | 1000 |
| 139 | Ga0097621_101364032 | 3300006237 | Bacteria | 671 |
| 140 | Ga0075370_10046227 | 3300006353 | Bacteria | 2463 |
| 141 | Ga0068871_101217842 | 3300006358 | Bacteria | 706 |
| 142 | Ga0075428_101260186 | 3300006844 | Bacteria | 778 |
| 143 | Ga0075428_102453156 | 3300006844 | Bacteria | 535 |
| 144 | Ga0075431_100461742 | 3300006847 | Bacteria | 1264 |
| 145 | Ga0075434_102513383 | 3300006871 | Bacteria | 516 |
| 146 | Ga0068865_100365800 | 3300006881 | Bacteria | 1172 |
| 147 | Ga0068865_100842986 | 3300006881 | Bacteria | 794 |
| 148 | Ga0068865_101564622 | 3300006881 | Bacteria | 592 |
| 149 | Ga0097620_100841345 | 3300006931 | Bacteria | 1004 |
| 150 | Ga0097620_102254798 | 3300006931 | Bacteria | 601 |
| 151 | Ga0099795_10027278 | 3300007788 | Bacteria | 1931 |
| 152 | Ga0105251_10060771 | 3300009011 | Bacteria | 1778 |
| 153 | Ga0105244_10054841 | 3300009036 | Bacteria | 2021 |
| 154 | Ga0105244_10402920 | 3300009036 | Bacteria | 629 |
| 155 | Ga0105250_10044883 | 3300009092 | Bacteria | 1772 |
| 156 | Ga0105240_11066111 | 3300009093 | Bacteria | 861 |
| 157 | Ga0105240_11261216 | 3300009093 | Bacteria | 781 |
| 158 | Ga0111539_10755061 | 3300009094 | Bacteria | 1132 |
| 159 | Ga0105245_10536725 | 3300009098 | Bacteria | 1190 |
| 160 | Ga0105245_11536163 | 3300009098 | Bacteria | 717 |
| 161 | Ga0105245_12117638 | 3300009098 | Bacteria | 616 |
| 162 | Ga0105247_10001194 | 3300009101 | Bacteria | 19309 |
| 163 | Ga0105247_10090321 | 3300009101 | Bacteria | 1943 |
| 164 | Ga0105247_10144205 | 3300009101 | Bacteria | 1563 |
| 165 | Ga0105247_10953698 | 3300009101 | Bacteria | 666 |
| 166 | Ga0105247_11320091 | 3300009101 | Bacteria | 580 |
| 167 | Ga0105247_11375329 | 3300009101 | Bacteria | 570 |
| 168 | Ga0114129_12583789 | 3300009147 | Bacteria | 606 |
| 169 | Ga0105243_10040584 | 3300009148 | Bacteria | 3635 |
| 170 | Ga0105243_10216123 | 3300009148 | Bacteria | 1691 |
| 171 | Ga0105243_10515441 | 3300009148 | Bacteria | 1136 |
| 172 | Ga0105241_11729418 | 3300009174 | Bacteria | 608 |
| 173 | Ga0105241_12500541 | 3300009174 | Bacteria | 517 |
| 174 | Ga0105242_10225814 | 3300009176 | Bacteria | 1676 |
| 175 | Ga0105242_12004301 | 3300009176 | Bacteria | 621 |
| 176 | Ga0105248_10410065 | 3300009177 | Bacteria | 1526 |
| 177 | Ga0105248_10823755 | 3300009177 | Bacteria | 1047 |
| 178 | Ga0105237_12059341 | 3300009545 | Bacteria | 580 |
| 179 | Ga0105238_11295325 | 3300009551 | Bacteria | 754 |
| 180 | Ga0105238_11318210 | 3300009551 | Bacteria | 748 |
| 181 | Ga0105238_11900665 | 3300009551 | Bacteria | 628 |
| 182 | Ga0105249_10291308 | 3300009553 | Bacteria | 1634 |
| 183 | Ga0105249_11971766 | 3300009553 | Bacteria | 657 |
| 184 | Ga0105249_12246313 | 3300009553 | Bacteria | 618 |
| 185 | Ga0105249_12401354 | 3300009553 | Bacteria | 600 |
| 186 | Ga0099796_10061715 | 3300010159 | Bacteria | 1330 |
| 187 | Ga0105239_10334387 | 3300010375 | Bacteria | 1709 |
| 188 | Ga0105239_10525534 | 3300010375 | Bacteria | 1346 |
| 189 | Ga0105239_11750252 | 3300010375 | Bacteria | 720 |
| 190 | Ga0105246_10644604 | 3300011119 | Bacteria | 921 |
| 191 | Ga0105246_10938471 | 3300011119 | Bacteria | 779 |
| 192 | Ga0157320_1041544 | 3300012481 | Bacteria | 500 |
| 193 | Ga0157329_1015323 | 3300012491 | Bacteria | 661 |
| 194 | Ga0157338_1068680 | 3300012515 | Bacteria | 548 |
| 195 | Ga0157373_10145383 | 3300013100 | Bacteria | 1668 |
| 196 | Ga0157371_10228013 | 3300013102 | Bacteria | 1338 |
| 197 | Ga0157371_11139426 | 3300013102 | Bacteria | 599 |
| 198 | Ga0157370_10289117 | 3300013104 | Bacteria | 1514 |
| 199 | Ga0157370_11334386 | 3300013104 | Bacteria | 646 |
| 200 | Ga0157369_10116917 | 3300013105 | Bacteria | 2831 |
| 201 | Ga0157369_10731174 | 3300013105 | Bacteria | 1019 |
| 202 | Ga0157369_11486388 | 3300013105 | Bacteria | 689 |
| 203 | Ga0157378_10275727 | 3300013297 | Bacteria | 1619 |
| 204 | Ga0157378_12158829 | 3300013297 | Bacteria | 608 |
| 205 | Ga0163162_10124140 | 3300013306 | Bacteria | 2687 |
| 206 | Ga0163162_12471429 | 3300013306 | Bacteria | 597 |
| 207 | Ga0163162_12914471 | 3300013306 | Bacteria | 550 |
| 208 | Ga0157372_11920749 | 3300013307 | Bacteria | 680 |
| 209 | Ga0157375_11181100 | 3300013308 | Bacteria | 897 |
| 210 | Ga0157375_11192929 | 3300013308 | Bacteria | 893 |
| 211 | Ga0163163_10213060 | 3300014325 | Bacteria | 1981 |
| 212 | Ga0163163_12977207 | 3300014325 | Bacteria | 528 |
| 213 | Ga0157380_11075039 | 3300014326 | Bacteria | 842 |
| 214 | Ga0157380_12276950 | 3300014326 | Bacteria | 606 |
| 215 | Ga0157380_12959500 | 3300014326 | Bacteria | 541 |
| 216 | Ga0157377_11772043 | 3300014745 | Bacteria | 500 |
| 217 | Ga0157379_11486759 | 3300014968 | Bacteria | 659 |
| 218 | Ga0157379_12185832 | 3300014968 | Bacteria | 549 |
| 219 | Ga0157376_11599279 | 3300014969 | Bacteria | 686 |
| 220 | Ga0157376_12352288 | 3300014969 | Bacteria | 572 |
| 221 | Ga0163161_10220237 | 3300017792 | Bacteria | 1469 |
| 222 | Ga0163161_10640764 | 3300017792 | Bacteria | 880 |
| 223 | Ga0163161_10750994 | 3300017792 | Bacteria | 816 |
| 224 | Ga0206356_11099645 | 3300020070 | Bacteria | 1310 |
| 225 | Ga0206351_10127246 | 3300020077 | Bacteria | 1459 |
| 226 | Ga0206351_10824162 | 3300020077 | Bacteria | 970 |
| 227 | Ga0206350_10662476 | 3300020080 | Bacteria | 2269 |
| 228 | Ga0206353_11968452 | 3300020082 | Bacteria | 1142 |
| 229 | Ga0154015_1150379 | 3300020610 | Bacteria | 2342 |
| 230 | Ga0154015_1608420 | 3300020610 | Bacteria | 1822 |
| 231 | Ga0154015_1700357 | 3300020610 | Bacteria | 1469 |
| 232 | Ga0213872_10098707 | 3300021361 | Bacteria | 1303 |
| 233 | Ga0213875_10074650 | 3300021388 | Bacteria | 1582 |
| 234 | Ga0224712_10087822 | 3300022467 | Bacteria | 1296 |
| 235 | Ga0207672_1007470 | 3300025223 | Bacteria | 638 |
| 236 | Ga0207638_1000153 | 3300025227 | Bacteria | 1478 |
| 237 | Ga0207697_10081555 | 3300025315 | Bacteria | 1363 |
| 238 | Ga0207656_10332155 | 3300025321 | Bacteria | 756 |
| 239 | Ga0207656_10556789 | 3300025321 | Bacteria | 584 |
| 240 | Ga0207696_1088706 | 3300025711 | Bacteria | 849 |
| 241 | Ga0207655_1220770 | 3300025728 | Bacteria | 553 |
| 242 | Ga0207713_1072531 | 3300025735 | Bacteria | 1267 |
| 243 | Ga0207653_10037231 | 3300025885 | Bacteria | 1586 |
| 244 | Ga0207682_10054880 | 3300025893 | Bacteria | 1656 |
| 245 | Ga0207692_10156620 | 3300025898 | Bacteria | 1309 |
| 246 | Ga0207692_10160095 | 3300025898 | Bacteria | 1297 |
| 247 | Ga0207642_10489724 | 3300025899 | Bacteria | 751 |
| 248 | Ga0207710_10000174 | 3300025900 | Bacteria | 65752 |
| 249 | Ga0207710_10112322 | 3300025900 | Bacteria | 1295 |
| 250 | Ga0207710_10193742 | 3300025900 | Bacteria | 1001 |
| 251 | Ga0207688_10082089 | 3300025901 | Bacteria | 1842 |
| 252 | Ga0207688_10137274 | 3300025901 | Bacteria | 1437 |
| 253 | Ga0207680_11011083 | 3300025903 | Bacteria | 595 |
| 254 | Ga0207647_10066317 | 3300025904 | Bacteria | 2189 |
| 255 | Ga0207647_10103936 | 3300025904 | Bacteria | 1684 |
| 256 | Ga0207685_10223007 | 3300025905 | Bacteria | 898 |
| 257 | Ga0207699_10294836 | 3300025906 | Bacteria | 1131 |
| 258 | Ga0207645_10040226 | 3300025907 | Bacteria | 2994 |
| 259 | Ga0207705_10236433 | 3300025909 | Bacteria | 1391 |
| 260 | Ga0207671_10287947 | 3300025914 | Bacteria | 1297 |
| 261 | Ga0207693_10100059 | 3300025915 | Bacteria | 2273 |
| 262 | Ga0207693_10173266 | 3300025915 | Unclassified | 1698 |
| 263 | Ga0207693_10247518 | 3300025915 | Bacteria | 1399 |
| 264 | Ga0207693_10254515 | 3300025915 | Bacteria | 1377 |
| 265 | Ga0207693_10503343 | 3300025915 | Bacteria | 945 |
| 266 | Ga0207663_10311884 | 3300025916 | Bacteria | 1179 |
| 267 | Ga0207660_10737579 | 3300025917 | Bacteria | 804 |
| 268 | Ga0207662_10071756 | 3300025918 | Bacteria | 2097 |
| 269 | Ga0207657_10268813 | 3300025919 | Bacteria | 1356 |
| 270 | Ga0207649_11217052 | 3300025920 | Bacteria | 595 |
| 271 | Ga0207652_10346752 | 3300025921 | Bacteria | 1340 |
| 272 | Ga0207652_10374969 | 3300025921 | Bacteria | 1284 |
| 273 | Ga0207646_10137071 | 3300025922 | Bacteria | 2204 |
| 274 | Ga0207681_10312639 | 3300025923 | Bacteria | 1246 |
| 275 | Ga0207681_10910270 | 3300025923 | Bacteria | 737 |
| 276 | Ga0207694_11047996 | 3300025924 | Bacteria | 690 |
| 277 | Ga0207650_10571097 | 3300025925 | Bacteria | 949 |
| 278 | Ga0207659_10309972 | 3300025926 | Bacteria | 1299 |
| 279 | Ga0207687_10291042 | 3300025927 | Bacteria | 1313 |
| 280 | Ga0207687_10801815 | 3300025927 | Bacteria | 803 |
| 281 | Ga0207700_10337077 | 3300025928 | Bacteria | 1310 |
| 282 | Ga0207700_10993153 | 3300025928 | Bacteria | 751 |
| 283 | Ga0207664_10299382 | 3300025929 | Bacteria | 1415 |
| 284 | Ga0207664_10307968 | 3300025929 | Bacteria | 1395 |
| 285 | Ga0207644_10258521 | 3300025931 | Bacteria | 1391 |
| 286 | Ga0207690_10277951 | 3300025932 | Bacteria | 1303 |
| 287 | Ga0207690_10384609 | 3300025932 | Bacteria | 1116 |
| 288 | Ga0207690_11673803 | 3300025932 | Bacteria | 532 |
| 289 | Ga0207706_10132435 | 3300025933 | Bacteria | 2193 |
| 290 | Ga0207706_11218745 | 3300025933 | Bacteria | 625 |
| 291 | Ga0207686_10163131 | 3300025934 | Bacteria | 1564 |
| 292 | Ga0207686_10248530 | 3300025934 | Bacteria | 1298 |
| 293 | Ga0207686_11244904 | 3300025934 | Bacteria | 610 |
| 294 | Ga0207709_10168136 | 3300025935 | Bacteria | 1536 |
| 295 | Ga0207709_10229376 | 3300025935 | Bacteria | 1344 |
| 296 | Ga0207709_10830388 | 3300025935 | Bacteria | 748 |
| 297 | Ga0207670_10277341 | 3300025936 | Bacteria | 1305 |
| 298 | Ga0207670_10693799 | 3300025936 | Bacteria | 842 |
| 299 | Ga0207669_10214206 | 3300025937 | Bacteria | 1408 |
| 300 | Ga0207669_10243578 | 3300025937 | Bacteria | 1334 |
| 301 | Ga0207704_10248668 | 3300025938 | Bacteria | 1333 |
| 302 | Ga0207704_10306501 | 3300025938 | Bacteria | 1219 |
| 303 | Ga0207704_10522533 | 3300025938 | Bacteria | 960 |
| 304 | Ga0207704_11988361 | 3300025938 | Bacteria | 500 |
| 305 | Ga0207665_10038982 | 3300025939 | Bacteria | 3166 |
| 306 | Ga0207691_10166282 | 3300025940 | Bacteria | 1933 |
| 307 | Ga0207691_10580315 | 3300025940 | Bacteria | 950 |
| 308 | Ga0207711_10343439 | 3300025941 | Bacteria | 1382 |
| 309 | Ga0207711_10745126 | 3300025941 | Bacteria | 913 |
| 310 | Ga0207711_11083111 | 3300025941 | Bacteria | 742 |
| 311 | Ga0207689_10066870 | 3300025942 | Bacteria | 2954 |
| 312 | Ga0207689_11580914 | 3300025942 | Bacteria | 546 |
| 313 | Ga0207661_10946473 | 3300025944 | Bacteria | 793 |
| 314 | Ga0207679_10086974 | 3300025945 | Bacteria | 2405 |
| 315 | Ga0207667_10377234 | 3300025949 | Bacteria | 1445 |
| 316 | Ga0207667_10740838 | 3300025949 | Bacteria | 983 |
| 317 | Ga0207667_11762610 | 3300025949 | Bacteria | 584 |
| 318 | Ga0207651_11219590 | 3300025960 | Bacteria | 675 |
| 319 | Ga0207712_10304370 | 3300025961 | Bacteria | 1310 |
| 320 | Ga0207712_11319545 | 3300025961 | Bacteria | 645 |
| 321 | Ga0207668_10199084 | 3300025972 | Bacteria | 1593 |
| 322 | Ga0207668_10628998 | 3300025972 | Bacteria | 937 |
| 323 | Ga0207640_10275253 | 3300025981 | Bacteria | 1319 |
| 324 | Ga0207658_10676048 | 3300025986 | Bacteria | 932 |
| 325 | Ga0207658_11161765 | 3300025986 | Bacteria | 705 |
| 326 | Ga0207658_11931440 | 3300025986 | Bacteria | 537 |
| 327 | Ga0207677_10312747 | 3300026023 | Bacteria | 1302 |
| 328 | Ga0207677_10350918 | 3300026023 | Bacteria | 1236 |
| 329 | Ga0207639_11400179 | 3300026041 | Bacteria | 656 |
| 330 | Ga0207639_11433245 | 3300026041 | Bacteria | 648 |
| 331 | Ga0207678_10060982 | 3300026067 | Bacteria | 3243 |
| 332 | Ga0207678_10126317 | 3300026067 | Bacteria | 2182 |
| 333 | Ga0207708_10058563 | 3300026075 | Bacteria | 2939 |
| 334 | Ga0207702_10417970 | 3300026078 | Bacteria | 1296 |
| 335 | Ga0207702_10583315 | 3300026078 | Bacteria | 1096 |
| 336 | Ga0207641_10419221 | 3300026088 | Bacteria | 1288 |
| 337 | Ga0207641_11656468 | 3300026088 | Bacteria | 642 |
| 338 | Ga0207648_10082259 | 3300026089 | Bacteria | 2808 |
| 339 | Ga0207676_10388090 | 3300026095 | Bacteria | 1301 |
| 340 | Ga0207674_10250405 | 3300026116 | Bacteria | 1719 |
| 341 | Ga0207674_12219864 | 3300026116 | Bacteria | 512 |
| 342 | Ga0207675_100120172 | 3300026118 | Bacteria | 2485 |
| 343 | Ga0207683_10640147 | 3300026121 | Bacteria | 985 |
| 344 | Ga0207683_12031967 | 3300026121 | Bacteria | 523 |
| 345 | Ga0207698_10275068 | 3300026142 | Bacteria | 1554 |
| 346 | Ga0207698_11333986 | 3300026142 | Bacteria | 732 |
| 347 | Ga0209179_1017980 | 3300027512 | Bacteria | 1346 |
| 348 | Ga0209813_10038555 | 3300027866 | Bacteria | 1445 |
| 349 | Ga0268266_10355434 | 3300028379 | Bacteria | 1377 |
| 350 | Ga0268265_10366655 | 3300028380 | Bacteria | 1320 |
| 351 | Ga0268264_10415480 | 3300028381 | Bacteria | 1296 |
| 352 | Ga0268264_12026609 | 3300028381 | Bacteria | 585 |
| 353 | Ga0265326_10201441 | 3300028558 | Bacteria | 572 |
| 354 | Ga0265334_10061749 | 3300028573 | Bacteria | 1411 |
| 355 | Ga0265318_10044751 | 3300028577 | Bacteria | 1674 |
| 356 | Ga0265336_10039803 | 3300028666 | Bacteria | 1440 |
| 357 | Ga0265338_10071206 | 3300028800 | Bacteria | 2976 |
| 358 | Ga0265338_10364433 | 3300028800 | Bacteria | 1036 |
| 359 | Ga0265330_10033908 | 3300031235 | Bacteria | 2281 |
| 360 | Ga0265332_10077431 | 3300031238 | Bacteria | 1412 |
| 361 | Ga0265320_10113188 | 3300031240 | Bacteria | 1241 |
| 362 | Ga0265325_10019975 | 3300031241 | Bacteria | 3696 |
| 363 | Ga0265340_10098644 | 3300031247 | Bacteria | 1359 |
| 364 | Ga0265339_10121880 | 3300031249 | Bacteria | 1339 |
| 365 | Ga0265331_10153412 | 3300031250 | Bacteria | 1045 |
| 366 | Ga0265327_10110587 | 3300031251 | Bacteria | 1313 |
| 367 | Ga0265316_10256572 | 3300031344 | Bacteria | 1282 |
| 368 | Ga0307513_10056093 | 3300031456 | Bacteria | 4209 |
| 369 | Ga0307408_100236173 | 3300031548 | Bacteria | 1500 |
| 370 | Ga0307408_100279968 | 3300031548 | Bacteria | 1389 |
| 371 | Ga0265313_10045990 | 3300031595 | Bacteria | 2121 |
| 372 | Ga0307514_10300690 | 3300031649 | Bacteria | 899 |
| 373 | Ga0265314_10127269 | 3300031711 | Bacteria | 1593 |
| 374 | Ga0265314_10150863 | 3300031711 | Bacteria | 1425 |
| 375 | Ga0265342_10062355 | 3300031712 | Bacteria | 2194 |
| 376 | Ga0307405_10851810 | 3300031731 | Bacteria | 767 |
| 377 | Ga0307413_10724908 | 3300031824 | Bacteria | 828 |
| 378 | Ga0307413_11089330 | 3300031824 | Bacteria | 689 |
| 379 | Ga0307413_11922460 | 3300031824 | Bacteria | 532 |
| 380 | Ga0307410_10095837 | 3300031852 | Bacteria | 2116 |
| 381 | Ga0307410_11205264 | 3300031852 | Bacteria | 659 |
| 382 | Ga0307406_10084547 | 3300031901 | Bacteria | 2119 |
| 383 | Ga0307406_10285896 | 3300031901 | Bacteria | 1260 |
| 384 | Ga0307407_10103387 | 3300031903 | Bacteria | 1773 |
| 385 | Ga0307407_10191155 | 3300031903 | Bacteria | 1364 |
| 386 | Ga0307412_10244790 | 3300031911 | Bacteria | 1389 |
| 387 | Ga0307409_100012519 | 3300031995 | Bacteria | 5410 |
| 388 | Ga0307409_100184205 | 3300031995 | Bacteria | 1852 |
| 389 | Ga0307409_100356335 | 3300031995 | Bacteria | 1382 |
| 390 | Ga0307409_101850884 | 3300031995 | Bacteria | 633 |
| 391 | Ga0307416_100328512 | 3300032002 | Bacteria | 1535 |
| 392 | Ga0307416_102323264 | 3300032002 | Bacteria | 636 |
| 393 | Ga0307416_103614155 | 3300032002 | Bacteria | 517 |
| 394 | Ga0307414_10447210 | 3300032004 | Bacteria | 1132 |
| 395 | Ga0307414_10821845 | 3300032004 | Bacteria | 848 |
| 396 | Ga0307411_10588495 | 3300032005 | Bacteria | 955 |
| 397 | Ga0307411_12134295 | 3300032005 | Bacteria | 524 |
| 398 | Ga0307415_100139650 | 3300032126 | Bacteria | 1848 |
| 399 | Ga0307415_101676142 | 3300032126 | Bacteria | 612 |
| 400 | Ga0373930_0033927 | 3300034816 | Bacteria | 1061 |
| 401 | Ga0373948_0164388 | 3300034817 | Bacteria | 561 |
| 402 | Ga0373950_0019818 | 3300034818 | Bacteria | 1178 |
| 403 | Ga0373950_0117473 | 3300034818 | Bacteria | 586 |
| 404 | Ga0373959_0023941 | 3300034820 | Bacteria | 1190 |
| 405 | Ga0373938_0020755 | 3300034957 | Bacteria | 1326 |
| 406 | Ga0373929_0014861 | 3300035085 | Bacteria | 1508 |
| 407 | Ga0373940_0050572 | 3300035088 | Bacteria | 1166 |
| 408 | Ga0373949_0028601 | 3300035090 | Bacteria | 1316 |
| 409 | Ga0373952_0014194 | 3300035092 | Bacteria | 1591 |
| 410 | Ga0373952_0021312 | 3300035092 | Bacteria | 1367 |
| 411 | Ga0373932_0048120 | 3300035112 | Bacteria | 1255 |
| 412 | Ga0373932_0125257 | 3300035112 | Bacteria | 861 |
| 413 | Ga0373939_0015306 | 3300035114 | Bacteria | 2005 |
| 414 | Ga0373939_0092926 | 3300035114 | Bacteria | 1022 |
| 415 | Ga0373941_0038204 | 3300035115 | Bacteria | 1468 |
| 416 | Ga0373960_0004501 | 3300035121 | Bacteria | 3200 |
| 417 | Ga0373960_0234204 | 3300035121 | Bacteria | 661 |
| 418 | Ga0373942_0068116 | 3300035207 | Bacteria | 1033 |
| 419 | Ga0373961_0369529 | 3300035241 | Bacteria | 544 |
| 420 | Ga0373962_0038247 | 3300035242 | Bacteria | 1342 |
| 421 | Ga0373931_0052933 | 3300035691 | Bacteria | 2165 |
| 422 | Ga0373931_0156019 | 3300035691 | Bacteria | 1334 |
| 423 | Ga0395899_0934890 | 3300037312 | Bacteria | 527 |
| 424 | Ga0395898_1034962 | 3300037466 | Bacteria | 756 |
| 425 | Ga0436364_0124370 | 3300037853 | Bacteria | 1704 |
| 426 | Ga0395901_0924865 | 3300038443 | Bacteria | 852 |
| 427 | Ga0436365_0101565 | 3300039437 | Bacteria | 611 |
| 428 | Ga0436361_0521444 | 3300039447 | Bacteria | 3558 |
| 429 | Ga0436362_0656493 | 3300039453 | Bacteria | 1412 |
| 430 | Ga0451793_0688899 | 3300041452 | Bacteria | 519 |
| 431 | Ga0451800_0771541 | 3300041459 | Bacteria | 960 |
| 432 | Ga0451806_714643 | 3300041462 | Bacteria | 562 |
| 433 | Ga0451843_0348584 | 3300041509 | Bacteria | 1516 |
| 434 | Ga0451843_0517588 | 3300041509 | Bacteria | 1063 |
| 435 | Ga0451853_0183895 | 3300041512 | Bacteria | 808 |
| 436 | Ga0439451_052650 | 3300042009 | Bacteria | 815 |
| 437 | Ga0450902_043385 | 3300042137 | Bacteria | 767 |
| 438 | Ga0439435_0018736 | 3300042436 | Bacteria | 1765 |
| 439 | Ga0439440_0227707 | 3300042993 | Bacteria | 561 |
| 440 | Ga0466972_0580419 | 3300044658 | Bacteria | 529 |
| 441 | Ga0466958_0101224 | 3300045836 | Bacteria | 1792 |
| 442 | Ga0495603_0108437 | 3300046455 | Bacteria | 1620 |
| 443 | Ga0495590_0252187 | 3300046457 | Bacteria | 657 |
| 444 | Ga0495629_1046103 | 3300046459 | Bacteria | 530 |
| 445 | Ga0495641_0058220 | 3300046461 | Bacteria | 1748 |
| 446 | Ga0495580_0171870 | 3300046472 | Bacteria | 1498 |
| 447 | Ga0495580_0221368 | 3300046472 | Bacteria | 1300 |
| 448 | Ga0495582_0088558 | 3300046473 | Bacteria | 1724 |
| 449 | Ga0495639_0042681 | 3300046475 | Bacteria | 2047 |
| 450 | Ga0495584_0081525 | 3300046491 | Bacteria | 1629 |
| 451 | Ga0495594_0080833 | 3300046499 | Bacteria | 1814 |
| 452 | Ga0495594_0147371 | 3300046499 | Bacteria | 1336 |
| 453 | Ga0495616_0341366 | 3300046513 | Bacteria | 625 |
| 454 | Ga0495620_0067948 | 3300046515 | Bacteria | 1465 |
| 455 | Ga0495631_0314486 | 3300046518 | Bacteria | 666 |
| 456 | Ga0495632_0523989 | 3300046519 | Bacteria | 510 |
| 457 | Ga0495663_0222149 | 3300046525 | Bacteria | 664 |
| 458 | Ga0495666_0060074 | 3300046526 | Bacteria | 1817 |
| 459 | Ga0495665_0140667 | 3300046531 | Bacteria | 1261 |
| 460 | Ga0495665_0424262 | 3300046531 | Bacteria | 673 |
| 461 | Ga0495622_0268006 | 3300046557 | Bacteria | 749 |
| 462 | Ga0495656_0559532 | 3300046615 | Bacteria | 610 |
| 463 | Ga0495668_0131607 | 3300046616 | Bacteria | 1369 |
| 464 | Ga0495647_0064966 | 3300046681 | Bacteria | 1448 |
| 465 | Ga0495647_0590591 | 3300046681 | Bacteria | 521 |
| 466 | Ga0495658_0101956 | 3300046683 | Bacteria | 1714 |
| 467 | Ga0495658_0808464 | 3300046683 | Bacteria | 600 |
| 468 | Ga0495669_0109460 | 3300046684 | Bacteria | 1289 |
| 469 | Ga0495624_0565721 | 3300046690 | Bacteria | 678 |
| 470 | Ga0495670_0103756 | 3300046691 | Bacteria | 1466 |
| 471 | Ga0495671_0473169 | 3300046692 | Bacteria | 598 |
| 472 | Ga0495581_0124860 | 3300047315 | Bacteria | 1498 |
| 473 | Ga0495672_0121296 | 3300047320 | Bacteria | 1389 |
| 474 | Ga0495676_0542327 | 3300047321 | Bacteria | 761 |
| 475 | Ga0496100_0128028 | 3300048903 | Bacteria | 1785 |
| 476 | Ga0496100_0430506 | 3300048903 | Bacteria | 1009 |
| 477 | Ga0496100_0815144 | 3300048903 | Bacteria | 731 |
| 478 | Ga0496101_0502506 | 3300048904 | Bacteria | 958 |
| 479 | Ga0496101_0565774 | 3300048904 | Unclassified | 899 |
| 480 | Ga0496102_0170430 | 3300048905 | Bacteria | 2049 |
| 481 | Ga0496102_0170781 | 3300048905 | Bacteria | 2047 |
| 482 | Ga0496102_0460512 | 3300048905 | Bacteria | 1192 |
| 483 | Ga0496103_0103532 | 3300048906 | Bacteria | 1803 |
| 484 | Ga0496103_0933924 | 3300048906 | Bacteria | 542 |
| 485 | Ga0496104_0119740 | 3300048907 | Bacteria | 2527 |
| 486 | Ga0496104_1238283 | 3300048907 | Bacteria | 649 |
| 487 | Ga0496105_0262963 | 3300048908 | Bacteria | 1395 |
| 488 | Ga0496106_0304444 | 3300048909 | Bacteria | 1278 |
| 489 | Ga0496106_0456782 | 3300048909 | Bacteria | 1026 |
| 490 | Ga0496109_0266152 | 3300048912 | Bacteria | 1615 |
| 491 | Ga0496109_0383306 | 3300048912 | Bacteria | 1328 |
| 492 | Ga0496109_0510361 | 3300048912 | Bacteria | 1135 |
| 493 | Ga0496110_1412563 | 3300048913 | Bacteria | 605 |
| 494 | Ga0496111_0065151 | 3300048914 | Bacteria | 2644 |
| 495 | Ga0496111_0543060 | 3300048914 | Bacteria | 854 |
| 496 | Ga0496112_0387234 | 3300048915 | Bacteria | 1338 |
| 497 | Ga0496113_0121140 | 3300048916 | Bacteria | 2045 |
| 498 | Ga0496114_0274377 | 3300048917 | Bacteria | 1486 |
| 499 | Ga0496114_0720236 | 3300048917 | Bacteria | 874 |
| 500 | Ga0496114_1554904 | 3300048917 | Bacteria | 549 |
| 501 | Ga0496115_0170941 | 3300048918 | Bacteria | 1797 |
| 502 | Ga0496115_0443914 | 3300048918 | Bacteria | 1049 |
| 503 | Ga0496117_0110642 | 3300048920 | Bacteria | 1712 |
| 504 | Ga0496118_0136348 | 3300048921 | Bacteria | 1565 |
| 505 | Ga0496119_0371945 | 3300048922 | Bacteria | 687 |
| 506 | Ga0496120_0446376 | 3300048923 | Bacteria | 564 |
| 507 | Ga0496121_0024298 | 3300048924 | Bacteria | 5802 |
| 508 | Ga0496124_0177563 | 3300048927 | Bacteria | 1642 |
| 509 | Ga0496126_1287282 | 3300048929 | Bacteria | 533 |
| 510 | Ga0501031_0078107 | 3300049568 | Bacteria | 2156 |
| 511 | Ga0501031_0163849 | 3300049568 | Bacteria | 1453 |
| 512 | Ga0501032_0132811 | 3300049569 | Bacteria | 1641 |
| 513 | Ga0501032_0172144 | 3300049569 | Bacteria | 1419 |
| 514 | Ga0501033_0031585 | 3300049570 | Bacteria | 3978 |
| 515 | Ga0501033_0205047 | 3300049570 | Bacteria | 1407 |
| 516 | Ga0501034_0302655 | 3300049571 | Bacteria | 1535 |
| 517 | Ga0501034_0569652 | 3300049571 | Bacteria | 1040 |
| 518 | Ga0501034_1394622 | 3300049571 | Bacteria | 576 |
| 519 | Ga0501036_0146601 | 3300049572 | Bacteria | 1991 |
| 520 | Ga0501037_0164713 | 3300049573 | Bacteria | 1579 |
| 521 | Ga0501037_0167701 | 3300049573 | Bacteria | 1562 |
| 522 | Ga0501038_0197053 | 3300049574 | Bacteria | 1618 |
| 523 | Ga0501038_0458340 | 3300049574 | Bacteria | 979 |
| 524 | Ga0501038_0777598 | 3300049574 | Bacteria | 713 |
| 525 | Ga0501039_0179954 | 3300049575 | Bacteria | 1663 |
| 526 | Ga0501039_0873613 | 3300049575 | Bacteria | 700 |
| 527 | Ga0501043_0187526 | 3300049579 | Bacteria | 1609 |
| 528 | Ga0501043_0259319 | 3300049579 | Bacteria | 1337 |
| 529 | Ga0501046_0188801 | 3300049580 | Bacteria | 1538 |
| 530 | Ga0501046_0682328 | 3300049580 | Bacteria | 725 |
| 531 | Ga0501047_0203658 | 3300049581 | Bacteria | 1839 |
| 532 | Ga0501047_0242088 | 3300049581 | Bacteria | 1654 |
| 533 | Ga0501048_0181283 | 3300049582 | Bacteria | 1493 |
| 534 | Ga0501069_0107661 | 3300049585 | Bacteria | 1585 |
| 535 | Ga0501069_0143450 | 3300049585 | Bacteria | 1370 |
| 536 | Ga0501070_0003549 | 3300049586 | Bacteria | 13490 |
| 537 | Ga0501070_0142184 | 3300049586 | Bacteria | 1981 |
| 538 | Ga0501070_0257124 | 3300049586 | Bacteria | 1428 |
| 539 | Ga0501071_0566754 | 3300049587 | Bacteria | 873 |
| 540 | Ga0501073_0192574 | 3300049589 | Bacteria | 1411 |
| 541 | Ga0501073_0224335 | 3300049589 | Bacteria | 1298 |
| 542 | Ga0501074_0207629 | 3300049590 | Bacteria | 1395 |
| 543 | Ga0501074_0248316 | 3300049590 | Bacteria | 1265 |
| 544 | Ga0501074_0563271 | 3300049590 | Bacteria | 806 |
| 545 | Ga0501079_0277006 | 3300049741 | Bacteria | 1312 |
| 546 | Ga0501079_0502158 | 3300049741 | Bacteria | 953 |
| 547 | Ga0501080_0001972 | 3300049742 | Bacteria | 17716 |
| 548 | Ga0501035_0021491 | 3300049822 | Bacteria | 5932 |
| 549 | Ga0501035_0221432 | 3300049822 | Bacteria | 1615 |
| 550 | Ga0501044_0037065 | 3300049823 | Bacteria | 5098 |
| 551 | Ga0501044_0061790 | 3300049823 | Bacteria | 3831 |
| 552 | Ga0501044_0321054 | 3300049823 | Bacteria | 1473 |
| 553 | nmdc:mga03n38_42913_c1 | 3300050490 | Bacteria | 1980 |
| 554 | nmdc:mga00v17_150467_c1 | 3300050491 | Bacteria | 1495 |
| 555 | nmdc:mga00v17_488749_c1 | 3300050491 | Bacteria | 798 |
| 556 | nmdc:mga00v17_78149_c1 | 3300050491 | Bacteria | 2062 |
| 557 | nmdc:mga00v17_906517_c1 | 3300050491 | Bacteria | 558 |
| 558 | nmdc:mga0yw44_129429_c1 | 3300050492 | Bacteria | 1633 |
| 559 | nmdc:mga0yw44_157553_c1 | 3300050492 | Bacteria | 1485 |
| 560 | nmdc:mga0yw44_22421_c1 | 3300050492 | Bacteria | 3541 |
| 561 | nmdc:mga0yw44_237576_c1 | 3300050492 | Bacteria | 1211 |
| 562 | nmdc:mga0yw44_268358_c1 | 3300050492 | Bacteria | 1139 |
| 563 | nmdc:mga0yw44_777746_c1 | 3300050492 | Bacteria | 650 |
| 564 | nmdc:mga06z11_136871_c1 | 3300050494 | Bacteria | 1381 |
| 565 | nmdc:mga04h51_64247_c1 | 3300050495 | Bacteria | 1266 |
| 566 | nmdc:mga07m45_53478_c2 | 3300050496 | Bacteria | 1305 |
| 567 | nmdc:mga06r32_22384_c1 | 3300050510 | Bacteria | 5843 |
| 568 | nmdc:mga0sz30_214203_c1 | 3300050516 | Bacteria | 856 |
| 569 | Ga0495655_0108378 | 3300053083 | Bacteria | 831 |
| 570 | Ga0500643_035625 | 3300053087 | Bacteria | 1490 |
| 571 | Ga0500622_0027519 | 3300053156 | Bacteria | 2997 |
| 572 | Ga0500622_0109273 | 3300053156 | Bacteria | 1353 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0569652 | Ga0501034_0569652_354_644 | 76 |
| 2 | 3300049741 | Ga0501079_0277006 | Ga0501079_0277006_1051_1293 | 80 |
| 3 | 3300050491 | nmdc:mga00v17_488749_c1 | nmdc:mga00v17_488749_c1_497_739 | 80 |
| 4 | 3300005336 | Ga0070680_100259674 | Ga0070680_1002596742 | 81 |
| 5 | 3300005338 | Ga0068868_102237611 | Ga0068868_1022376112 | 82 |
| 6 | 3300005436 | Ga0070713_101628720 | Ga0070713_1016287201 | 82 |
| 7 | 3300005440 | Ga0070705_100830986 | Ga0070705_1008309861 | 82 |
| 8 | 3300006175 | Ga0070712_101579374 | Ga0070712_1015793741 | 82 |
| 9 | 3300006881 | Ga0068865_101564622 | Ga0068865_1015646221 | 82 |
| 10 | 3300025898 | Ga0207692_10160095 | Ga0207692_101600952 | 82 |
| 11 | 3300025915 | Ga0207693_10503343 | Ga0207693_105033432 | 82 |
| 12 | 3300031731 | Ga0307405_10851810 | Ga0307405_108518101 | 83 |
| 13 | 3300031824 | Ga0307413_10724908 | Ga0307413_107249082 | 83 |
| 14 | 3300031852 | Ga0307410_10095837 | Ga0307410_100958373 | 83 |
| 15 | 3300031901 | Ga0307406_10084547 | Ga0307406_100845472 | 83 |
| 16 | 3300031903 | Ga0307407_10191155 | Ga0307407_101911553 | 83 |
| 17 | 3300031995 | Ga0307409_100012519 | Ga0307409_1000125195 | 83 |
| 18 | 3300032002 | Ga0307416_103614155 | Ga0307416_1036141552 | 83 |
| 19 | 3300032004 | Ga0307414_10447210 | Ga0307414_104472102 | 83 |
| 20 | 3300032005 | Ga0307411_12134295 | Ga0307411_121342951 | 83 |
| 21 | 3300014325 | Ga0163163_12977207 | Ga0163163_129772071 | 84 |
| 22 | 3300009094 | Ga0111539_10755061 | Ga0111539_107550611 | 86 |
| 23 | 3300009147 | Ga0114129_12583789 | Ga0114129_125837891 | 86 |
| 24 | 3300028800 | Ga0265338_10364433 | Ga0265338_103644332 | 86 |
| 25 | 3300031238 | Ga0265332_10077431 | Ga0265332_100774312 | 86 |
| 26 | 3300031251 | Ga0265327_10110587 | Ga0265327_101105872 | 86 |
| 27 | 3300031711 | Ga0265314_10150863 | Ga0265314_101508632 | 86 |
| 28 | 3300005367 | Ga0070667_100157980 | Ga0070667_1001579802 | 87 |
| 29 | 3300006038 | Ga0075365_10011120 | Ga0075365_100111201 | 87 |
| 30 | 3300006038 | Ga0075365_10159281 | Ga0075365_101592813 | 87 |
| 31 | 3300006038 | Ga0075365_11031371 | Ga0075365_110313712 | 87 |
| 32 | 3300006042 | Ga0075368_10088339 | Ga0075368_100883392 | 87 |
| 33 | 3300006048 | Ga0075363_100196243 | Ga0075363_1001962431 | 87 |
| 34 | 3300006051 | Ga0075364_10353011 | Ga0075364_103530112 | 87 |
| 35 | 3300006177 | Ga0075362_10003608 | Ga0075362_100036081 | 87 |
| 36 | 3300006186 | Ga0075369_10170199 | Ga0075369_101701991 | 87 |
| 37 | 3300006353 | Ga0075370_10046227 | Ga0075370_100462273 | 87 |
| 38 | 3300014968 | Ga0157379_11486759 | Ga0157379_114867592 | 87 |
| 39 | 3300025986 | Ga0207658_11931440 | Ga0207658_119314401 | 87 |
| 40 | 3300027866 | Ga0209813_10038555 | Ga0209813_100385552 | 87 |
| 41 | 3300039437 | Ga0436365_0101565 | Ga0436365_0101565_78_383 | 87 |
| 42 | 3300041509 | Ga0451843_0517588 | Ga0451843_0517588_447_752 | 87 |
| 43 | 3300041512 | Ga0451853_0183895 | Ga0451853_0183895_66_371 | 87 |
| 44 | 3300048927 | Ga0496124_0177563 | Ga0496124_0177563_1239_1544 | 87 |
| 45 | 3300050490 | nmdc:mga03n38_42913_c1 | nmdc:mga03n38_42913_c1_1279_1596 | 87 |
| 46 | 3300050491 | nmdc:mga00v17_150467_c1 | nmdc:mga00v17_150467_c1_948_1253 | 87 |
| 47 | 3300050491 | nmdc:mga00v17_78149_c1 | nmdc:mga00v17_78149_c1_1087_1404 | 87 |
| 48 | 3300050492 | nmdc:mga0yw44_129429_c1 | nmdc:mga0yw44_129429_c1_1269_1574 | 87 |
| 49 | 3300050492 | nmdc:mga0yw44_157553_c1 | nmdc:mga0yw44_157553_c1_128_433 | 87 |
| 50 | 3300050492 | nmdc:mga0yw44_22421_c1 | nmdc:mga0yw44_22421_c1_3124_3429 | 87 |
| 51 | 3300050492 | nmdc:mga0yw44_237576_c1 | nmdc:mga0yw44_237576_c1_200_517 | 87 |
| 52 | 3300050494 | nmdc:mga06z11_136871_c1 | nmdc:mga06z11_136871_c1_993_1310 | 87 |
| 53 | 3300050495 | nmdc:mga04h51_64247_c1 | nmdc:mga04h51_64247_c1_906_1223 | 87 |
| 54 | 3300050496 | nmdc:mga07m45_53478_c2 | nmdc:mga07m45_53478_c2_83_400 | 87 |
| 55 | 3300050516 | nmdc:mga0sz30_214203_c1 | nmdc:mga0sz30_214203_c1_526_843 | 87 |
| 56 | 3300005441 | Ga0070700_100512744 | Ga0070700_1005127443 | 88 |
| 57 | 3300014969 | Ga0157376_11599279 | Ga0157376_115992791 | 88 |
| 58 | 3300031548 | Ga0307408_100236173 | Ga0307408_1002361733 | 89 |
| 59 | 3300031901 | Ga0307406_10285896 | Ga0307406_102858961 | 89 |
| 60 | 3300031995 | Ga0307409_100356335 | Ga0307409_1003563352 | 89 |
| 61 | 3300031995 | Ga0307409_101850884 | Ga0307409_1018508841 | 89 |
| 62 | 3300032002 | Ga0307416_102323264 | Ga0307416_1023232641 | 89 |
| 63 | 3300032126 | Ga0307415_100139650 | Ga0307415_1001396502 | 89 |
| 64 | 3300032126 | Ga0307415_101676142 | Ga0307415_1016761421 | 89 |
| 65 | 3300013105 | Ga0157369_10731174 | Ga0157369_107311742 | 90 |
| 66 | 3300003323 | rootH1_10053897 | rootH1_100538973 | 92 |
| 67 | 3300003323 | rootH1_10252916 | rootH1_102529161 | 92 |
| 68 | iso_pu_bacteria | 2791354901 | 2791917430 | 92 |
| 69 | 3300005337 | Ga0070682_100441202 | Ga0070682_1004412023 | 93 |
| 70 | 3300005434 | Ga0070709_10323464 | Ga0070709_103234642 | 93 |
| 71 | 3300005435 | Ga0070714_100344906 | Ga0070714_1003449061 | 93 |
| 72 | 3300005437 | Ga0070710_10202979 | Ga0070710_102029791 | 93 |
| 73 | 3300005439 | Ga0070711_100140716 | Ga0070711_1001407162 | 93 |
| 74 | 3300006028 | Ga0070717_10471921 | Ga0070717_104719211 | 93 |
| 75 | 3300006175 | Ga0070712_100226901 | Ga0070712_1002269012 | 93 |
| 76 | 3300025906 | Ga0207699_10294836 | Ga0207699_102948362 | 93 |
| 77 | 3300025915 | Ga0207693_10254515 | Ga0207693_102545152 | 93 |
| 78 | 3300025916 | Ga0207663_10311884 | Ga0207663_103118841 | 93 |
| 79 | 3300025928 | Ga0207700_10337077 | Ga0207700_103370772 | 93 |
| 80 | 3300025929 | Ga0207664_10307968 | Ga0207664_103079681 | 93 |
| 81 | 3300042436 | Ga0439435_0018736 | Ga0439435_0018736_1396_1680 | 93 |
| 82 | 3300045836 | Ga0466958_0101224 | Ga0466958_0101224_408_722 | 93 |
| 83 | 3300050510 | nmdc:mga06r32_22384_c1 | nmdc:mga06r32_22384_c1_5202_5489 | 93 |
| 84 | 3300009101 | Ga0105247_10001194 | Ga0105247_100011947 | 94 |
| 85 | 3300025900 | Ga0207710_10000174 | Ga0207710_1000017419 | 94 |
| 86 | 3300048904 | Ga0496101_0565774 | Ga0496101_0565774_496_786 | 94 |
| 87 | 3300048905 | Ga0496102_0170430 | Ga0496102_0170430_162_452 | 94 |
| 88 | 3300048906 | Ga0496103_0103532 | Ga0496103_0103532_1027_1317 | 94 |
| 89 | 3300048920 | Ga0496117_0110642 | Ga0496117_0110642_132_422 | 94 |
| 90 | 3300048921 | Ga0496118_0136348 | Ga0496118_0136348_174_464 | 94 |
| 91 | 3300048924 | Ga0496121_0024298 | Ga0496121_0024298_4740_5030 | 94 |
| 92 | 3300049587 | Ga0501071_0566754 | Ga0501071_0566754_254_538 | 94 |
| 93 | 3300005330 | Ga0070690_100965611 | Ga0070690_1009656112 | 95 |
| 94 | 3300005355 | Ga0070671_101581393 | Ga0070671_1015813932 | 95 |
| 95 | 3300005535 | Ga0070684_101354972 | Ga0070684_1013549721 | 95 |
| 96 | 3300005548 | Ga0070665_101676125 | Ga0070665_1016761252 | 95 |
| 97 | 3300005615 | Ga0070702_101215703 | Ga0070702_1012157032 | 95 |
| 98 | 3300006028 | Ga0070717_11062494 | Ga0070717_110624942 | 95 |
| 99 | 3300006175 | Ga0070712_100185010 | Ga0070712_1001850102 | 95 |
| 100 | 3300006881 | Ga0068865_100365800 | Ga0068865_1003658002 | 95 |
| 101 | 3300009098 | Ga0105245_10536725 | Ga0105245_105367252 | 95 |
| 102 | 3300009098 | Ga0105245_12117638 | Ga0105245_121176382 | 95 |
| 103 | 3300009101 | Ga0105247_11375329 | Ga0105247_113753292 | 95 |
| 104 | 3300009148 | Ga0105243_10515441 | Ga0105243_105154412 | 95 |
| 105 | 3300009176 | Ga0105242_10225814 | Ga0105242_102258142 | 95 |
| 106 | 3300009177 | Ga0105248_10823755 | Ga0105248_108237552 | 95 |
| 107 | 3300009551 | Ga0105238_11318210 | Ga0105238_113182102 | 95 |
| 108 | 3300009553 | Ga0105249_11971766 | Ga0105249_119717662 | 95 |
| 109 | 3300009553 | Ga0105249_12246313 | Ga0105249_122463132 | 95 |
| 110 | 3300010375 | Ga0105239_10334387 | Ga0105239_103343873 | 95 |
| 111 | 3300010375 | Ga0105239_11750252 | Ga0105239_117502522 | 95 |
| 112 | 3300013306 | Ga0163162_12471429 | Ga0163162_124714291 | 95 |
| 113 | 3300017792 | Ga0163161_10640764 | Ga0163161_106407641 | 95 |
| 114 | 3300025321 | Ga0207656_10332155 | Ga0207656_103321552 | 95 |
| 115 | 3300025915 | Ga0207693_10173266 | Ga0207693_101732663 | 95 |
| 116 | 3300025927 | Ga0207687_10801815 | Ga0207687_108018151 | 95 |
| 117 | 3300025932 | Ga0207690_11673803 | Ga0207690_116738031 | 95 |
| 118 | 3300025933 | Ga0207706_11218745 | Ga0207706_112187452 | 95 |
| 119 | 3300025934 | Ga0207686_10163131 | Ga0207686_101631312 | 95 |
| 120 | 3300025935 | Ga0207709_10168136 | Ga0207709_101681362 | 95 |
| 121 | 3300025936 | Ga0207670_10693799 | Ga0207670_106937992 | 95 |
| 122 | 3300025938 | Ga0207704_10522533 | Ga0207704_105225332 | 95 |
| 123 | 3300025941 | Ga0207711_11083111 | Ga0207711_110831112 | 95 |
| 124 | 3300037312 | Ga0395899_0934890 | Ga0395899_0934890_60_353 | 95 |
| 125 | 3300037466 | Ga0395898_1034962 | Ga0395898_1034962_60_353 | 95 |
| 126 | 3300038443 | Ga0395901_0924865 | Ga0395901_0924865_382_675 | 95 |
| 127 | 3300041452 | Ga0451793_0688899 | Ga0451793_0688899_130_417 | 95 |
| 128 | 3300042009 | Ga0439451_052650 | Ga0439451_052650_515_802 | 95 |
| 129 | 3300042137 | Ga0450902_043385 | Ga0450902_043385_199_492 | 95 |
| 130 | 3300046615 | Ga0495656_0559532 | Ga0495656_0559532_73_360 | 95 |
| 131 | 3300048903 | Ga0496100_0430506 | Ga0496100_0430506_708_995 | 95 |
| 132 | 3300048904 | Ga0496101_0502506 | Ga0496101_0502506_142_429 | 95 |
| 133 | 3300048905 | Ga0496102_0170781 | Ga0496102_0170781_79_366 | 95 |
| 134 | 3300048912 | Ga0496109_0266152 | Ga0496109_0266152_1221_1508 | 95 |
| 135 | 3300048914 | Ga0496111_0543060 | Ga0496111_0543060_91_381 | 95 |
| 136 | 3300048917 | Ga0496114_0274377 | Ga0496114_0274377_132_419 | 95 |
| 137 | 3300048917 | Ga0496114_0720236 | Ga0496114_0720236_504_791 | 95 |
| 138 | 3300049585 | Ga0501069_0107661 | Ga0501069_0107661_1063_1395 | 95 |
| 139 | 3300049590 | Ga0501074_0563271 | Ga0501074_0563271_45_377 | 95 |
| 140 | 3300049741 | Ga0501079_0502158 | Ga0501079_0502158_477_809 | 95 |
| 141 | 3300000531 | CNBas_1011574 | CNBas_10115741 | 96 |
| 142 | 3300000549 | LJQas_1001486 | LJQas_10014863 | 96 |
| 143 | 3300001904 | JGI24736J21556_1014596 | JGI24736J21556_10145961 | 96 |
| 144 | 3300001915 | JGI24741J21665_1014894 | JGI24741J21665_10148942 | 96 |
| 145 | 3300001915 | JGI24741J21665_1015450 | JGI24741J21665_10154502 | 96 |
| 146 | 3300001976 | JGI24752J21851_1009146 | JGI24752J21851_10091461 | 96 |
| 147 | 3300001979 | JGI24740J21852_10042187 | JGI24740J21852_100421872 | 96 |
| 148 | 3300001979 | JGI24740J21852_10174428 | JGI24740J21852_101744282 | 96 |
| 149 | 3300001989 | JGI24739J22299_10058528 | JGI24739J22299_100585281 | 96 |
| 150 | 3300002067 | JGI24735J21928_10183692 | JGI24735J21928_101836922 | 96 |
| 151 | 3300002075 | JGI24738J21930_10014229 | JGI24738J21930_100142293 | 96 |
| 152 | 3300002076 | JGI24749J21850_1013375 | JGI24749J21850_10133751 | 96 |
| 153 | 3300002077 | JGI24744J21845_10004331 | JGI24744J21845_100043312 | 96 |
| 154 | 3300002077 | JGI24744J21845_10090658 | JGI24744J21845_100906582 | 96 |
| 155 | 3300002155 | JGI24033J26618_1007147 | JGI24033J26618_10071472 | 96 |
| 156 | 3300002239 | JGI24034J26672_10007726 | JGI24034J26672_100077261 | 96 |
| 157 | 3300002459 | JGI24751J29686_10024078 | JGI24751J29686_100240782 | 96 |
| 158 | 3300002459 | JGI24751J29686_10094652 | JGI24751J29686_100946522 | 96 |
| 159 | 3300005290 | Ga0065712_10031799 | Ga0065712_100317991 | 96 |
| 160 | 3300005327 | Ga0070658_10333962 | Ga0070658_103339621 | 96 |
| 161 | 3300005327 | Ga0070658_10620771 | Ga0070658_106207712 | 96 |
| 162 | 3300005329 | Ga0070683_100395030 | Ga0070683_1003950302 | 96 |
| 163 | 3300005329 | Ga0070683_100411502 | Ga0070683_1004115021 | 96 |
| 164 | 3300005331 | Ga0070670_101945290 | Ga0070670_1019452901 | 96 |
| 165 | 3300005333 | Ga0070677_10415026 | Ga0070677_104150262 | 96 |
| 166 | 3300005334 | Ga0068869_100105382 | Ga0068869_1001053822 | 96 |
| 167 | 3300005334 | Ga0068869_100298511 | Ga0068869_1002985111 | 96 |
| 168 | 3300005334 | Ga0068869_100538371 | Ga0068869_1005383712 | 96 |
| 169 | 3300005336 | Ga0070680_100253346 | Ga0070680_1002533461 | 96 |
| 170 | 3300005337 | Ga0070682_100229574 | Ga0070682_1002295742 | 96 |
| 171 | 3300005337 | Ga0070682_100854148 | Ga0070682_1008541481 | 96 |
| 172 | 3300005337 | Ga0070682_101955858 | Ga0070682_1019558581 | 96 |
| 173 | 3300005338 | Ga0068868_100260641 | Ga0068868_1002606412 | 96 |
| 174 | 3300005339 | Ga0070660_101336127 | Ga0070660_1013361272 | 96 |
| 175 | 3300005340 | Ga0070689_101114961 | Ga0070689_1011149612 | 96 |
| 176 | 3300005341 | Ga0070691_10508364 | Ga0070691_105083641 | 96 |
| 177 | 3300005344 | Ga0070661_101098424 | Ga0070661_1010984242 | 96 |
| 178 | 3300005344 | Ga0070661_101733463 | Ga0070661_1017334631 | 96 |
| 179 | 3300005347 | Ga0070668_100220973 | Ga0070668_1002209732 | 96 |
| 180 | 3300005356 | Ga0070674_100139031 | Ga0070674_1001390312 | 96 |
| 181 | 3300005364 | Ga0070673_100618149 | Ga0070673_1006181492 | 96 |
| 182 | 3300005365 | Ga0070688_100124208 | Ga0070688_1001242083 | 96 |
| 183 | 3300005366 | Ga0070659_100353607 | Ga0070659_1003536072 | 96 |
| 184 | 3300005366 | Ga0070659_101487605 | Ga0070659_1014876051 | 96 |
| 185 | 3300005367 | Ga0070667_100494532 | Ga0070667_1004945323 | 96 |
| 186 | 3300005406 | Ga0070703_10407137 | Ga0070703_104071372 | 96 |
| 187 | 3300005434 | Ga0070709_10032131 | Ga0070709_100321314 | 96 |
| 188 | 3300005436 | Ga0070713_100736471 | Ga0070713_1007364712 | 96 |
| 189 | 3300005437 | Ga0070710_10131788 | Ga0070710_101317882 | 96 |
| 190 | 3300005438 | Ga0070701_10051684 | Ga0070701_100516843 | 96 |
| 191 | 3300005439 | Ga0070711_100091075 | Ga0070711_1000910752 | 96 |
| 192 | 3300005439 | Ga0070711_100138873 | Ga0070711_1001388734 | 96 |
| 193 | 3300005439 | Ga0070711_100233973 | Ga0070711_1002339732 | 96 |
| 194 | 3300005444 | Ga0070694_101047112 | Ga0070694_1010471122 | 96 |
| 195 | 3300005445 | Ga0070708_100251683 | Ga0070708_1002516833 | 96 |
| 196 | 3300005455 | Ga0070663_100156641 | Ga0070663_1001566411 | 96 |
| 197 | 3300005456 | Ga0070678_100264314 | Ga0070678_1002643142 | 96 |
| 198 | 3300005456 | Ga0070678_102034088 | Ga0070678_1020340882 | 96 |
| 199 | 3300005458 | Ga0070681_10217925 | Ga0070681_102179253 | 96 |
| 200 | 3300005466 | Ga0070685_10212452 | Ga0070685_102124522 | 96 |
| 201 | 3300005467 | Ga0070706_100936928 | Ga0070706_1009369282 | 96 |
| 202 | 3300005468 | Ga0070707_100781035 | Ga0070707_1007810352 | 96 |
| 203 | 3300005468 | Ga0070707_102185678 | Ga0070707_1021856781 | 96 |
| 204 | 3300005471 | Ga0070698_100357972 | Ga0070698_1003579723 | 96 |
| 205 | 3300005471 | Ga0070698_100897934 | Ga0070698_1008979342 | 96 |
| 206 | 3300005471 | Ga0070698_101815416 | Ga0070698_1018154161 | 96 |
| 207 | 3300005518 | Ga0070699_100250318 | Ga0070699_1002503181 | 96 |
| 208 | 3300005518 | Ga0070699_100391354 | Ga0070699_1003913541 | 96 |
| 209 | 3300005530 | Ga0070679_100325143 | Ga0070679_1003251431 | 96 |
| 210 | 3300005530 | Ga0070679_100679167 | Ga0070679_1006791672 | 96 |
| 211 | 3300005535 | Ga0070684_100177227 | Ga0070684_1001772273 | 96 |
| 212 | 3300005535 | Ga0070684_101056549 | Ga0070684_1010565491 | 96 |
| 213 | 3300005536 | Ga0070697_100135953 | Ga0070697_1001359532 | 96 |
| 214 | 3300005536 | Ga0070697_100255784 | Ga0070697_1002557842 | 96 |
| 215 | 3300005536 | Ga0070697_100918061 | Ga0070697_1009180612 | 96 |
| 216 | 3300005539 | Ga0068853_100689144 | Ga0068853_1006891441 | 96 |
| 217 | 3300005543 | Ga0070672_101224727 | Ga0070672_1012247271 | 96 |
| 218 | 3300005543 | Ga0070672_101929395 | Ga0070672_1019293952 | 96 |
| 219 | 3300005543 | Ga0070672_102179744 | Ga0070672_1021797441 | 96 |
| 220 | 3300005546 | Ga0070696_100272272 | Ga0070696_1002722722 | 96 |
| 221 | 3300005546 | Ga0070696_100645344 | Ga0070696_1006453442 | 96 |
| 222 | 3300005548 | Ga0070665_101840314 | Ga0070665_1018403141 | 96 |
| 223 | 3300005549 | Ga0070704_101109899 | Ga0070704_1011098991 | 96 |
| 224 | 3300005563 | Ga0068855_100479377 | Ga0068855_1004793772 | 96 |
| 225 | 3300005563 | Ga0068855_101129371 | Ga0068855_1011293712 | 96 |
| 226 | 3300005564 | Ga0070664_100402418 | Ga0070664_1004024181 | 96 |
| 227 | 3300005577 | Ga0068857_100397824 | Ga0068857_1003978241 | 96 |
| 228 | 3300005577 | Ga0068857_100937161 | Ga0068857_1009371612 | 96 |
| 229 | 3300005614 | Ga0068856_100502880 | Ga0068856_1005028802 | 96 |
| 230 | 3300005614 | Ga0068856_100891110 | Ga0068856_1008911102 | 96 |
| 231 | 3300005616 | Ga0068852_100206930 | Ga0068852_1002069301 | 96 |
| 232 | 3300005616 | Ga0068852_100326940 | Ga0068852_1003269401 | 96 |
| 233 | 3300005616 | Ga0068852_102761088 | Ga0068852_1027610881 | 96 |
| 234 | 3300005617 | Ga0068859_100841444 | Ga0068859_1008414441 | 96 |
| 235 | 3300005617 | Ga0068859_102255135 | Ga0068859_1022551351 | 96 |
| 236 | 3300005834 | Ga0068851_10719631 | Ga0068851_107196312 | 96 |
| 237 | 3300005840 | Ga0068870_11391173 | Ga0068870_113911732 | 96 |
| 238 | 3300005841 | Ga0068863_102220838 | Ga0068863_1022208382 | 96 |
| 239 | 3300005843 | Ga0068860_102153739 | Ga0068860_1021537392 | 96 |
| 240 | 3300005937 | Ga0081455_10782811 | Ga0081455_107828112 | 96 |
| 241 | 3300005985 | Ga0081539_10014068 | Ga0081539_100140685 | 96 |
| 242 | 3300006038 | Ga0075365_10349796 | Ga0075365_103497962 | 96 |
| 243 | 3300006038 | Ga0075365_10992522 | Ga0075365_109925222 | 96 |
| 244 | 3300006163 | Ga0070715_10087964 | Ga0070715_100879642 | 96 |
| 245 | 3300006163 | Ga0070715_10756686 | Ga0070715_107566861 | 96 |
| 246 | 3300006175 | Ga0070712_100262758 | Ga0070712_1002627582 | 96 |
| 247 | 3300006175 | Ga0070712_101778353 | Ga0070712_1017783532 | 96 |
| 248 | 3300006237 | Ga0097621_101364032 | Ga0097621_1013640321 | 96 |
| 249 | 3300006358 | Ga0068871_101217842 | Ga0068871_1012178422 | 96 |
| 250 | 3300006844 | Ga0075428_101260186 | Ga0075428_1012601861 | 96 |
| 251 | 3300006844 | Ga0075428_102453156 | Ga0075428_1024531561 | 96 |
| 252 | 3300006847 | Ga0075431_100461742 | Ga0075431_1004617422 | 96 |
| 253 | 3300006871 | Ga0075434_102513383 | Ga0075434_1025133832 | 96 |
| 254 | 3300006881 | Ga0068865_100842986 | Ga0068865_1008429861 | 96 |
| 255 | 3300006931 | Ga0097620_100841345 | Ga0097620_1008413452 | 96 |
| 256 | 3300006931 | Ga0097620_102254798 | Ga0097620_1022547982 | 96 |
| 257 | 3300007788 | Ga0099795_10027278 | Ga0099795_100272782 | 96 |
| 258 | 3300009011 | Ga0105251_10060771 | Ga0105251_100607712 | 96 |
| 259 | 3300009036 | Ga0105244_10054841 | Ga0105244_100548411 | 96 |
| 260 | 3300009036 | Ga0105244_10402920 | Ga0105244_104029202 | 96 |
| 261 | 3300009092 | Ga0105250_10044883 | Ga0105250_100448832 | 96 |
| 262 | 3300009093 | Ga0105240_11066111 | Ga0105240_110661112 | 96 |
| 263 | 3300009093 | Ga0105240_11261216 | Ga0105240_112612163 | 96 |
| 264 | 3300009098 | Ga0105245_11536163 | Ga0105245_115361632 | 96 |
| 265 | 3300009101 | Ga0105247_10090321 | Ga0105247_100903212 | 96 |
| 266 | 3300009101 | Ga0105247_10144205 | Ga0105247_101442051 | 96 |
| 267 | 3300009101 | Ga0105247_10953698 | Ga0105247_109536981 | 96 |
| 268 | 3300009101 | Ga0105247_11320091 | Ga0105247_113200911 | 96 |
| 269 | 3300009148 | Ga0105243_10040584 | Ga0105243_100405844 | 96 |
| 270 | 3300009148 | Ga0105243_10216123 | Ga0105243_102161232 | 96 |
| 271 | 3300009174 | Ga0105241_11729418 | Ga0105241_117294181 | 96 |
| 272 | 3300009174 | Ga0105241_12500541 | Ga0105241_125005411 | 96 |
| 273 | 3300009176 | Ga0105242_12004301 | Ga0105242_120043012 | 96 |
| 274 | 3300009177 | Ga0105248_10410065 | Ga0105248_104100652 | 96 |
| 275 | 3300009545 | Ga0105237_12059341 | Ga0105237_120593411 | 96 |
| 276 | 3300009551 | Ga0105238_11295325 | Ga0105238_112953252 | 96 |
| 277 | 3300009551 | Ga0105238_11900665 | Ga0105238_119006651 | 96 |
| 278 | 3300009553 | Ga0105249_10291308 | Ga0105249_102913081 | 96 |
| 279 | 3300009553 | Ga0105249_12401354 | Ga0105249_124013542 | 96 |
| 280 | 3300010159 | Ga0099796_10061715 | Ga0099796_100617151 | 96 |
| 281 | 3300010375 | Ga0105239_10525534 | Ga0105239_105255341 | 96 |
| 282 | 3300011119 | Ga0105246_10644604 | Ga0105246_106446042 | 96 |
| 283 | 3300011119 | Ga0105246_10938471 | Ga0105246_109384712 | 96 |
| 284 | 3300012481 | Ga0157320_1041544 | Ga0157320_10415442 | 96 |
| 285 | 3300012491 | Ga0157329_1015323 | Ga0157329_10153231 | 96 |
| 286 | 3300012515 | Ga0157338_1068680 | Ga0157338_10686801 | 96 |
| 287 | 3300013100 | Ga0157373_10145383 | Ga0157373_101453831 | 96 |
| 288 | 3300013102 | Ga0157371_10228013 | Ga0157371_102280131 | 96 |
| 289 | 3300013102 | Ga0157371_11139426 | Ga0157371_111394262 | 96 |
| 290 | 3300013104 | Ga0157370_10289117 | Ga0157370_102891173 | 96 |
| 291 | 3300013104 | Ga0157370_11334386 | Ga0157370_113343862 | 96 |
| 292 | 3300013105 | Ga0157369_10116917 | Ga0157369_101169174 | 96 |
| 293 | 3300013105 | Ga0157369_11486388 | Ga0157369_114863882 | 96 |
| 294 | 3300013297 | Ga0157378_10275727 | Ga0157378_102757271 | 96 |
| 295 | 3300013297 | Ga0157378_12158829 | Ga0157378_121588291 | 96 |
| 296 | 3300013306 | Ga0163162_10124140 | Ga0163162_101241403 | 96 |
| 297 | 3300013306 | Ga0163162_12914471 | Ga0163162_129144711 | 96 |
| 298 | 3300013307 | Ga0157372_11920749 | Ga0157372_119207492 | 96 |
| 299 | 3300013308 | Ga0157375_11181100 | Ga0157375_111811001 | 96 |
| 300 | 3300013308 | Ga0157375_11192929 | Ga0157375_111929292 | 96 |
| 301 | 3300014325 | Ga0163163_10213060 | Ga0163163_102130602 | 96 |
| 302 | 3300014326 | Ga0157380_11075039 | Ga0157380_110750391 | 96 |
| 303 | 3300014326 | Ga0157380_12276950 | Ga0157380_122769501 | 96 |
| 304 | 3300014326 | Ga0157380_12959500 | Ga0157380_129595002 | 96 |
| 305 | 3300014745 | Ga0157377_11772043 | Ga0157377_117720432 | 96 |
| 306 | 3300014968 | Ga0157379_12185832 | Ga0157379_121858322 | 96 |
| 307 | 3300014969 | Ga0157376_12352288 | Ga0157376_123522881 | 96 |
| 308 | 3300017792 | Ga0163161_10220237 | Ga0163161_102202371 | 96 |
| 309 | 3300017792 | Ga0163161_10750994 | Ga0163161_107509942 | 96 |
| 310 | 3300020070 | Ga0206356_11099645 | Ga0206356_110996452 | 96 |
| 311 | 3300020077 | Ga0206351_10127246 | Ga0206351_101272462 | 96 |
| 312 | 3300020077 | Ga0206351_10824162 | Ga0206351_108241621 | 96 |
| 313 | 3300020080 | Ga0206350_10662476 | Ga0206350_106624763 | 96 |
| 314 | 3300020082 | Ga0206353_11968452 | Ga0206353_119684522 | 96 |
| 315 | 3300020610 | Ga0154015_1150379 | Ga0154015_11503794 | 96 |
| 316 | 3300020610 | Ga0154015_1608420 | Ga0154015_16084202 | 96 |
| 317 | 3300020610 | Ga0154015_1700357 | Ga0154015_17003573 | 96 |
| 318 | 3300021361 | Ga0213872_10098707 | Ga0213872_100987072 | 96 |
| 319 | 3300021388 | Ga0213875_10074650 | Ga0213875_100746501 | 96 |
| 320 | 3300022467 | Ga0224712_10087822 | Ga0224712_100878221 | 96 |
| 321 | 3300025223 | Ga0207672_1007470 | Ga0207672_10074702 | 96 |
| 322 | 3300025227 | Ga0207638_1000153 | Ga0207638_10001533 | 96 |
| 323 | 3300025315 | Ga0207697_10081555 | Ga0207697_100815551 | 96 |
| 324 | 3300025321 | Ga0207656_10556789 | Ga0207656_105567891 | 96 |
| 325 | 3300025711 | Ga0207696_1088706 | Ga0207696_10887062 | 96 |
| 326 | 3300025728 | Ga0207655_1220770 | Ga0207655_12207702 | 96 |
| 327 | 3300025735 | Ga0207713_1072531 | Ga0207713_10725311 | 96 |
| 328 | 3300025885 | Ga0207653_10037231 | Ga0207653_100372312 | 96 |
| 329 | 3300025893 | Ga0207682_10054880 | Ga0207682_100548803 | 96 |
| 330 | 3300025898 | Ga0207692_10156620 | Ga0207692_101566202 | 96 |
| 331 | 3300025899 | Ga0207642_10489724 | Ga0207642_104897241 | 96 |
| 332 | 3300025900 | Ga0207710_10112322 | Ga0207710_101123221 | 96 |
| 333 | 3300025900 | Ga0207710_10193742 | Ga0207710_101937421 | 96 |
| 334 | 3300025901 | Ga0207688_10082089 | Ga0207688_100820892 | 96 |
| 335 | 3300025901 | Ga0207688_10137274 | Ga0207688_101372742 | 96 |
| 336 | 3300025903 | Ga0207680_11011083 | Ga0207680_110110831 | 96 |
| 337 | 3300025904 | Ga0207647_10066317 | Ga0207647_100663172 | 96 |
| 338 | 3300025904 | Ga0207647_10103936 | Ga0207647_101039362 | 96 |
| 339 | 3300025905 | Ga0207685_10223007 | Ga0207685_102230071 | 96 |
| 340 | 3300025907 | Ga0207645_10040226 | Ga0207645_100402263 | 96 |
| 341 | 3300025909 | Ga0207705_10236433 | Ga0207705_102364332 | 96 |
| 342 | 3300025914 | Ga0207671_10287947 | Ga0207671_102879471 | 96 |
| 343 | 3300025915 | Ga0207693_10100059 | Ga0207693_101000593 | 96 |
| 344 | 3300025915 | Ga0207693_10247518 | Ga0207693_102475182 | 96 |
| 345 | 3300025917 | Ga0207660_10737579 | Ga0207660_107375791 | 96 |
| 346 | 3300025918 | Ga0207662_10071756 | Ga0207662_100717562 | 96 |
| 347 | 3300025919 | Ga0207657_10268813 | Ga0207657_102688131 | 96 |
| 348 | 3300025920 | Ga0207649_11217052 | Ga0207649_112170521 | 96 |
| 349 | 3300025921 | Ga0207652_10346752 | Ga0207652_103467523 | 96 |
| 350 | 3300025921 | Ga0207652_10374969 | Ga0207652_103749691 | 96 |
| 351 | 3300025922 | Ga0207646_10137071 | Ga0207646_101370712 | 96 |
| 352 | 3300025923 | Ga0207681_10312639 | Ga0207681_103126392 | 96 |
| 353 | 3300025923 | Ga0207681_10910270 | Ga0207681_109102702 | 96 |
| 354 | 3300025924 | Ga0207694_11047996 | Ga0207694_110479961 | 96 |
| 355 | 3300025925 | Ga0207650_10571097 | Ga0207650_105710971 | 96 |
| 356 | 3300025926 | Ga0207659_10309972 | Ga0207659_103099722 | 96 |
| 357 | 3300025927 | Ga0207687_10291042 | Ga0207687_102910422 | 96 |
| 358 | 3300025928 | Ga0207700_10993153 | Ga0207700_109931532 | 96 |
| 359 | 3300025929 | Ga0207664_10299382 | Ga0207664_102993821 | 96 |
| 360 | 3300025931 | Ga0207644_10258521 | Ga0207644_102585212 | 96 |
| 361 | 3300025932 | Ga0207690_10277951 | Ga0207690_102779512 | 96 |
| 362 | 3300025932 | Ga0207690_10384609 | Ga0207690_103846091 | 96 |
| 363 | 3300025933 | Ga0207706_10132435 | Ga0207706_101324352 | 96 |
| 364 | 3300025934 | Ga0207686_10248530 | Ga0207686_102485302 | 96 |
| 365 | 3300025934 | Ga0207686_11244904 | Ga0207686_112449042 | 96 |
| 366 | 3300025935 | Ga0207709_10229376 | Ga0207709_102293762 | 96 |
| 367 | 3300025935 | Ga0207709_10830388 | Ga0207709_108303882 | 96 |
| 368 | 3300025936 | Ga0207670_10277341 | Ga0207670_102773412 | 96 |
| 369 | 3300025937 | Ga0207669_10214206 | Ga0207669_102142062 | 96 |
| 370 | 3300025937 | Ga0207669_10243578 | Ga0207669_102435782 | 96 |
| 371 | 3300025938 | Ga0207704_10248668 | Ga0207704_102486682 | 96 |
| 372 | 3300025938 | Ga0207704_10306501 | Ga0207704_103065012 | 96 |
| 373 | 3300025938 | Ga0207704_11988361 | Ga0207704_119883612 | 96 |
| 374 | 3300025939 | Ga0207665_10038982 | Ga0207665_100389823 | 96 |
| 375 | 3300025940 | Ga0207691_10166282 | Ga0207691_101662824 | 96 |
| 376 | 3300025940 | Ga0207691_10580315 | Ga0207691_105803152 | 96 |
| 377 | 3300025941 | Ga0207711_10343439 | Ga0207711_103434391 | 96 |
| 378 | 3300025941 | Ga0207711_10745126 | Ga0207711_107451261 | 96 |
| 379 | 3300025942 | Ga0207689_10066870 | Ga0207689_100668704 | 96 |
| 380 | 3300025942 | Ga0207689_11580914 | Ga0207689_115809141 | 96 |
| 381 | 3300025944 | Ga0207661_10946473 | Ga0207661_109464732 | 96 |
| 382 | 3300025945 | Ga0207679_10086974 | Ga0207679_100869742 | 96 |
| 383 | 3300025949 | Ga0207667_10377234 | Ga0207667_103772342 | 96 |
| 384 | 3300025949 | Ga0207667_10740838 | Ga0207667_107408382 | 96 |
| 385 | 3300025949 | Ga0207667_11762610 | Ga0207667_117626101 | 96 |
| 386 | 3300025960 | Ga0207651_11219590 | Ga0207651_112195901 | 96 |
| 387 | 3300025961 | Ga0207712_10304370 | Ga0207712_103043702 | 96 |
| 388 | 3300025961 | Ga0207712_11319545 | Ga0207712_113195452 | 96 |
| 389 | 3300025972 | Ga0207668_10199084 | Ga0207668_101990842 | 96 |
| 390 | 3300025972 | Ga0207668_10628998 | Ga0207668_106289981 | 96 |
| 391 | 3300025981 | Ga0207640_10275253 | Ga0207640_102752531 | 96 |
| 392 | 3300025986 | Ga0207658_10676048 | Ga0207658_106760481 | 96 |
| 393 | 3300025986 | Ga0207658_11161765 | Ga0207658_111617652 | 96 |
| 394 | 3300026023 | Ga0207677_10312747 | Ga0207677_103127471 | 96 |
| 395 | 3300026023 | Ga0207677_10350918 | Ga0207677_103509182 | 96 |
| 396 | 3300026041 | Ga0207639_11400179 | Ga0207639_114001791 | 96 |
| 397 | 3300026041 | Ga0207639_11433245 | Ga0207639_114332452 | 96 |
| 398 | 3300026067 | Ga0207678_10060982 | Ga0207678_100609823 | 96 |
| 399 | 3300026067 | Ga0207678_10126317 | Ga0207678_101263173 | 96 |
| 400 | 3300026075 | Ga0207708_10058563 | Ga0207708_100585633 | 96 |
| 401 | 3300026078 | Ga0207702_10417970 | Ga0207702_104179701 | 96 |
| 402 | 3300026078 | Ga0207702_10583315 | Ga0207702_105833152 | 96 |
| 403 | 3300026088 | Ga0207641_10419221 | Ga0207641_104192212 | 96 |
| 404 | 3300026088 | Ga0207641_11656468 | Ga0207641_116564682 | 96 |
| 405 | 3300026089 | Ga0207648_10082259 | Ga0207648_100822592 | 96 |
| 406 | 3300026095 | Ga0207676_10388090 | Ga0207676_103880902 | 96 |
| 407 | 3300026116 | Ga0207674_10250405 | Ga0207674_102504053 | 96 |
| 408 | 3300026116 | Ga0207674_12219864 | Ga0207674_122198642 | 96 |
| 409 | 3300026118 | Ga0207675_100120172 | Ga0207675_1001201721 | 96 |
| 410 | 3300026121 | Ga0207683_10640147 | Ga0207683_106401472 | 96 |
| 411 | 3300026121 | Ga0207683_12031967 | Ga0207683_120319671 | 96 |
| 412 | 3300026142 | Ga0207698_10275068 | Ga0207698_102750682 | 96 |
| 413 | 3300026142 | Ga0207698_11333986 | Ga0207698_113339862 | 96 |
| 414 | 3300027512 | Ga0209179_1017980 | Ga0209179_10179802 | 96 |
| 415 | 3300028379 | Ga0268266_10355434 | Ga0268266_103554341 | 96 |
| 416 | 3300028380 | Ga0268265_10366655 | Ga0268265_103666551 | 96 |
| 417 | 3300028381 | Ga0268264_10415480 | Ga0268264_104154801 | 96 |
| 418 | 3300028381 | Ga0268264_12026609 | Ga0268264_120266092 | 96 |
| 419 | 3300028558 | Ga0265326_10201441 | Ga0265326_102014411 | 96 |
| 420 | 3300028573 | Ga0265334_10061749 | Ga0265334_100617492 | 96 |
| 421 | 3300028577 | Ga0265318_10044751 | Ga0265318_100447513 | 96 |
| 422 | 3300028666 | Ga0265336_10039803 | Ga0265336_100398032 | 96 |
| 423 | 3300028800 | Ga0265338_10071206 | Ga0265338_100712065 | 96 |
| 424 | 3300031235 | Ga0265330_10033908 | Ga0265330_100339083 | 96 |
| 425 | 3300031240 | Ga0265320_10113188 | Ga0265320_101131882 | 96 |
| 426 | 3300031241 | Ga0265325_10019975 | Ga0265325_100199752 | 96 |
| 427 | 3300031247 | Ga0265340_10098644 | Ga0265340_100986442 | 96 |
| 428 | 3300031249 | Ga0265339_10121880 | Ga0265339_101218802 | 96 |
| 429 | 3300031250 | Ga0265331_10153412 | Ga0265331_101534122 | 96 |
| 430 | 3300031344 | Ga0265316_10256572 | Ga0265316_102565721 | 96 |
| 431 | 3300031456 | Ga0307513_10056093 | Ga0307513_100560934 | 96 |
| 432 | 3300031548 | Ga0307408_100279968 | Ga0307408_1002799683 | 96 |
| 433 | 3300031595 | Ga0265313_10045990 | Ga0265313_100459901 | 96 |
| 434 | 3300031649 | Ga0307514_10300690 | Ga0307514_103006902 | 96 |
| 435 | 3300031711 | Ga0265314_10127269 | Ga0265314_101272691 | 96 |
| 436 | 3300031712 | Ga0265342_10062355 | Ga0265342_100623552 | 96 |
| 437 | 3300031824 | Ga0307413_11089330 | Ga0307413_110893302 | 96 |
| 438 | 3300031824 | Ga0307413_11922460 | Ga0307413_119224602 | 96 |
| 439 | 3300031852 | Ga0307410_11205264 | Ga0307410_112052642 | 96 |
| 440 | 3300031903 | Ga0307407_10103387 | Ga0307407_101033872 | 96 |
| 441 | 3300031911 | Ga0307412_10244790 | Ga0307412_102447901 | 96 |
| 442 | 3300031995 | Ga0307409_100184205 | Ga0307409_1001842051 | 96 |
| 443 | 3300032002 | Ga0307416_100328512 | Ga0307416_1003285123 | 96 |
| 444 | 3300032004 | Ga0307414_10821845 | Ga0307414_108218452 | 96 |
| 445 | 3300032005 | Ga0307411_10588495 | Ga0307411_105884952 | 96 |
| 446 | 3300034816 | Ga0373930_0033927 | Ga0373930_0033927_35_325 | 96 |
| 447 | 3300034817 | Ga0373948_0164388 | Ga0373948_0164388_223_513 | 96 |
| 448 | 3300034818 | Ga0373950_0019818 | Ga0373950_0019818_790_1080 | 96 |
| 449 | 3300034818 | Ga0373950_0117473 | Ga0373950_0117473_83_373 | 96 |
| 450 | 3300034820 | Ga0373959_0023941 | Ga0373959_0023941_829_1119 | 96 |
| 451 | 3300034957 | Ga0373938_0020755 | Ga0373938_0020755_974_1264 | 96 |
| 452 | 3300035085 | Ga0373929_0014861 | Ga0373929_0014861_1022_1312 | 96 |
| 453 | 3300035088 | Ga0373940_0050572 | Ga0373940_0050572_104_394 | 96 |
| 454 | 3300035090 | Ga0373949_0028601 | Ga0373949_0028601_997_1287 | 96 |
| 455 | 3300035092 | Ga0373952_0014194 | Ga0373952_0014194_67_357 | 96 |
| 456 | 3300035092 | Ga0373952_0021312 | Ga0373952_0021312_974_1264 | 96 |
| 457 | 3300035112 | Ga0373932_0048120 | Ga0373932_0048120_928_1218 | 96 |
| 458 | 3300035112 | Ga0373932_0125257 | Ga0373932_0125257_205_495 | 96 |
| 459 | 3300035114 | Ga0373939_0015306 | Ga0373939_0015306_1529_1819 | 96 |
| 460 | 3300035114 | Ga0373939_0092926 | Ga0373939_0092926_138_428 | 96 |
| 461 | 3300035115 | Ga0373941_0038204 | Ga0373941_0038204_1048_1338 | 96 |
| 462 | 3300035121 | Ga0373960_0004501 | Ga0373960_0004501_666_956 | 96 |
| 463 | 3300035121 | Ga0373960_0234204 | Ga0373960_0234204_277_567 | 96 |
| 464 | 3300035207 | Ga0373942_0068116 | Ga0373942_0068116_666_956 | 96 |
| 465 | 3300035241 | Ga0373961_0369529 | Ga0373961_0369529_135_425 | 96 |
| 466 | 3300035242 | Ga0373962_0038247 | Ga0373962_0038247_1015_1305 | 96 |
| 467 | 3300035691 | Ga0373931_0052933 | Ga0373931_0052933_170_460 | 96 |
| 468 | 3300035691 | Ga0373931_0156019 | Ga0373931_0156019_130_420 | 96 |
| 469 | 3300037853 | Ga0436364_0124370 | Ga0436364_0124370_148_438 | 96 |
| 470 | 3300039447 | Ga0436361_0521444 | Ga0436361_0521444_1051_1341 | 96 |
| 471 | 3300039453 | Ga0436362_0656493 | Ga0436362_0656493_633_923 | 96 |
| 472 | 3300041459 | Ga0451800_0771541 | Ga0451800_0771541_644_934 | 96 |
| 473 | 3300041462 | Ga0451806_714643 | Ga0451806_714643_246_536 | 96 |
| 474 | 3300041509 | Ga0451843_0348584 | Ga0451843_0348584_926_1216 | 96 |
| 475 | 3300042993 | Ga0439440_0227707 | Ga0439440_0227707_101_391 | 96 |
| 476 | 3300044658 | Ga0466972_0580419 | Ga0466972_0580419_153_449 | 96 |
| 477 | 3300046455 | Ga0495603_0108437 | Ga0495603_0108437_1261_1554 | 96 |
| 478 | 3300046457 | Ga0495590_0252187 | Ga0495590_0252187_66_356 | 96 |
| 479 | 3300046459 | Ga0495629_1046103 | Ga0495629_1046103_11_301 | 96 |
| 480 | 3300046461 | Ga0495641_0058220 | Ga0495641_0058220_534_827 | 96 |
| 481 | 3300046472 | Ga0495580_0171870 | Ga0495580_0171870_1005_1298 | 96 |
| 482 | 3300046472 | Ga0495580_0221368 | Ga0495580_0221368_55_348 | 96 |
| 483 | 3300046473 | Ga0495582_0088558 | Ga0495582_0088558_1236_1529 | 96 |
| 484 | 3300046475 | Ga0495639_0042681 | Ga0495639_0042681_1403_1696 | 96 |
| 485 | 3300046491 | Ga0495584_0081525 | Ga0495584_0081525_173_463 | 96 |
| 486 | 3300046499 | Ga0495594_0080833 | Ga0495594_0080833_1140_1433 | 96 |
| 487 | 3300046499 | Ga0495594_0147371 | Ga0495594_0147371_105_395 | 96 |
| 488 | 3300046513 | Ga0495616_0341366 | Ga0495616_0341366_163_453 | 96 |
| 489 | 3300046515 | Ga0495620_0067948 | Ga0495620_0067948_378_668 | 96 |
| 490 | 3300046518 | Ga0495631_0314486 | Ga0495631_0314486_362_652 | 96 |
| 491 | 3300046519 | Ga0495632_0523989 | Ga0495632_0523989_210_500 | 96 |
| 492 | 3300046525 | Ga0495663_0222149 | Ga0495663_0222149_129_419 | 96 |
| 493 | 3300046526 | Ga0495666_0060074 | Ga0495666_0060074_1175_1468 | 96 |
| 494 | 3300046531 | Ga0495665_0140667 | Ga0495665_0140667_901_1194 | 96 |
| 495 | 3300046531 | Ga0495665_0424262 | Ga0495665_0424262_19_312 | 96 |
| 496 | 3300046557 | Ga0495622_0268006 | Ga0495622_0268006_77_370 | 96 |
| 497 | 3300046616 | Ga0495668_0131607 | Ga0495668_0131607_932_1222 | 96 |
| 498 | 3300046681 | Ga0495647_0064966 | Ga0495647_0064966_1100_1393 | 96 |
| 499 | 3300046681 | Ga0495647_0590591 | Ga0495647_0590591_120_413 | 96 |
| 500 | 3300046683 | Ga0495658_0101956 | Ga0495658_0101956_277_570 | 96 |
| 501 | 3300046683 | Ga0495658_0808464 | Ga0495658_0808464_239_529 | 96 |
| 502 | 3300046684 | Ga0495669_0109460 | Ga0495669_0109460_109_399 | 96 |
| 503 | 3300046690 | Ga0495624_0565721 | Ga0495624_0565721_53_346 | 96 |
| 504 | 3300046691 | Ga0495670_0103756 | Ga0495670_0103756_184_474 | 96 |
| 505 | 3300046692 | Ga0495671_0473169 | Ga0495671_0473169_284_574 | 96 |
| 506 | 3300047315 | Ga0495581_0124860 | Ga0495581_0124860_1157_1450 | 96 |
| 507 | 3300047320 | Ga0495672_0121296 | Ga0495672_0121296_86_376 | 96 |
| 508 | 3300047321 | Ga0495676_0542327 | Ga0495676_0542327_89_382 | 96 |
| 509 | 3300048903 | Ga0496100_0128028 | Ga0496100_0128028_1133_1423 | 96 |
| 510 | 3300048903 | Ga0496100_0815144 | Ga0496100_0815144_304_594 | 96 |
| 511 | 3300048905 | Ga0496102_0460512 | Ga0496102_0460512_732_1022 | 96 |
| 512 | 3300048906 | Ga0496103_0933924 | Ga0496103_0933924_119_409 | 96 |
| 513 | 3300048907 | Ga0496104_0119740 | Ga0496104_0119740_2128_2418 | 96 |
| 514 | 3300048907 | Ga0496104_1238283 | Ga0496104_1238283_310_603 | 96 |
| 515 | 3300048908 | Ga0496105_0262963 | Ga0496105_0262963_104_397 | 96 |
| 516 | 3300048909 | Ga0496106_0304444 | Ga0496106_0304444_932_1222 | 96 |
| 517 | 3300048909 | Ga0496106_0456782 | Ga0496106_0456782_68_433 | 96 |
| 518 | 3300048912 | Ga0496109_0383306 | Ga0496109_0383306_104_397 | 96 |
| 519 | 3300048912 | Ga0496109_0510361 | Ga0496109_0510361_704_994 | 96 |
| 520 | 3300048913 | Ga0496110_1412563 | Ga0496110_1412563_217_507 | 96 |
| 521 | 3300048914 | Ga0496111_0065151 | Ga0496111_0065151_2295_2585 | 96 |
| 522 | 3300048915 | Ga0496112_0387234 | Ga0496112_0387234_939_1229 | 96 |
| 523 | 3300048916 | Ga0496113_0121140 | Ga0496113_0121140_119_409 | 96 |
| 524 | 3300048917 | Ga0496114_1554904 | Ga0496114_1554904_84_374 | 96 |
| 525 | 3300048918 | Ga0496115_0170941 | Ga0496115_0170941_838_1128 | 96 |
| 526 | 3300048918 | Ga0496115_0443914 | Ga0496115_0443914_402_692 | 96 |
| 527 | 3300048922 | Ga0496119_0371945 | Ga0496119_0371945_329_619 | 96 |
| 528 | 3300048923 | Ga0496120_0446376 | Ga0496120_0446376_186_476 | 96 |
| 529 | 3300048929 | Ga0496126_1287282 | Ga0496126_1287282_122_412 | 96 |
| 530 | 3300049568 | Ga0501031_0078107 | Ga0501031_0078107_75_368 | 96 |
| 531 | 3300049568 | Ga0501031_0163849 | Ga0501031_0163849_108_398 | 96 |
| 532 | 3300049569 | Ga0501032_0132811 | Ga0501032_0132811_1002_1295 | 96 |
| 533 | 3300049569 | Ga0501032_0172144 | Ga0501032_0172144_135_425 | 96 |
| 534 | 3300049570 | Ga0501033_0031585 | Ga0501033_0031585_3637_3930 | 96 |
| 535 | 3300049570 | Ga0501033_0205047 | Ga0501033_0205047_76_366 | 96 |
| 536 | 3300049571 | Ga0501034_0302655 | Ga0501034_0302655_88_378 | 96 |
| 537 | 3300049571 | Ga0501034_1394622 | Ga0501034_1394622_140_433 | 96 |
| 538 | 3300049572 | Ga0501036_0146601 | Ga0501036_0146601_1590_1880 | 96 |
| 539 | 3300049573 | Ga0501037_0164713 | Ga0501037_0164713_267_557 | 96 |
| 540 | 3300049573 | Ga0501037_0167701 | Ga0501037_0167701_1213_1506 | 96 |
| 541 | 3300049574 | Ga0501038_0197053 | Ga0501038_0197053_1208_1501 | 96 |
| 542 | 3300049574 | Ga0501038_0458340 | Ga0501038_0458340_568_858 | 96 |
| 543 | 3300049574 | Ga0501038_0777598 | Ga0501038_0777598_169_459 | 96 |
| 544 | 3300049575 | Ga0501039_0179954 | Ga0501039_0179954_126_419 | 96 |
| 545 | 3300049575 | Ga0501039_0873613 | Ga0501039_0873613_302_592 | 96 |
| 546 | 3300049579 | Ga0501043_0187526 | Ga0501043_0187526_1120_1413 | 96 |
| 547 | 3300049579 | Ga0501043_0259319 | Ga0501043_0259319_986_1276 | 96 |
| 548 | 3300049580 | Ga0501046_0188801 | Ga0501046_0188801_209_499 | 96 |
| 549 | 3300049580 | Ga0501046_0682328 | Ga0501046_0682328_288_581 | 96 |
| 550 | 3300049581 | Ga0501047_0203658 | Ga0501047_0203658_1488_1781 | 96 |
| 551 | 3300049581 | Ga0501047_0242088 | Ga0501047_0242088_231_521 | 96 |
| 552 | 3300049582 | Ga0501048_0181283 | Ga0501048_0181283_675_965 | 96 |
| 553 | 3300049585 | Ga0501069_0143450 | Ga0501069_0143450_91_384 | 96 |
| 554 | 3300049586 | Ga0501070_0003549 | Ga0501070_0003549_1703_1993 | 96 |
| 555 | 3300049586 | Ga0501070_0142184 | Ga0501070_0142184_491_784 | 96 |
| 556 | 3300049586 | Ga0501070_0257124 | Ga0501070_0257124_34_336 | 96 |
| 557 | 3300049589 | Ga0501073_0192574 | Ga0501073_0192574_1048_1338 | 96 |
| 558 | 3300049589 | Ga0501073_0224335 | Ga0501073_0224335_109_399 | 96 |
| 559 | 3300049590 | Ga0501074_0207629 | Ga0501074_0207629_123_416 | 96 |
| 560 | 3300049590 | Ga0501074_0248316 | Ga0501074_0248316_54_347 | 96 |
| 561 | 3300049742 | Ga0501080_0001972 | Ga0501080_0001972_5913_6203 | 96 |
| 562 | 3300049822 | Ga0501035_0021491 | Ga0501035_0021491_4583_4873 | 96 |
| 563 | 3300049822 | Ga0501035_0221432 | Ga0501035_0221432_53_346 | 96 |
| 564 | 3300049823 | Ga0501044_0037065 | Ga0501044_0037065_339_629 | 96 |
| 565 | 3300049823 | Ga0501044_0061790 | Ga0501044_0061790_1953_2246 | 96 |
| 566 | 3300049823 | Ga0501044_0321054 | Ga0501044_0321054_920_1210 | 96 |
| 567 | 3300050491 | nmdc:mga00v17_906517_c1 | nmdc:mga00v17_906517_c1_131_421 | 96 |
| 568 | 3300050492 | nmdc:mga0yw44_268358_c1 | nmdc:mga0yw44_268358_c1_789_1079 | 96 |
| 569 | 3300050492 | nmdc:mga0yw44_777746_c1 | nmdc:mga0yw44_777746_c1_100_390 | 96 |
| 570 | 3300053083 | Ga0495655_0108378 | Ga0495655_0108378_120_410 | 96 |
| 571 | 3300053087 | Ga0500643_035625 | Ga0500643_035625_170_460 | 96 |
| 572 | 3300053156 | Ga0500622_0027519 | Ga0500622_0027519_77_367 | 96 |
| 573 | 3300053156 | Ga0500622_0109273 | Ga0500622_0109273_140_430 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pax-assembly1.cif.gz_A | crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions | 0.868 | 4 | 50 |
| 8b4h-assembly1.cif.gz_D | ista transposase cleaved donor complex | 0.855 | 7 | 45 |
| 1mdm-assembly1.cif.gz_A | inhibited fragment of ets-1 and paired domain of pax5 bound to dna | 0.8525 | 4 | 51 |
| 5vxn-assembly1.cif.gz_B | structure of two rcsb dimers bound to two parallel dnas. | 0.8383 | 13 | 53 |
| 1l3l-assembly2.cif.gz_C | crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna | 0.8318 | 13 | 53 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f8mB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9162 | 25 | 52 | 1.10.10.10 |
| af_A0A0P0Y3M7_58_149_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.9081 | 6 | 46 | 1.10.472.10 |
| af_O06371_1_115_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.88 | 11 | 46 | 1.10.10.60 |
| 6paxA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.868 | 4 | 50 | 1.10.10.10 |
| af_Q21972_79_144_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8601 | 4 | 50 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0JKD6-F1-model_v4 | Transposase of ISAar25, IS3 family, IS3 group, orfA | 0.9677 | 1 | 48 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A2A5B8Y1-F1-model_v4 | Transposase | 0.9597 | 1 | 46 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-F9PKP1-F1-model_v4 | Transposase | 0.9534 | 4 | 54 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A6L5FCC8-F1-model_v4 | Transposase | 0.9496 | 1 | 54 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A1X3L1X3-F1-model_v4 | deleted | 0.9487 | 1 | 56 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar