F465259

General Info

Members Datasets Scaffolds Average Seq Length
573 328 513 430

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919704043|2919707089
Length 459
Sequence AVPVRLSTLDPNFESQFAARLHWAADTDAAIEHRVADILADVQKRGDAAVLAYTERFDGLAAGQVSELELTQSDFKTAFDALPVAQKAALEAAARRVRSYHEAQKKAGGESWSYRDEDGTLLGQKVTPLDRVGIYVPGGKAAYPSSLIMNAVPAHVAGVQEIIMVVPTPVRGSVATGGSGATTATRGERNELVLAAAYVAGVTRAFTIGGAQAVAALAYGTETVPKVDKITGPGNAYVASAKKRVFGTVGIDMIAGPSEILVLADGSTPAEWVAMDLFSQAEHDELAQSILLCPDAAYIEEVQRAIDRLLPTMPRAAIIAKSLNDRGALIHTRSMEEACAISNRIAPEHLEISSDDPHRWEPLLKHAGAIFLGAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSQAGAQSLGVIAAEMAYGEGLQAHARAAELRLDTVPPMRGGA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
18 2643221658 Variovorax sp. Root411 Isolate Unclassified
19 2643221660 Methylibium sp. Root1272 Isolate Unclassified
20 2643221672 Variovorax sp. Root434 Isolate Unclassified
21 2643221717 Acidovorax sp. Root267 Isolate Unclassified
22 2721755523 Delftia sp. HK171 Isolate Unclassified
23 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
24 2738541277 Variovorax sp. GV051 Isolate Unclassified
25 2738541307 Variovorax sp. GV008 Isolate Unclassified
26 2738543012 Acidovorax sp. CF301 Isolate Unclassified
27 2738543019 Variovorax sp. GV040 Isolate Unclassified
28 2816332133 Acidovorax radicis 2721A Isolate Unclassified
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
31 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
32 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
33 2842677519 Variovorax sp. R-72495 Isolate Unclassified
34 2842733646 Variovorax sp. R-72446 Isolate Unclassified
35 2842747753 Variovorax sp. R-72060 Isolate Unclassified
36 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
37 2885198086 Variovorax sp. 679 Isolate Unclassified
38 2885211737 Variovorax sp. 553 Isolate Unclassified
39 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
40 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
41 2899924645 Variovorax sp. 369 Isolate Unclassified
42 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
43 2904456579 Variovorax sp. 2002 Isolate Unclassified
44 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
45 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
46 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
47 2928037797 Variovorax sp. 1126 Isolate Unclassified
48 2928044640 Variovorax sp. 1128 Isolate Unclassified
49 2928051484 Variovorax sp. 1133 Isolate Unclassified
50 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
51 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
52 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
53 2929520902 Variovorax beijingensis 502 Isolate Unclassified
54 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
55 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
56 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
57 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
58 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
59 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
60 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
61 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
62 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
63 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
64 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
65 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
66 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
67 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
68 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
69 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
70 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
71 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
72 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
73 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
74 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
75 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
76 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
81 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
82 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
83 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
84 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
85 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
86 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
87 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
88 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
98 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
99 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
100 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
121 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
209 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
241 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
242 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
304 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
319 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
320 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
325 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 0
Isolates 10.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.51
Nodule 1.22
Rhizoplane 1.75
Rhizosphere 48.17
Stem 0
Stem Tuber 0
Unclassified 15.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000022 3300002704 Bacteria 142950
2 JGI25156J39149_1000005 3300002705 Bacteria 263980
3 JGI25156J39149_1000403 3300002705 Bacteria 27092
4 JGI25154J39366_1000017 3300002738 Bacteria 252448
5 JGI25154J39366_1001215 3300002738 Bacteria 9751
6 JGI25157J39369_1000003 3300002741 Bacteria 274935
7 JGI25157J39369_1000008 3300002741 Bacteria 211083
8 JGI25152J39213_1000516 3300002773 Bacteria 21501
9 JGI25150J39212_1001212 3300002774 Bacteria 7609
10 JGI25150J39212_1001998 3300002774 Bacteria 5328
11 JGI25159J45721_1001840 3300002987 Bacteria 8476
12 JGI25151J46595_10004893 3300003187 Bacteria 6996
13 JGI25151J46595_10004998 3300003187 Bacteria 6911
14 JGI25151J46595_10006367 3300003187 Bacteria 5942
15 JGI25151J46595_10007286 3300003187 Bacteria 5442
16 JGI25153J46596_10002374 3300003215 Bacteria 10904
17 rootL2_10020595 3300003322 Bacteria 7441
18 Ga0055539_1000255 3300003752 Bacteria 34096
19 Ga0055533_1000040 3300003756 Bacteria 242927
20 Ga0055525_1000031 3300003759 Bacteria 314909
21 Ga0055525_1001111 3300003759 Bacteria 6611
22 Ga0055535_1000052 3300003761 Bacteria 132513
23 Ga0055535_1000966 3300003761 Bacteria 18756
24 Ga0055542_1000080 3300003762 Bacteria 129634
25 Ga0055529_1000053 3300003763 Bacteria 198996
26 Ga0055526_1003196 3300003771 Bacteria 10598
27 Ga0055526_1003957 3300003771 Bacteria 9142
28 Ga0055526_1014420 3300003771 Bacteria 3252
29 Ga0055526_1014478 3300003771 Bacteria 3242
30 Ga0055537_1000150 3300003773 Bacteria 52097
31 Ga0055537_1000205 3300003773 Bacteria 44266
32 Ga0055524_1000073 3300003775 Bacteria 123033
33 Ga0055524_1003013 3300003775 Bacteria 8348
34 Ga0055524_1005814 3300003775 Bacteria 5447
35 Ga0055524_1005838 3300003775 Bacteria 5433
36 Ga0055524_1007894 3300003775 Bacteria 4471
37 Ga0055536_1008669 3300003781 Bacteria 4327
38 Ga0055534_1000016 3300003784 Bacteria 144444
39 Ga0055528_1000894 3300003790 Bacteria 20125
40 Ga0055528_1002836 3300003790 Bacteria 9062
41 Ga0055530_10000848 3300003791 Bacteria 25191
42 Ga0055530_10005116 3300003791 Bacteria 6409
43 Ga0055540_1000037 3300003792 Bacteria 162957
44 Ga0055540_1005560 3300003792 Bacteria 5259
45 Ga0055540_1005600 3300003792 Bacteria 5227
46 Ga0055540_1009672 3300003792 Bacteria 3298
47 Ga0055531_10001826 3300003794 Bacteria 15080
48 Ga0055531_10002177 3300003794 Bacteria 13374
49 Ga0055543_1003131 3300004625 Bacteria 5062
50 Ga0055543_1005258 3300004625 Bacteria 3337
51 Ga0055543_1005454 3300004625 Bacteria 3240
52 Ga0065165_1000170 3300005262 Bacteria 115389
53 Ga0065165_1000521 3300005262 Bacteria 58807
54 Ga0065165_1002331 3300005262 Bacteria 16569
55 Ga0065165_1006524 3300005262 Bacteria 6083
56 Ga0065165_1022205 3300005262 Bacteria 2183
57 Ga0065704_10074875 3300005289 Bacteria 5943
58 Ga0070682_100075557 3300005337 Bacteria 2167
59 Ga0068868_100051527 3300005338 Bacteria 3238
60 Ga0070660_100010089 3300005339 Bacteria 6665
61 Ga0070689_100025052 3300005340 Bacteria 4480
62 Ga0070675_100034538 3300005354 Bacteria 4105
63 Ga0070673_100053908 3300005364 Bacteria 3161
64 Ga0070688_100075566 3300005365 Bacteria 2166
65 Ga0070667_100032234 3300005367 Bacteria 4370
66 Ga0070667_100111448 3300005367 Bacteria 2373
67 Ga0070667_100157438 3300005367 Bacteria 1999
68 Ga0070663_100000113 3300005455 Bacteria 37716
69 Ga0070678_100107221 3300005456 Bacteria 2178
70 Ga0070662_100018849 3300005457 Bacteria 4675
71 Ga0070662_100019538 3300005457 Bacteria 4600
72 Ga0070706_100000700 3300005467 Bacteria 37931
73 Ga0070706_100053666 3300005467 Bacteria 3720
74 Ga0070672_100122941 3300005543 Bacteria 2126
75 Ga0068855_100006806 3300005563 Bacteria 13869
76 Ga0068855_100171401 3300005563 Bacteria 2458
77 Ga0068855_100242571 3300005563 Bacteria 2013
78 Ga0068857_100013938 3300005577 Bacteria 6996
79 Ga0068854_100017693 3300005578 Bacteria 4774
80 Ga0068856_100009632 3300005614 Bacteria 9377
81 Ga0068852_100141725 3300005616 Bacteria 2225
82 Ga0068864_100002948 3300005618 Bacteria 14063
83 Ga0068864_100175333 3300005618 Bacteria 1957
84 Ga0068863_100076127 3300005841 Bacteria 3175
85 Ga0068860_100060272 3300005843 Bacteria 3607
86 Ga0075365_10153478 3300006038 Bacteria 1602
87 Ga0075368_10016485 3300006042 Bacteria 2754
88 Ga0075363_100002569 3300006048 Bacteria 7462
89 Ga0075363_100035663 3300006048 Bacteria 2605
90 Ga0075364_10008008 3300006051 Bacteria 6298
91 Ga0075364_10010221 3300006051 Bacteria 5661
92 Ga0075432_10002614 3300006058 Bacteria 6016
93 Ga0075362_10055049 3300006177 Bacteria 1789
94 Ga0075369_10043960 3300006186 Bacteria 1918
95 Ga0075366_10001287 3300006195 Bacteria 12501
96 Ga0075366_10011144 3300006195 Bacteria 5068
97 Ga0075366_10011179 3300006195 Bacteria 5061
98 Ga0075366_10011876 3300006195 Bacteria 4928
99 Ga0075366_10051354 3300006195 Bacteria 2450
100 Ga0075366_10070791 3300006195 Bacteria 2077
101 Ga0075370_10000133 3300006353 Bacteria 24995
102 Ga0075370_10000304 3300006353 Bacteria 17728
103 Ga0075370_10001450 3300006353 Bacteria 10303
104 Ga0075370_10002475 3300006353 Bacteria 8564
105 Ga0075370_10004243 3300006353 Bacteria 6935
106 Ga0075370_10006690 3300006353 Bacteria 5815
107 Ga0075370_10012919 3300006353 Bacteria 4426
108 Ga0075370_10017319 3300006353 Bacteria 3893
109 Ga0075370_10032627 3300006353 Bacteria 2912
110 Ga0075370_10046027 3300006353 Bacteria 2468
111 Ga0075370_10065374 3300006353 Bacteria 2074
112 Ga0075429_100005760 3300006880 Bacteria 10698
113 Ga0099823_1000155 3300006944 Bacteria 36540
114 Ga0099826_10000101 3300006948 Bacteria 40408
115 Ga0099794_10023374 3300007265 Bacteria 2826
116 Ga0105244_10010520 3300009036 Bacteria 5606
117 Ga0105240_10004767 3300009093 Bacteria 20470
118 Ga0105240_10006365 3300009093 Bacteria 17386
119 Ga0105240_10194087 3300009093 Bacteria 2386
120 Ga0105240_10364671 3300009093 Bacteria 1635
121 Ga0111539_10113810 3300009094 Bacteria 3173
122 Ga0105243_10202787 3300009148 Bacteria 1741
123 Ga0105242_10000553 3300009176 Bacteria 29613
124 Ga0105237_10001363 3300009545 Bacteria 32325
125 Ga0105237_10393674 3300009545 Bacteria 1390
126 Ga0105239_10000954 3300010375 Bacteria 40769
127 Ga0105239_10026451 3300010375 Bacteria 6385
128 Ga0105239_10037942 3300010375 Bacteria 5280
129 Ga0105239_10111545 3300010375 Bacteria 3032
130 Ga0163162_10097105 3300013306 Bacteria 3035
131 Ga0157375_10101519 3300013308 Bacteria 2960
132 Ga0182008_10001633 3300014497 Bacteria 14849
133 Ga0182008_10005156 3300014497 Bacteria 7495
134 Ga0182008_10006253 3300014497 Bacteria 6690
135 Ga0157377_10004975 3300014745 Bacteria 6198
136 Ga0157376_10061677 3300014969 Bacteria 3153
137 Ga0182006_1006614 3300015261 Bacteria 5367
138 Ga0182007_10000853 3300015262 Bacteria 16919
139 Ga0163161_10001891 3300017792 Bacteria 15283
140 Ga0163161_10015556 3300017792 Bacteria 5306
141 Ga0213872_10000175 3300021361 Bacteria 57086
142 Ga0213872_10001003 3300021361 Bacteria 19713
143 Ga0213872_10003975 3300021361 Bacteria 7972
144 Ga0213872_10011567 3300021361 Bacteria 4174
145 Ga0209435_100002 3300025206 Bacteria 794178
146 Ga0209674_100066 3300025226 Bacteria 256739
147 Ga0209672_100378 3300025228 Bacteria 27209
148 Ga0209147_100696 3300025229 Bacteria 17227
149 Ga0209563_100044 3300025230 Bacteria 396812
150 Ga0209563_100107 3300025230 Bacteria 143807
151 Ga0207427_100266 3300025231 Bacteria 40361
152 Ga0209258_100074 3300025242 Bacteria 271062
153 Ga0209258_100093 3300025242 Bacteria 223559
154 Ga0209258_100489 3300025242 Bacteria 40371
155 Ga0207425_1001221 3300025245 Bacteria 11309
156 Ga0207425_1002855 3300025245 Bacteria 5807
157 Ga0209646_1000001 3300025246 Bacteria 3092932
158 Ga0209646_1000039 3300025246 Bacteria 349637
159 Ga0209026_1000001 3300025250 Bacteria 1228671
160 Ga0209026_1000006 3300025250 Bacteria 677225
161 Ga0209677_100052 3300025253 Bacteria 167826
162 Ga0209677_100914 3300025253 Bacteria 14434
163 Ga0209677_103358 3300025253 Bacteria 5254
164 Ga0209148_1000007 3300025254 Bacteria 1592273
165 Ga0209759_1000001 3300025256 Bacteria 2799452
166 Ga0209759_1000020 3300025256 Bacteria 344904
167 Ga0209759_1000909 3300025256 Bacteria 21990
168 Ga0209759_1002131 3300025256 Bacteria 9135
169 Ga0209129_1000024 3300025258 Bacteria 417268
170 Ga0209129_1000269 3300025258 Bacteria 51170
171 Ga0209129_1003815 3300025258 Bacteria 6302
172 Ga0209129_1004573 3300025258 Bacteria 5325
173 Ga0209129_1008242 3300025258 Bacteria 2931
174 Ga0209565_1000098 3300025263 Bacteria 132021
175 Ga0209565_1000128 3300025263 Bacteria 108959
176 Ga0209565_1000574 3300025263 Bacteria 24961
177 Ga0209565_1000633 3300025263 Bacteria 22947
178 Ga0209565_1003743 3300025263 Bacteria 4815
179 Ga0209455_1000066 3300025272 Bacteria 316811
180 Ga0209673_1000008 3300025273 Bacteria 626013
181 Ga0209673_1000058 3300025273 Bacteria 269028
182 Ga0209673_1002178 3300025273 Bacteria 14443
183 Ga0209673_1002449 3300025273 Bacteria 12865
184 Ga0209673_1016385 3300025273 Bacteria 2774
185 Ga0209130_1000338 3300025284 Bacteria 53907
186 Ga0209130_1000654 3300025284 Bacteria 31825
187 Ga0209130_1001114 3300025284 Bacteria 19756
188 Ga0209675_1000010 3300025291 Bacteria 541927
189 Ga0209675_1000099 3300025291 Bacteria 128911
190 Ga0209675_1000151 3300025291 Bacteria 91172
191 Ga0209675_1002776 3300025291 Bacteria 8744
192 Ga0209675_1004124 3300025291 Bacteria 6604
193 Ga0209676_1000023 3300025292 Bacteria 589732
194 Ga0209676_1000028 3300025292 Bacteria 559745
195 Ga0209025_1001904 3300025294 Bacteria 24327
196 Ga0209025_1002647 3300025294 Bacteria 18311
197 Ga0209025_1005469 3300025294 Bacteria 10341
198 Ga0209025_1006074 3300025294 Bacteria 9549
199 Ga0209025_1006765 3300025294 Bacteria 8792
200 Ga0209564_1000209 3300025295 Bacteria 133651
201 Ga0209564_1000300 3300025295 Bacteria 98386
202 Ga0209564_1002281 3300025295 Bacteria 15652
203 Ga0209564_1002522 3300025295 Bacteria 14144
204 Ga0209564_1003391 3300025295 Bacteria 10974
205 Ga0209758_1000049 3300025297 Bacteria 345104
206 Ga0209758_1000453 3300025297 Bacteria 68482
207 Ga0209758_1000605 3300025297 Bacteria 55552
208 Ga0209758_1005721 3300025297 Bacteria 9380
209 Ga0209758_1008071 3300025297 Bacteria 6941
210 Ga0209050_1000022 3300025298 Bacteria 565239
211 Ga0209050_1000072 3300025298 Bacteria 293619
212 Ga0209050_1000770 3300025298 Bacteria 46024
213 Ga0209050_1000927 3300025298 Bacteria 38487
214 Ga0209256_1000001 3300025299 Bacteria 2166974
215 Ga0209256_1000085 3300025299 Bacteria 219043
216 Ga0209256_1000088 3300025299 Bacteria 217236
217 Ga0209256_1000437 3300025299 Bacteria 64248
218 Ga0209256_1004126 3300025299 Bacteria 9396
219 Ga0207426_1000038 3300025302 Bacteria 441522
220 Ga0207426_1000053 3300025302 Bacteria 384818
221 Ga0207426_1009147 3300025302 Bacteria 3938
222 Ga0209051_1000013 3300025303 Bacteria 565239
223 Ga0209051_1000015 3300025303 Bacteria 546798
224 Ga0209051_1000056 3300025303 Bacteria 271616
225 Ga0209051_1000196 3300025303 Bacteria 107028
226 Ga0209051_1000545 3300025303 Bacteria 46076
227 Ga0209051_1001930 3300025303 Bacteria 16022
228 Ga0209051_1020755 3300025303 Bacteria 2817
229 Ga0209257_1000042 3300025304 Bacteria 537149
230 Ga0209257_1000305 3300025304 Bacteria 107001
231 Ga0209257_1000351 3300025304 Bacteria 94766
232 Ga0209257_1000479 3300025304 Bacteria 72716
233 Ga0209257_1003278 3300025304 Bacteria 14122
234 Ga0207655_1006555 3300025728 Bacteria 7689
235 Ga0207684_10004795 3300025910 Bacteria 12670
236 Ga0207695_10019943 3300025913 Bacteria 7700
237 Ga0207695_10021837 3300025913 Bacteria 7289
238 Ga0207695_10099286 3300025913 Bacteria 2909
239 Ga0207695_10109726 3300025913 Bacteria 2741
240 Ga0207671_10038827 3300025914 Bacteria 3528
241 Ga0207660_10182363 3300025917 Bacteria 1631
242 Ga0207657_10014060 3300025919 Bacteria 7832
243 Ga0207694_10022029 3300025924 Bacteria 4832
244 Ga0207659_10008745 3300025926 Bacteria 6305
245 Ga0207706_10025315 3300025933 Bacteria 5318
246 Ga0207706_10030294 3300025933 Bacteria 4827
247 Ga0207686_10027724 3300025934 Bacteria 3320
248 Ga0207709_10000111 3300025935 Bacteria 127580
249 Ga0207709_10002735 3300025935 Bacteria 10877
250 Ga0207709_10020861 3300025935 Bacteria 3701
251 Ga0207691_10021922 3300025940 Bacteria 6028
252 Ga0207689_10100258 3300025942 Bacteria 2379
253 Ga0207667_10021851 3300025949 Bacteria 7081
254 Ga0207667_10087881 3300025949 Bacteria 3215
255 Ga0207667_10177882 3300025949 Bacteria 2185
256 Ga0207667_10262842 3300025949 Bacteria 1765
257 Ga0207651_10004471 3300025960 Bacteria 7054
258 Ga0207651_10099683 3300025960 Bacteria 2152
259 Ga0207640_10007491 3300025981 Bacteria 6030
260 Ga0207658_10070704 3300025986 Bacteria 2641
261 Ga0207677_10181355 3300026023 Bacteria 1657
262 Ga0207639_10012945 3300026041 Bacteria 5820
263 Ga0207639_10137394 3300026041 Bacteria 2032
264 Ga0207678_10002401 3300026067 Bacteria 17019
265 Ga0207678_10063464 3300026067 Bacteria 3174
266 Ga0207678_10089138 3300026067 Bacteria 2637
267 Ga0207708_10064184 3300026075 Bacteria 2805
268 Ga0207702_10000310 3300026078 Bacteria 55596
269 Ga0207648_10027173 3300026089 Bacteria 5082
270 Ga0207676_10011140 3300026095 Bacteria 6421
271 Ga0207674_10025604 3300026116 Bacteria 6286
272 Ga0207683_10068465 3300026121 Bacteria 3133
273 Ga0207683_10191284 3300026121 Bacteria 1858
274 Ga0207698_10066556 3300026142 Bacteria 2837
275 Ga0209281_1000017 3300027111 Bacteria 583251
276 Ga0209389_1011713 3300027296 Bacteria 7940
277 Ga0209995_1001967 3300027471 Bacteria 3218
278 Ga0209968_1000748 3300027526 Bacteria 5008
279 Ga0209282_1001024 3300027666 Bacteria 14706
280 Ga0209966_1000008 3300027695 Bacteria 88938
281 Ga0209813_10013867 3300027866 Bacteria 2160
282 Ga0209974_10004129 3300027876 Bacteria 5190
283 Ga0209974_10006511 3300027876 Bacteria 4076
284 Ga0268266_10207653 3300028379 Bacteria 1795
285 Ga0307517_10005635 3300028786 Bacteria 18785
286 Ga0307517_10148941 3300028786 Bacteria 1613
287 Ga0307515_10000011 3300028794 Bacteria 633903
288 Ga0307515_10000084 3300028794 Bacteria 221434
289 Ga0307515_10001854 3300028794 Bacteria 47116
290 Ga0307515_10020861 3300028794 Bacteria 11649
291 Ga0307515_10041425 3300028794 Bacteria 7241
292 Ga0307515_10154903 3300028794 Bacteria 2371
293 Ga0307515_10175547 3300028794 Bacteria 2115
294 Ga0268256_1024879 3300030500 Bacteria 1530
295 Ga0307511_10045429 3300030521 Bacteria 3629
296 Ga0307512_10051338 3300030522 Bacteria 3301
297 Ga0316176_1225243 3300030732 Bacteria 2313
298 Ga0314311_1036973 3300030733 Bacteria 6291
299 Ga0316181_1050790 3300030744 Bacteria 3750
300 Ga0265332_10000027 3300031238 Bacteria 190796
301 Ga0265332_10007247 3300031238 Bacteria 5021
302 Ga0265328_10006867 3300031239 Bacteria 4781
303 Ga0265328_10011741 3300031239 Bacteria 3494
304 Ga0265331_10001682 3300031250 Bacteria 15989
305 Ga0265331_10025673 3300031250 Bacteria 2971
306 Ga0265331_10030385 3300031250 Bacteria 2690
307 Ga0265327_10000042 3300031251 Bacteria 287487
308 Ga0265327_10000320 3300031251 Bacteria 91776
309 Ga0265327_10019430 3300031251 Bacteria 4176
310 Ga0265327_10040332 3300031251 Bacteria 2527
311 Ga0265327_10044275 3300031251 Bacteria 2375
312 Ga0265316_10009418 3300031344 Bacteria 8999
313 Ga0307513_10000038 3300031456 Bacteria 174780
314 Ga0307513_10002473 3300031456 Bacteria 25565
315 Ga0307513_10136410 3300031456 Bacteria 2389
316 Ga0307509_10000063 3300031507 Bacteria 143708
317 Ga0307509_10081292 3300031507 Bacteria 3347
318 Ga0307509_10090856 3300031507 Bacteria 3127
319 Ga0307408_100000263 3300031548 Bacteria 53454
320 Ga0307408_100004302 3300031548 Bacteria 9664
321 Ga0307408_100011106 3300031548 Bacteria 5949
322 Ga0307408_100156868 3300031548 Bacteria 1803
323 Ga0307508_10000053 3300031616 Bacteria 128020
324 Ga0307508_10005254 3300031616 Bacteria 12357
325 Ga0307514_10000560 3300031649 Bacteria 71030
326 Ga0307514_10000954 3300031649 Bacteria 43472
327 Ga0307514_10010207 3300031649 Bacteria 7861
328 Ga0307514_10084913 3300031649 Bacteria 2329
329 Ga0265314_10007074 3300031711 Bacteria 9791
330 Ga0265342_10050897 3300031712 Bacteria 2472
331 Ga0307516_10000676 3300031730 Bacteria 46208
332 Ga0307516_10001245 3300031730 Bacteria 35441
333 Ga0307516_10035006 3300031730 Bacteria 5041
334 Ga0307516_10049964 3300031730 Bacteria 4105
335 Ga0307405_10021442 3300031731 Bacteria 3632
336 Ga0307405_10074982 3300031731 Bacteria 2189
337 Ga0307406_10000654 3300031901 Bacteria 19636
338 Ga0307406_10012286 3300031901 Bacteria 4882
339 Ga0307412_10009231 3300031911 Bacteria 5653
340 Ga0307409_100201659 3300031995 Bacteria 1780
341 Ga0307416_100106433 3300032002 Bacteria 2458
342 Ga0307416_100160256 3300032002 Bacteria 2079
343 Ga0307411_10193669 3300032005 Bacteria 1554
344 Ga0307510_10017213 3300033180 Bacteria 8527
345 Ga0373931_0035797 3300035691 Bacteria 2583
346 Ga0373937_0034163 3300036401 Bacteria 4625
347 Ga0395899_0001210 3300037312 Bacteria 22624
348 Ga0395899_0003316 3300037312 Bacteria 12759
349 Ga0395899_0007047 3300037312 Bacteria 8699
350 Ga0395899_0017845 3300037312 Bacteria 5403
351 Ga0395900_0034561 3300037418 Bacteria 5207
352 Ga0395900_0050324 3300037418 Bacteria 4291
353 Ga0395900_0130173 3300037418 Bacteria 2579
354 Ga0395898_0003251 3300037466 Bacteria 18262
355 Ga0395898_0034026 3300037466 Bacteria 5082
356 Ga0395905_0000027 3300037471 Bacteria 297239
357 Ga0395905_0000728 3300037471 Bacteria 43400
358 Ga0395905_0006280 3300037471 Bacteria 11985
359 Ga0395905_0011080 3300037471 Bacteria 8728
360 Ga0395905_0023393 3300037471 Bacteria 5839
361 Ga0395905_0119579 3300037471 Bacteria 2476
362 Ga0395905_0145219 3300037471 Bacteria 2232
363 Ga0395905_0161384 3300037471 Bacteria 2106
364 Ga0395905_0220403 3300037471 Bacteria 1775
365 Ga0395901_0125038 3300038443 Bacteria 2702
366 Ga0395901_0125499 3300038443 Bacteria 2697
367 Ga0395901_0138921 3300038443 Bacteria 2554
368 Ga0436361_0039667 3300039447 Bacteria 5314
369 Ga0436361_0070738 3300039447 Bacteria 27213
370 Ga0436361_0110525 3300039447 Bacteria 45343
371 Ga0436361_0433107 3300039447 Bacteria 5992
372 Ga0436361_0492952 3300039447 Bacteria 4141
373 Ga0436361_0566823 3300039447 Bacteria 2277
374 Ga0436361_0920355 3300039447 Bacteria 16590
375 Ga0436361_1151553 3300039447 Bacteria 66661
376 Ga0439436_0005938 3300041404 Bacteria 3743
377 Ga0439432_001040 3300042006 Bacteria 10528
378 Ga0439452_003432 3300042010 Bacteria 5550
379 Ga0450890_000863 3300042127 Bacteria 4375
380 Ga0439434_0004240 3300042435 Bacteria 4188
381 Ga0450918_004109 3300042531 Bacteria 2669
382 Ga0451577_0000270 3300042876 Bacteria 101581
383 Ga0451577_0012078 3300042876 Bacteria 8124
384 Ga0466969_0006251 3300044656 Bacteria 6337
385 Ga0466965_0003434 3300044683 Bacteria 6950
386 Ga0466966_0016381 3300044684 Bacteria 4898
387 Ga0466966_0018583 3300044684 Bacteria 4582
388 Ga0466961_0005878 3300044693 Bacteria 7772
389 Ga0466963_0213143 3300044694 Bacteria 1352
390 Ga0466964_0009552 3300044706 Bacteria 3656
391 Ga0466964_0065819 3300044706 Bacteria 1519
392 Ga0453684_0000040 3300044712 Bacteria 690210
393 Ga0453684_0000868 3300044712 Bacteria 101512
394 Ga0453684_0041490 3300044712 Bacteria 6222
395 Ga0453684_0061027 3300044712 Bacteria 4843
396 Ga0453684_0144005 3300044712 Bacteria 2841
397 Ga0466971_0004741 3300044719 Bacteria 5882
398 Ga0466957_0016266 3300044842 Bacteria 4350
399 Ga0466957_0138543 3300044842 Bacteria 1566
400 Ga0466959_0004682 3300045049 Bacteria 9207
401 Ga0466959_0005876 3300045049 Bacteria 8451
402 Ga0451576_0004748 3300045051 Bacteria 17449
403 Ga0451576_0040585 3300045051 Bacteria 4924
404 Ga0495627_000004 3300046453 Bacteria 640612
405 Ga0495627_001913 3300046453 Bacteria 10880
406 Ga0495592_0006972 3300046454 Bacteria 8442
407 Ga0495638_0067786 3300046460 Bacteria 2190
408 Ga0495650_0009758 3300046471 Bacteria 5432
409 Ga0495580_0145180 3300046472 Bacteria 1644
410 Ga0495585_0060106 3300046492 Bacteria 2092
411 Ga0495583_0000034 3300046506 Bacteria 246856
412 Ga0495583_0059586 3300046506 Bacteria 1710
413 Ga0495606_0001225 3300046507 Bacteria 35933
414 Ga0495616_0006125 3300046513 Bacteria 7322
415 Ga0495620_0002466 3300046515 Bacteria 10724
416 Ga0495632_0005292 3300046519 Bacteria 8572
417 Ga0495632_0015603 3300046519 Bacteria 4249
418 Ga0495632_0098915 3300046519 Bacteria 1376
419 Ga0495637_0011635 3300046520 Bacteria 4223
420 Ga0495643_0075393 3300046522 Bacteria 1765
421 Ga0495654_0037224 3300046530 Bacteria 2442
422 Ga0495597_0000516 3300046542 Bacteria 31996
423 Ga0495597_0053429 3300046542 Bacteria 1776
424 Ga0495633_0001397 3300046558 Bacteria 18813
425 Ga0495656_0000646 3300046615 Bacteria 11165
426 Ga0495668_0014233 3300046616 Bacteria 4670
427 Ga0495625_0000950 3300046660 Bacteria 38751
428 Ga0495625_0007721 3300046660 Bacteria 9310
429 Ga0495625_0049703 3300046660 Bacteria 3013
430 Ga0495625_0092649 3300046660 Bacteria 2087
431 Ga0495625_0225386 3300046660 Bacteria 1226
432 Ga0495661_0110306 3300046665 Bacteria 1534
433 Ga0495599_0220154 3300046678 Bacteria 1162
434 Ga0495646_0122864 3300046680 Bacteria 1467
435 Ga0495658_0024109 3300046683 Bacteria 3237
436 Ga0495658_0025207 3300046683 Bacteria 3177
437 Ga0495649_0000428 3300046694 Bacteria 36408
438 Ga0495649_0005989 3300046694 Bacteria 7617
439 Ga0495649_0103288 3300046694 Bacteria 1513
440 Ga0495589_0016342 3300046794 Bacteria 3815
441 Ga0495672_0000019 3300047320 Bacteria 448153
442 Ga0495683_0024285 3300047323 Bacteria 3112
443 Ga0495681_0070658 3300047470 Bacteria 1582
444 Ga0495593_0008695 3300047673 Bacteria 5900
445 Ga0495593_0012263 3300047673 Bacteria 4898
446 Ga0496101_0028202 3300048904 Bacteria 3918
447 Ga0496101_0113018 3300048904 Bacteria 2046
448 Ga0496102_0049020 3300048905 Bacteria 3841
449 Ga0496102_0079265 3300048905 Bacteria 3025
450 Ga0496104_0029955 3300048907 Bacteria 5053
451 Ga0496105_0004053 3300048908 Bacteria 10967
452 Ga0496106_0009081 3300048909 Bacteria 7347
453 Ga0496106_0045100 3300048909 Bacteria 3311
454 Ga0496109_0078520 3300048912 Bacteria 3040
455 Ga0496109_0293529 3300048912 Bacteria 1533
456 Ga0496118_0006363 3300048921 Bacteria 13016
457 Ga0496122_0000612 3300048925 Bacteria 73307
458 Ga0496123_0000274 3300048926 Bacteria 101783
459 Ga0496123_0024412 3300048926 Bacteria 4596
460 Ga0496125_0001638 3300048928 Bacteria 31567
461 Ga0496126_0154066 3300048929 Bacteria 1968
462 Ga0501031_0001576 3300049568 Bacteria 14214
463 Ga0501034_0151445 3300049571 Bacteria 2295
464 Ga0501038_0107781 3300049574 Bacteria 2311
465 Ga0501043_0000002 3300049579 Bacteria 351081
466 Ga0501046_0000008 3300049580 Bacteria 351167
467 Ga0501047_0000003 3300049581 Bacteria 508375
468 Ga0501047_0103370 3300049581 Bacteria 2729
469 Ga0501198_000024 3300049649 Bacteria 67171
470 Ga0501222_000020 3300049662 Bacteria 67164
471 Ga0501044_0004069 3300049823 Bacteria 16400
472 Ga0501045_0003417 3300049824 Bacteria 10864
473 nmdc:mga03n38_17836_c1 3300050490 Bacteria 2788
474 nmdc:mga03n38_53889_c1 3300050490 Bacteria 1806
475 nmdc:mga0k408_15012_c1 3300050493 Bacteria 4280
476 nmdc:mga0k408_213_c1 3300050493 Bacteria 31180
477 nmdc:mga0k408_2734_c1 3300050493 Bacteria 9371
478 nmdc:mga0k408_2741_c1 3300050493 Bacteria 9364
479 nmdc:mga0k408_302_c1 3300050493 Bacteria 26707
480 nmdc:mga06z11_5393_c1 3300050494 Bacteria 5126
481 nmdc:mga04h51_22746_c1 3300050495 Bacteria 1900
482 nmdc:mga07m45_2735_c1 3300050496 Bacteria 8313
483 nmdc:mga07m45_38029_c1 3300050496 Bacteria 2685
484 nmdc:mga07m45_5257_c1 3300050496 Bacteria 6430
485 nmdc:mga07m45_5336_c1 3300050496 Bacteria 6395
486 nmdc:mga07m45_5339_c1 3300050496 Bacteria 6394
487 nmdc:mga07m45_6318_c1 3300050496 Bacteria 5985
488 nmdc:mga07m45_6363_c1 3300050496 Bacteria 4415
489 nmdc:mga07m45_769_c1 3300050496 Bacteria 13783
490 nmdc:mga07m45_847_c1 3300050496 Bacteria 13276
491 nmdc:mga09592_1310_c1 3300050508 Bacteria 19982
492 nmdc:mga0sz30_9041_c1 3300050516 Bacteria 3778
493 Ga0500610_0018115 3300053079 Bacteria 3395
494 Ga0500635_0000008 3300053080 Bacteria 167327
495 Ga0500578_0000025 3300053086 Bacteria 151485
496 Ga0500651_0000347 3300053093 Bacteria 26028
497 Ga0500651_0007319 3300053093 Bacteria 6442
498 Ga0500593_000047 3300053117 Bacteria 42992
499 Ga0500593_001062 3300053117 Bacteria 9919
500 Ga0500608_053027 3300053122 Bacteria 1947
501 Ga0500652_000177 3300053131 Bacteria 24784
502 Ga0500658_0000560 3300053134 Bacteria 15661
503 Ga0500658_0000589 3300053134 Bacteria 15190
504 Ga0500658_0007141 3300053134 Bacteria 4130
505 Ga0500559_0000013 3300053136 Bacteria 163436
506 Ga0500559_0025044 3300053136 Bacteria 2539
507 Ga0500568_0006650 3300053139 Bacteria 5780
508 Ga0500604_0024081 3300053151 Bacteria 1740
509 Ga0500622_0004247 3300053156 Bacteria 9113
510 Ga0500634_0035101 3300053161 Bacteria 2732
511 Ga0500645_001112 3300053730 Bacteria 14708
512 Ga0466962_0005789 3300061719 Bacteria 5938
513 Ga0466962_0056484 3300061719 Bacteria 1874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10393674 Ga0105237_103936742 333
2 3300046694 Ga0495649_0103288 Ga0495649_0103288_25_1146 344
3 3300046472 Ga0495580_0145180 Ga0495580_0145180_22_1155 345
4 3300046492 Ga0495585_0060106 Ga0495585_0060106_952_2070 345
5 3300046519 Ga0495632_0098915 Ga0495632_0098915_22_1140 345
6 3300046542 Ga0495597_0053429 Ga0495597_0053429_646_1761 345
7 3300046660 Ga0495625_0225386 Ga0495625_0225386_82_1215 345
8 3300046665 Ga0495661_0110306 Ga0495661_0110306_352_1485 345
9 3300046678 Ga0495599_0220154 Ga0495599_0220154_19_1152 345
10 3300046794 Ga0495589_0016342 Ga0495589_0016342_39_1157 345
11 3300026067 Ga0207678_10063464 Ga0207678_100634643 346
12 3300044694 Ga0466963_0213143 Ga0466963_0213143_20_1183 361
13 3300032002 Ga0307416_100160256 Ga0307416_1001602562 365
14 3300047470 Ga0495681_0070658 Ga0495681_0070658_99_1289 367
15 3300049574 Ga0501038_0107781 Ga0501038_0107781_471_1775 368
16 3300049823 Ga0501044_0004069 Ga0501044_0004069_10432_11736 368
17 3300053117 Ga0500593_000047 Ga0500593_000047_3552_4871 371
18 3300005354 Ga0070675_100034538 Ga0070675_1000345381 372
19 3300005365 Ga0070688_100075566 Ga0070688_1000755662 372
20 3300025917 Ga0207660_10182363 Ga0207660_101823632 372
21 3300025926 Ga0207659_10008745 Ga0207659_100087456 372
22 3300025960 Ga0207651_10099683 Ga0207651_100996832 372
23 3300026075 Ga0207708_10064184 Ga0207708_100641842 372
24 3300028794 Ga0307515_10000011 Ga0307515_10000011163 373
25 3300002987 JGI25159J45721_1001840 JGI25159J45721_10018403 375
26 3300003187 JGI25151J46595_10004893 JGI25151J46595_100048932 375
27 3300003791 Ga0055530_10000848 Ga0055530_1000084822 375
28 3300003792 Ga0055540_1000037 Ga0055540_100003750 375
29 3300003794 Ga0055531_10002177 Ga0055531_1000217712 375
30 3300005262 Ga0065165_1022205 Ga0065165_10222052 375
31 3300025245 Ga0207425_1002855 Ga0207425_10028556 375
32 3300025284 Ga0209130_1000338 Ga0209130_100033822 375
33 3300025292 Ga0209676_1000023 Ga0209676_1000023363 375
34 3300025294 Ga0209025_1006074 Ga0209025_10060745 375
35 3300025298 Ga0209050_1000022 Ga0209050_1000022345 375
36 3300025302 Ga0207426_1009147 Ga0207426_10091471 375
37 3300025303 Ga0209051_1000013 Ga0209051_1000013345 375
38 3300025304 Ga0209257_1000042 Ga0209257_1000042142 375
39 3300003771 Ga0055526_1003957 Ga0055526_10039574 376
40 3300003773 Ga0055537_1000205 Ga0055537_100020536 376
41 3300003775 Ga0055524_1000073 Ga0055524_100007338 376
42 3300003790 Ga0055528_1002836 Ga0055528_10028366 376
43 3300005337 Ga0070682_100075557 Ga0070682_1000755572 376
44 3300025263 Ga0209565_1000128 Ga0209565_100012848 376
45 3300025273 Ga0209673_1000008 Ga0209673_100000871 376
46 3300025291 Ga0209675_1000099 Ga0209675_100009925 376
47 3300025295 Ga0209564_1002522 Ga0209564_100252210 376
48 3300025299 Ga0209256_1000001 Ga0209256_10000011831 376
49 3300031548 Ga0307408_100004302 Ga0307408_10000430215 376
50 3300009176 Ga0105242_10000553 Ga0105242_1000055322 377
51 3300025934 Ga0207686_10027724 Ga0207686_100277241 377
52 3300006195 Ga0075366_10001287 Ga0075366_1000128718 379
53 3300050493 nmdc:mga0k408_302_c1 nmdc:mga0k408_302_c1_24973_26331 379
54 3300037312 Ga0395899_0003316 Ga0395899_0003316_10534_11844 381
55 3300037418 Ga0395900_0034561 Ga0395900_0034561_3863_5173 381
56 3300037471 Ga0395905_0011080 Ga0395905_0011080_4117_5427 381
57 3300038443 Ga0395901_0138921 Ga0395901_0138921_68_1378 381
58 3300003792 Ga0055540_1005560 Ga0055540_10055606 383
59 3300005340 Ga0070689_100025052 Ga0070689_1000250522 383
60 3300005543 Ga0070672_100122941 Ga0070672_1001229412 383
61 3300014745 Ga0157377_10004975 Ga0157377_100049753 383
62 3300028794 Ga0307515_10001854 Ga0307515_100018548 384
63 3300009093 Ga0105240_10004767 Ga0105240_100047674 385
64 3300009545 Ga0105237_10001363 Ga0105237_1000136310 385
65 3300010375 Ga0105239_10000954 Ga0105239_1000095418 385
66 3300021361 Ga0213872_10011567 Ga0213872_100115674 385
67 3300025913 Ga0207695_10021837 Ga0207695_100218374 385
68 3300039447 Ga0436361_0039667 Ga0436361_0039667_2695_4032 385
69 3300042876 Ga0451577_0000270 Ga0451577_0000270_54068_55378 386
70 3300044712 Ga0453684_0000868 Ga0453684_0000868_46130_47440 386
71 3300045051 Ga0451576_0004748 Ga0451576_0004748_4426_5736 386
72 3300046506 Ga0495583_0059586 Ga0495583_0059586_87_1349 387
73 3300037312 Ga0395899_0001210 Ga0395899_0001210_9706_11016 388
74 3300037312 Ga0395899_0007047 Ga0395899_0007047_7117_8427 388
75 3300037466 Ga0395898_0003251 Ga0395898_0003251_14110_15420 388
76 3300046660 Ga0495625_0092649 Ga0495625_0092649_149_1465 388
77 3300046683 Ga0495658_0024109 Ga0495658_0024109_1394_2707 388
78 3300048905 Ga0496102_0049020 Ga0496102_0049020_285_1604 389
79 3300031548 Ga0307408_100156868 Ga0307408_1001568682 391
80 3300050490 nmdc:mga03n38_53889_c1 nmdc:mga03n38_53889_c1_524_1795 391
81 3300005367 Ga0070667_100032234 Ga0070667_1000322343 392
82 3300013306 Ga0163162_10097105 Ga0163162_100971053 392
83 3300026121 Ga0207683_10191284 Ga0207683_101912842 392
84 3300048904 Ga0496101_0028202 Ga0496101_0028202_770_2098 392
85 3300048905 Ga0496102_0079265 Ga0496102_0079265_821_2149 392
86 3300048907 Ga0496104_0029955 Ga0496104_0029955_972_2300 392
87 3300048908 Ga0496105_0004053 Ga0496105_0004053_7133_8461 392
88 3300048909 Ga0496106_0009081 Ga0496106_0009081_2354_3682 392
89 3300046683 Ga0495658_0025207 Ga0495658_0025207_1652_2974 393
90 3300031711 Ga0265314_10007074 Ga0265314_100070749 394
91 3300031712 Ga0265342_10050897 Ga0265342_100508972 394
92 3300005262 Ga0065165_1002331 Ga0065165_100233115 398
93 3300025273 Ga0209673_1002449 Ga0209673_10024494 398
94 3300037471 Ga0395905_0145219 Ga0395905_0145219_882_2201 398
95 3300049581 Ga0501047_0103370 Ga0501047_0103370_431_1750 399
96 3300005456 Ga0070678_100107221 Ga0070678_1001072212 400
97 3300005457 Ga0070662_100019538 Ga0070662_1000195385 400
98 3300009093 Ga0105240_10364671 Ga0105240_103646712 400
99 3300014497 Ga0182008_10001633 Ga0182008_1000163312 400
100 3300025231 Ga0207427_100266 Ga0207427_10026632 400
101 3300025913 Ga0207695_10109726 Ga0207695_101097262 400
102 3300025933 Ga0207706_10025315 Ga0207706_100253152 400
103 3300025940 Ga0207691_10021922 Ga0207691_100219224 400
104 3300026089 Ga0207648_10027173 Ga0207648_100271731 400
105 3300026121 Ga0207683_10068465 Ga0207683_100684652 400
106 3300028794 Ga0307515_10000084 Ga0307515_10000084175 400
107 3300031251 Ga0265327_10040332 Ga0265327_100403323 400
108 3300031456 Ga0307513_10136410 Ga0307513_101364102 400
109 3300031649 Ga0307514_10000954 Ga0307514_1000095431 400
110 3300025298 Ga0209050_1000770 Ga0209050_100077018 401
111 3300025303 Ga0209051_1020755 Ga0209051_10207553 401
112 3300027471 Ga0209995_1001967 Ga0209995_10019673 401
113 3300037471 Ga0395905_0161384 Ga0395905_0161384_325_1638 401
114 3300053086 Ga0500578_0000025 Ga0500578_0000025_43763_45082 401
115 3300053151 Ga0500604_0024081 Ga0500604_0024081_152_1471 401
116 3300003794 Ga0055531_10001826 Ga0055531_1000182614 402
117 3300006353 Ga0075370_10065374 Ga0075370_100653742 402
118 3300025303 Ga0209051_1000196 Ga0209051_1000196113 402
119 3300025304 Ga0209257_1000305 Ga0209257_10003056 402
120 3300028379 Ga0268266_10207653 Ga0268266_102076532 402
121 3300005563 Ga0068855_100171401 Ga0068855_1001714012 403
122 3300009094 Ga0111539_10113810 Ga0111539_101138102 403
123 3300021361 Ga0213872_10003975 Ga0213872_100039755 403
124 3300025949 Ga0207667_10262842 Ga0207667_102628422 403
125 3300031730 Ga0307516_10001245 Ga0307516_100012456 403
126 3300039447 Ga0436361_0070738 Ga0436361_0070738_14933_16249 403
127 3300014969 Ga0157376_10061677 Ga0157376_100616773 404
128 3300025949 Ga0207667_10177882 Ga0207667_101778822 404
129 3300044706 Ga0466964_0065819 Ga0466964_0065819_136_1503 404
130 3300005563 Ga0068855_100242571 Ga0068855_1002425712 405
131 3300046471 Ga0495650_0009758 Ga0495650_0009758_3944_5257 405
132 3300049579 Ga0501043_0000002 Ga0501043_0000002_213506_214828 405
133 3300049580 Ga0501046_0000008 Ga0501046_0000008_213589_214911 405
134 3300049581 Ga0501047_0000003 Ga0501047_0000003_236771_238093 405
135 3300049824 Ga0501045_0003417 Ga0501045_0003417_4065_5387 405
136 3300061719 Ga0466962_0056484 Ga0466962_0056484_272_1639 405
137 3300005338 Ga0068868_100051527 Ga0068868_1000515273 406
138 3300046615 Ga0495656_0000646 Ga0495656_0000646_9158_10474 406
139 iso_pu_bacteria 2643221544 2643743620 406
140 3300006195 Ga0075366_10011876 Ga0075366_100118764 407
141 3300006353 Ga0075370_10002475 Ga0075370_100024756 407
142 3300007265 Ga0099794_10023374 Ga0099794_100233743 407
143 3300026023 Ga0207677_10181355 Ga0207677_101813552 407
144 3300031250 Ga0265331_10025673 Ga0265331_100256734 407
145 3300031251 Ga0265327_10019430 Ga0265327_100194305 407
146 3300031251 Ga0265327_10044275 Ga0265327_100442753 407
147 3300044712 Ga0453684_0000040 Ga0453684_0000040_49165_50463 407
148 3300050496 nmdc:mga07m45_6363_c1 nmdc:mga07m45_6363_c1_17_1333 407
149 3300006880 Ga0075429_100005760 Ga0075429_1000057608 408
150 3300009148 Ga0105243_10202787 Ga0105243_102027872 408
151 3300013308 Ga0157375_10101519 Ga0157375_101015193 408
152 3300050508 nmdc:mga09592_1310_c1 nmdc:mga09592_1310_c1_4077_5402 408
153 iso_pu_bacteria 2585428057 2587725531 408
154 iso_pu_bacteria 2585428058 2587734999 408
155 iso_pu_bacteria 2588253510 2588290531 408
156 iso_pu_bacteria 2643221592 2643970046 408
157 iso_pu_bacteria 2643221609 2644062253 408
158 iso_pu_bacteria 2643221611 2644071440 408
159 iso_pu_bacteria 2643221625 2644142980 408
160 iso_pu_bacteria 2643221648 2644271960 408
161 iso_pu_bacteria 2721755763 2723879616 408
162 iso_pu_bacteria 2738543012 2739245863 408
163 iso_pu_bacteria 2816332133 2816470557 408
164 iso_pu_bacteria 2643221654 2644303307 409
165 3300005289 Ga0065704_10074875 Ga0065704_100748753 410
166 3300005467 Ga0070706_100053666 Ga0070706_1000536663 410
167 3300037418 Ga0395900_0130173 Ga0395900_0130173_683_2002 410
168 3300038443 Ga0395901_0125038 Ga0395901_0125038_701_2020 410
169 3300039447 Ga0436361_0492952 Ga0436361_0492952_138_1445 410
170 3300046542 Ga0495597_0000516 Ga0495597_0000516_15582_16910 410
171 3300048926 Ga0496123_0024412 Ga0496123_0024412_105_1421 410
172 3300048928 Ga0496125_0001638 Ga0496125_0001638_28753_30069 410
173 iso_pu_bacteria 2511231002 2511244663 410
174 iso_pu_bacteria 2513020051 2513230077 410
175 iso_pu_bacteria 2547132374 2548499078 410
176 iso_pu_bacteria 2643221570 2643867718 410
177 iso_pu_bacteria 2643221596 2643991581 410
178 iso_pu_bacteria 2643221628 2644162163 410
179 iso_pu_bacteria 2643221652 2644293327 410
180 iso_pu_bacteria 2643221658 2644324286 410
181 iso_pu_bacteria 2643221672 2644396127 410
182 iso_pu_bacteria 2643221717 2644648535 410
183 iso_pu_bacteria 2721755523 2722881945 410
184 iso_pu_bacteria 2738541277 2738720469 410
185 iso_pu_bacteria 2738541307 2738884040 410
186 iso_pu_bacteria 2738543019 2739279668 410
187 iso_pu_bacteria 2818991446 2819601151 410
188 iso_pu_bacteria 2831265667 2831271535 410
189 iso_pu_bacteria 2838054893 2838055436 410
190 iso_pu_bacteria 2839138175 2839144894 410
191 iso_pu_bacteria 2842677519 2842680585 410
192 iso_pu_bacteria 2842733646 2842736412 410
193 iso_pu_bacteria 2842747753 2842748919 410
194 iso_pu_bacteria 2885192300 2885196986 410
195 iso_pu_bacteria 2885198086 2885201031 410
196 iso_pu_bacteria 2885211737 2885214186 410
197 iso_pu_bacteria 2886848708 2886850079 410
198 iso_pu_bacteria 2894023352 2894024280 410
199 iso_pu_bacteria 2899924645 2899927503 410
200 iso_pu_bacteria 2904449895 2904450769 410
201 iso_pu_bacteria 2904456579 2904459731 410
202 iso_pu_bacteria 2904479285 2904481551 410
203 iso_pu_bacteria 2919462493 2919462700 410
204 iso_pu_bacteria 2919704043 2919707089 410
205 iso_pu_bacteria 2928037797 2928042585 410
206 iso_pu_bacteria 2928044640 2928048988 410
207 iso_pu_bacteria 2928051484 2928051538 410
208 iso_pu_bacteria 2928064002 2928068749 410
209 iso_pu_bacteria 2928084124 2928087014 410
210 iso_pu_bacteria 2928115317 2928118034 410
211 iso_pu_bacteria 2929520902 2929521487 410
212 iso_pu_bacteria 2939631187 2939635100 410
213 iso_pu_bacteria 2945945610 2945949500 410
214 iso_pu_bacteria 2945984333 2945990656 410
215 iso_pu_bacteria 2954767861 2954770841 410
216 iso_pu_bacteria 2974320154 2974320459 410
217 iso_pu_bacteria 2990710928 2990713973 410
218 3300003759 Ga0055525_1000031 Ga0055525_100003161 411
219 3300005262 Ga0065165_1000521 Ga0065165_10005218 411
220 3300005367 Ga0070667_100111448 Ga0070667_1001114482 411
221 3300005618 Ga0068864_100002948 Ga0068864_1000029485 411
222 3300005841 Ga0068863_100076127 Ga0068863_1000761272 411
223 3300005843 Ga0068860_100060272 Ga0068860_1000602722 411
224 3300006195 Ga0075366_10051354 Ga0075366_100513542 411
225 3300006353 Ga0075370_10006690 Ga0075370_100066904 411
226 3300006353 Ga0075370_10032627 Ga0075370_100326272 411
227 3300021361 Ga0213872_10000175 Ga0213872_1000017537 411
228 3300021361 Ga0213872_10001003 Ga0213872_100010033 411
229 3300025230 Ga0209563_100044 Ga0209563_100044130 411
230 3300025913 Ga0207695_10099286 Ga0207695_100992863 411
231 3300025986 Ga0207658_10070704 Ga0207658_100707041 411
232 3300026095 Ga0207676_10011140 Ga0207676_100111405 411
233 3300027526 Ga0209968_1000748 Ga0209968_10007485 411
234 3300027695 Ga0209966_1000008 Ga0209966_100000837 411
235 3300028786 Ga0307517_10005635 Ga0307517_100056355 411
236 3300031238 Ga0265332_10007247 Ga0265332_100072473 411
237 3300031239 Ga0265328_10011741 Ga0265328_100117415 411
238 3300031250 Ga0265331_10001682 Ga0265331_1000168212 411
239 3300031250 Ga0265331_10030385 Ga0265331_100303852 411
240 3300031251 Ga0265327_10000042 Ga0265327_10000042148 411
241 3300031507 Ga0307509_10000063 Ga0307509_10000063108 411
242 3300031507 Ga0307509_10081292 Ga0307509_100812924 411
243 3300031616 Ga0307508_10005254 Ga0307508_100052544 411
244 3300033180 Ga0307510_10017213 Ga0307510_100172136 411
245 3300037312 Ga0395899_0017845 Ga0395899_0017845_2870_4189 411
246 3300037418 Ga0395900_0050324 Ga0395900_0050324_2290_3609 411
247 3300037466 Ga0395898_0034026 Ga0395898_0034026_329_1648 411
248 3300038443 Ga0395901_0125499 Ga0395901_0125499_683_2002 411
249 3300039447 Ga0436361_0110525 Ga0436361_0110525_2900_4216 411
250 3300039447 Ga0436361_0433107 Ga0436361_0433107_2249_3559 411
251 3300039447 Ga0436361_0920355 Ga0436361_0920355_4682_5992 411
252 3300039447 Ga0436361_1151553 Ga0436361_1151553_30135_31445 411
253 3300044693 Ga0466961_0005878 Ga0466961_0005878_4522_5889 411
254 3300046453 Ga0495627_000004 Ga0495627_000004_186304_187638 411
255 3300046454 Ga0495592_0006972 Ga0495592_0006972_2783_4120 411
256 3300046460 Ga0495638_0067786 Ga0495638_0067786_439_1773 411
257 3300046513 Ga0495616_0006125 Ga0495616_0006125_3305_4654 411
258 3300046558 Ga0495633_0001397 Ga0495633_0001397_3678_5009 411
259 3300046616 Ga0495668_0014233 Ga0495668_0014233_789_2147 411
260 3300046680 Ga0495646_0122864 Ga0495646_0122864_47_1384 411
261 3300047320 Ga0495672_0000019 Ga0495672_0000019_256012_257385 411
262 3300047673 Ga0495593_0008695 Ga0495593_0008695_1933_3261 411
263 3300048909 Ga0496106_0045100 Ga0496106_0045100_438_1769 411
264 3300048912 Ga0496109_0293529 Ga0496109_0293529_141_1478 411
265 3300050493 nmdc:mga0k408_2741_c1 nmdc:mga0k408_2741_c1_7359_8681 411
266 3300050496 nmdc:mga07m45_5339_c1 nmdc:mga07m45_5339_c1_3443_4765 411
267 3300053136 Ga0500559_0000013 Ga0500559_0000013_104730_106064 411
268 3300002705 JGI25156J39149_1000403 JGI25156J39149_100040324 412
269 3300002738 JGI25154J39366_1001215 JGI25154J39366_10012158 412
270 3300002741 JGI25157J39369_1000008 JGI25157J39369_1000008127 412
271 3300002773 JGI25152J39213_1000516 JGI25152J39213_100051610 412
272 3300003215 JGI25153J46596_10002374 JGI25153J46596_1000237413 412
273 3300003752 Ga0055539_1000255 Ga0055539_10002556 412
274 3300003756 Ga0055533_1000040 Ga0055533_1000040121 412
275 3300003759 Ga0055525_1001111 Ga0055525_10011117 412
276 3300003761 Ga0055535_1000052 Ga0055535_10000522 412
277 3300003763 Ga0055529_1000053 Ga0055529_1000053147 412
278 3300003775 Ga0055524_1007894 Ga0055524_10078944 412
279 3300004625 Ga0055543_1005258 Ga0055543_10052583 412
280 3300005262 Ga0065165_1000170 Ga0065165_100017028 412
281 3300005364 Ga0070673_100053908 Ga0070673_1000539083 412
282 3300005367 Ga0070667_100157438 Ga0070667_1001574382 412
283 3300005455 Ga0070663_100000113 Ga0070663_10000011313 412
284 3300005577 Ga0068857_100013938 Ga0068857_1000139384 412
285 3300005578 Ga0068854_100017693 Ga0068854_1000176932 412
286 3300005614 Ga0068856_100009632 Ga0068856_10000963210 412
287 3300005616 Ga0068852_100141725 Ga0068852_1001417252 412
288 3300006038 Ga0075365_10153478 Ga0075365_101534782 412
289 3300006051 Ga0075364_10008008 Ga0075364_100080083 412
290 3300006177 Ga0075362_10055049 Ga0075362_100550492 412
291 3300006195 Ga0075366_10011144 Ga0075366_100111443 412
292 3300006195 Ga0075366_10011179 Ga0075366_100111793 412
293 3300006353 Ga0075370_10000133 Ga0075370_1000013315 412
294 3300006353 Ga0075370_10001450 Ga0075370_100014506 412
295 3300006353 Ga0075370_10012919 Ga0075370_100129193 412
296 3300006353 Ga0075370_10017319 Ga0075370_100173193 412
297 3300006944 Ga0099823_1000155 Ga0099823_100015529 412
298 3300009093 Ga0105240_10194087 Ga0105240_101940871 412
299 3300010375 Ga0105239_10026451 Ga0105239_100264518 412
300 3300010375 Ga0105239_10037942 Ga0105239_100379423 412
301 3300025226 Ga0209674_100066 Ga0209674_100066119 412
302 3300025230 Ga0209563_100107 Ga0209563_100107102 412
303 3300025242 Ga0209258_100074 Ga0209258_100074109 412
304 3300025242 Ga0209258_100489 Ga0209258_10048916 412
305 3300025245 Ga0207425_1001221 Ga0207425_100122114 412
306 3300025246 Ga0209646_1000039 Ga0209646_1000039130 412
307 3300025250 Ga0209026_1000006 Ga0209026_1000006471 412
308 3300025253 Ga0209677_100052 Ga0209677_100052119 412
309 3300025253 Ga0209677_100914 Ga0209677_10091413 412
310 3300025253 Ga0209677_103358 Ga0209677_1033585 412
311 3300025256 Ga0209759_1000020 Ga0209759_1000020126 412
312 3300025256 Ga0209759_1000909 Ga0209759_100090914 412
313 3300025256 Ga0209759_1002131 Ga0209759_10021316 412
314 3300025258 Ga0209129_1000269 Ga0209129_100026953 412
315 3300025258 Ga0209129_1008242 Ga0209129_10082423 412
316 3300025272 Ga0209455_1000066 Ga0209455_1000066149 412
317 3300025295 Ga0209564_1000300 Ga0209564_100030053 412
318 3300025297 Ga0209758_1000453 Ga0209758_100045348 412
319 3300025297 Ga0209758_1000605 Ga0209758_100060534 412
320 3300025299 Ga0209256_1000437 Ga0209256_100043749 412
321 3300025303 Ga0209051_1001930 Ga0209051_10019305 412
322 3300025304 Ga0209257_1000479 Ga0209257_100047931 412
323 3300025913 Ga0207695_10019943 Ga0207695_100199437 412
324 3300025924 Ga0207694_10022029 Ga0207694_100220292 412
325 3300025942 Ga0207689_10100258 Ga0207689_101002583 412
326 3300025949 Ga0207667_10087881 Ga0207667_100878814 412
327 3300025960 Ga0207651_10004471 Ga0207651_100044713 412
328 3300025981 Ga0207640_10007491 Ga0207640_100074916 412
329 3300026041 Ga0207639_10012945 Ga0207639_100129453 412
330 3300026067 Ga0207678_10002401 Ga0207678_100024015 412
331 3300026067 Ga0207678_10089138 Ga0207678_100891382 412
332 3300026078 Ga0207702_10000310 Ga0207702_1000031057 412
333 3300026116 Ga0207674_10025604 Ga0207674_100256043 412
334 3300026142 Ga0207698_10066556 Ga0207698_100665564 412
335 3300027296 Ga0209389_1011713 Ga0209389_10117135 412
336 3300027876 Ga0209974_10004129 Ga0209974_100041294 412
337 3300028786 Ga0307517_10148941 Ga0307517_101489411 412
338 3300028794 Ga0307515_10020861 Ga0307515_100208617 412
339 3300028794 Ga0307515_10041425 Ga0307515_100414255 412
340 3300028794 Ga0307515_10154903 Ga0307515_101549032 412
341 3300030521 Ga0307511_10045429 Ga0307511_100454295 412
342 3300030522 Ga0307512_10051338 Ga0307512_100513383 412
343 3300031239 Ga0265328_10006867 Ga0265328_100068672 412
344 3300031251 Ga0265327_10000320 Ga0265327_1000032065 412
345 3300031344 Ga0265316_10009418 Ga0265316_100094187 412
346 3300031456 Ga0307513_10002473 Ga0307513_1000247322 412
347 3300031507 Ga0307509_10090856 Ga0307509_100908562 412
348 3300031616 Ga0307508_10000053 Ga0307508_1000005386 412
349 3300031649 Ga0307514_10000560 Ga0307514_100005605 412
350 3300031649 Ga0307514_10010207 Ga0307514_100102076 412
351 3300031649 Ga0307514_10084913 Ga0307514_100849132 412
352 3300031730 Ga0307516_10000676 Ga0307516_1000067642 412
353 3300031730 Ga0307516_10035006 Ga0307516_100350062 412
354 3300031730 Ga0307516_10049964 Ga0307516_100499643 412
355 3300031731 Ga0307405_10021442 Ga0307405_100214423 412
356 3300031995 Ga0307409_100201659 Ga0307409_1002016592 412
357 3300035691 Ga0373931_0035797 Ga0373931_0035797_270_1586 412
358 3300036401 Ga0373937_0034163 Ga0373937_0034163_1963_3285 412
359 3300037471 Ga0395905_0000728 Ga0395905_0000728_22236_23558 412
360 3300037471 Ga0395905_0006280 Ga0395905_0006280_5202_6515 412
361 3300037471 Ga0395905_0119579 Ga0395905_0119579_199_1512 412
362 3300037471 Ga0395905_0220403 Ga0395905_0220403_398_1723 412
363 3300039447 Ga0436361_0566823 Ga0436361_0566823_680_1996 412
364 3300044683 Ga0466965_0003434 Ga0466965_0003434_1691_3007 412
365 3300044684 Ga0466966_0016381 Ga0466966_0016381_2555_3871 412
366 3300044706 Ga0466964_0009552 Ga0466964_0009552_2210_3526 412
367 3300044712 Ga0453684_0041490 Ga0453684_0041490_1494_2825 412
368 3300044719 Ga0466971_0004741 Ga0466971_0004741_3537_4853 412
369 3300044842 Ga0466957_0016266 Ga0466957_0016266_1950_3266 412
370 3300044842 Ga0466957_0138543 Ga0466957_0138543_132_1451 412
371 3300045049 Ga0466959_0005876 Ga0466959_0005876_1380_2696 412
372 3300046506 Ga0495583_0000034 Ga0495583_0000034_19242_20558 412
373 3300046507 Ga0495606_0001225 Ga0495606_0001225_34596_35912 412
374 3300046519 Ga0495632_0005292 Ga0495632_0005292_785_2104 412
375 3300046519 Ga0495632_0015603 Ga0495632_0015603_510_1841 412
376 3300046522 Ga0495643_0075393 Ga0495643_0075393_288_1604 412
377 3300046660 Ga0495625_0007721 Ga0495625_0007721_2704_4035 412
378 3300046694 Ga0495649_0000428 Ga0495649_0000428_4893_6209 412
379 3300046694 Ga0495649_0005989 Ga0495649_0005989_3865_5196 412
380 3300047323 Ga0495683_0024285 Ga0495683_0024285_1372_2688 412
381 3300049571 Ga0501034_0151445 Ga0501034_0151445_58_1374 412
382 3300049649 Ga0501198_000024 Ga0501198_000024_16908_18221 412
383 3300049662 Ga0501222_000020 Ga0501222_000020_48969_50282 412
384 3300050493 nmdc:mga0k408_15012_c1 nmdc:mga0k408_15012_c1_579_1910 412
385 3300050493 nmdc:mga0k408_213_c1 nmdc:mga0k408_213_c1_13172_14506 412
386 3300050493 nmdc:mga0k408_2734_c1 nmdc:mga0k408_2734_c1_5895_7229 412
387 3300050494 nmdc:mga06z11_5393_c1 nmdc:mga06z11_5393_c1_2873_4207 412
388 3300050496 nmdc:mga07m45_2735_c1 nmdc:mga07m45_2735_c1_1214_2530 412
389 3300050496 nmdc:mga07m45_38029_c1 nmdc:mga07m45_38029_c1_1176_2507 412
390 3300050496 nmdc:mga07m45_5336_c1 nmdc:mga07m45_5336_c1_4821_6152 412
391 3300050496 nmdc:mga07m45_769_c1 nmdc:mga07m45_769_c1_8253_9587 412
392 3300050496 nmdc:mga07m45_847_c1 nmdc:mga07m45_847_c1_6495_7829 412
393 3300050516 nmdc:mga0sz30_9041_c1 nmdc:mga0sz30_9041_c1_1442_2776 412
394 3300053080 Ga0500635_0000008 Ga0500635_0000008_72479_73795 412
395 3300053131 Ga0500652_000177 Ga0500652_000177_10780_12099 412
396 3300053134 Ga0500658_0007141 Ga0500658_0007141_2308_3639 412
397 3300053136 Ga0500559_0025044 Ga0500559_0025044_549_1865 412
398 3300053156 Ga0500622_0004247 Ga0500622_0004247_6198_7517 412
399 3300061719 Ga0466962_0005789 Ga0466962_0005789_2959_4275 412
400 iso_pu_bacteria 2643221660 2644341111 412
401 3300003775 Ga0055524_1003013 Ga0055524_10030136 413
402 3300006353 Ga0075370_10046027 Ga0075370_100460272 413
403 3300025299 Ga0209256_1000085 Ga0209256_100008541 413
404 3300025304 Ga0209257_1000351 Ga0209257_10003516 413
405 3300030500 Ga0268256_1024879 Ga0268256_10248791 413
406 3300037471 Ga0395905_0000027 Ga0395905_0000027_124079_125398 413
407 3300042127 Ga0450890_000863 Ga0450890_000863_1171_2490 413
408 3300002704 JGI25155J39150_1000022 JGI25155J39150_1000022133 414
409 3300002705 JGI25156J39149_1000005 JGI25156J39149_1000005125 414
410 3300002738 JGI25154J39366_1000017 JGI25154J39366_1000017117 414
411 3300002741 JGI25157J39369_1000003 JGI25157J39369_1000003133 414
412 3300002774 JGI25150J39212_1001212 JGI25150J39212_10012123 414
413 3300002774 JGI25150J39212_1001998 JGI25150J39212_10019983 414
414 3300003187 JGI25151J46595_10004998 JGI25151J46595_100049983 414
415 3300003187 JGI25151J46595_10006367 JGI25151J46595_100063675 414
416 3300003187 JGI25151J46595_10007286 JGI25151J46595_100072862 414
417 3300003322 rootL2_10020595 rootL2_1002059510 414
418 3300003761 Ga0055535_1000966 Ga0055535_100096614 414
419 3300003762 Ga0055542_1000080 Ga0055542_100008084 414
420 3300003771 Ga0055526_1003196 Ga0055526_100319612 414
421 3300003771 Ga0055526_1014420 Ga0055526_10144204 414
422 3300003771 Ga0055526_1014478 Ga0055526_10144782 414
423 3300003773 Ga0055537_1000150 Ga0055537_10001505 414
424 3300003775 Ga0055524_1005814 Ga0055524_10058142 414
425 3300003775 Ga0055524_1005838 Ga0055524_10058382 414
426 3300003781 Ga0055536_1008669 Ga0055536_10086693 414
427 3300003784 Ga0055534_1000016 Ga0055534_1000016105 414
428 3300003790 Ga0055528_1000894 Ga0055528_100089415 414
429 3300003791 Ga0055530_10005116 Ga0055530_100051163 414
430 3300003792 Ga0055540_1005600 Ga0055540_10056005 414
431 3300003792 Ga0055540_1009672 Ga0055540_10096723 414
432 3300004625 Ga0055543_1003131 Ga0055543_10031313 414
433 3300004625 Ga0055543_1005454 Ga0055543_10054542 414
434 3300005262 Ga0065165_1006524 Ga0065165_10065243 414
435 3300005339 Ga0070660_100010089 Ga0070660_1000100896 414
436 3300005457 Ga0070662_100018849 Ga0070662_1000188496 414
437 3300005467 Ga0070706_100000700 Ga0070706_10000070034 414
438 3300005563 Ga0068855_100006806 Ga0068855_1000068063 414
439 3300005618 Ga0068864_100175333 Ga0068864_1001753332 414
440 3300006042 Ga0075368_10016485 Ga0075368_100164854 414
441 3300006048 Ga0075363_100002569 Ga0075363_1000025697 414
442 3300006048 Ga0075363_100035663 Ga0075363_1000356631 414
443 3300006051 Ga0075364_10010221 Ga0075364_100102215 414
444 3300006058 Ga0075432_10002614 Ga0075432_100026143 414
445 3300006186 Ga0075369_10043960 Ga0075369_100439602 414
446 3300006195 Ga0075366_10070791 Ga0075366_100707912 414
447 3300006353 Ga0075370_10000304 Ga0075370_1000030421 414
448 3300006353 Ga0075370_10004243 Ga0075370_100042435 414
449 3300006948 Ga0099826_10000101 Ga0099826_1000010133 414
450 3300009036 Ga0105244_10010520 Ga0105244_100105204 414
451 3300009093 Ga0105240_10006365 Ga0105240_1000636514 414
452 3300010375 Ga0105239_10111545 Ga0105239_101115454 414
453 3300014497 Ga0182008_10005156 Ga0182008_100051563 414
454 3300014497 Ga0182008_10006253 Ga0182008_100062536 414
455 3300015261 Ga0182006_1006614 Ga0182006_10066143 414
456 3300015262 Ga0182007_10000853 Ga0182007_1000085312 414
457 3300017792 Ga0163161_10001891 Ga0163161_1000189113 414
458 3300017792 Ga0163161_10015556 Ga0163161_100155562 414
459 3300025206 Ga0209435_100002 Ga0209435_100002241 414
460 3300025228 Ga0209672_100378 Ga0209672_10037828 414
461 3300025229 Ga0209147_100696 Ga0209147_10069620 414
462 3300025242 Ga0209258_100093 Ga0209258_10009326 414
463 3300025246 Ga0209646_1000001 Ga0209646_10000012384 414
464 3300025250 Ga0209026_1000001 Ga0209026_10000011041 414
465 3300025254 Ga0209148_1000007 Ga0209148_1000007993 414
466 3300025256 Ga0209759_1000001 Ga0209759_10000012015 414
467 3300025258 Ga0209129_1000024 Ga0209129_100002484 414
468 3300025258 Ga0209129_1003815 Ga0209129_10038157 414
469 3300025258 Ga0209129_1004573 Ga0209129_10045732 414
470 3300025263 Ga0209565_1000098 Ga0209565_100009873 414
471 3300025263 Ga0209565_1000574 Ga0209565_100057423 414
472 3300025263 Ga0209565_1000633 Ga0209565_100063325 414
473 3300025263 Ga0209565_1003743 Ga0209565_10037433 414
474 3300025273 Ga0209673_1000058 Ga0209673_1000058178 414
475 3300025273 Ga0209673_1002178 Ga0209673_100217817 414
476 3300025273 Ga0209673_1016385 Ga0209673_10163852 414
477 3300025284 Ga0209130_1000654 Ga0209130_100065420 414
478 3300025284 Ga0209130_1001114 Ga0209130_100111415 414
479 3300025291 Ga0209675_1000010 Ga0209675_100001087 414
480 3300025291 Ga0209675_1000151 Ga0209675_10001515 414
481 3300025291 Ga0209675_1002776 Ga0209675_100277610 414
482 3300025291 Ga0209675_1004124 Ga0209675_10041244 414
483 3300025292 Ga0209676_1000028 Ga0209676_1000028272 414
484 3300025294 Ga0209025_1001904 Ga0209025_100190416 414
485 3300025294 Ga0209025_1002647 Ga0209025_100264713 414
486 3300025294 Ga0209025_1005469 Ga0209025_10054698 414
487 3300025294 Ga0209025_1006765 Ga0209025_10067656 414
488 3300025295 Ga0209564_1000209 Ga0209564_100020989 414
489 3300025295 Ga0209564_1002281 Ga0209564_100228117 414
490 3300025295 Ga0209564_1003391 Ga0209564_10033916 414
491 3300025297 Ga0209758_1000049 Ga0209758_10000493 414
492 3300025297 Ga0209758_1005721 Ga0209758_100572110 414
493 3300025297 Ga0209758_1008071 Ga0209758_10080718 414
494 3300025298 Ga0209050_1000072 Ga0209050_100007228 414
495 3300025298 Ga0209050_1000927 Ga0209050_100092716 414
496 3300025299 Ga0209256_1000088 Ga0209256_1000088181 414
497 3300025299 Ga0209256_1004126 Ga0209256_100412610 414
498 3300025302 Ga0207426_1000038 Ga0207426_1000038375 414
499 3300025302 Ga0207426_1000053 Ga0207426_100005339 414
500 3300025303 Ga0209051_1000015 Ga0209051_1000015201 414
501 3300025303 Ga0209051_1000056 Ga0209051_1000056199 414
502 3300025303 Ga0209051_1000545 Ga0209051_100054538 414
503 3300025304 Ga0209257_1003278 Ga0209257_10032783 414
504 3300025728 Ga0207655_1006555 Ga0207655_10065553 414
505 3300025910 Ga0207684_10004795 Ga0207684_100047955 414
506 3300025914 Ga0207671_10038827 Ga0207671_100388274 414
507 3300025919 Ga0207657_10014060 Ga0207657_100140608 414
508 3300025933 Ga0207706_10030294 Ga0207706_100302942 414
509 3300025935 Ga0207709_10000111 Ga0207709_1000011146 414
510 3300025935 Ga0207709_10002735 Ga0207709_100027359 414
511 3300025935 Ga0207709_10020861 Ga0207709_100208613 414
512 3300025949 Ga0207667_10021851 Ga0207667_100218513 414
513 3300026041 Ga0207639_10137394 Ga0207639_101373942 414
514 3300027111 Ga0209281_1000017 Ga0209281_100001711 414
515 3300027666 Ga0209282_1001024 Ga0209282_10010249 414
516 3300027866 Ga0209813_10013867 Ga0209813_100138672 414
517 3300027876 Ga0209974_10006511 Ga0209974_100065111 414
518 3300028794 Ga0307515_10175547 Ga0307515_101755472 414
519 3300030732 Ga0316176_1225243 Ga0316176_12252432 414
520 3300030733 Ga0314311_1036973 Ga0314311_10369733 414
521 3300030744 Ga0316181_1050790 Ga0316181_10507904 414
522 3300031238 Ga0265332_10000027 Ga0265332_10000027147 414
523 3300031456 Ga0307513_10000038 Ga0307513_10000038124 414
524 3300031548 Ga0307408_100000263 Ga0307408_10000026346 414
525 3300031548 Ga0307408_100011106 Ga0307408_1000111063 414
526 3300031731 Ga0307405_10074982 Ga0307405_100749822 414
527 3300031901 Ga0307406_10000654 Ga0307406_100006546 414
528 3300031901 Ga0307406_10012286 Ga0307406_100122866 414
529 3300031911 Ga0307412_10009231 Ga0307412_100092314 414
530 3300032002 Ga0307416_100106433 Ga0307416_1001064332 414
531 3300032005 Ga0307411_10193669 Ga0307411_101936692 414
532 3300037471 Ga0395905_0023393 Ga0395905_0023393_962_2281 414
533 3300041404 Ga0439436_0005938 Ga0439436_0005938_1993_3360 414
534 3300042006 Ga0439432_001040 Ga0439432_001040_3508_4875 414
535 3300042010 Ga0439452_003432 Ga0439452_003432_1599_2966 414
536 3300042435 Ga0439434_0004240 Ga0439434_0004240_2760_4082 414
537 3300042531 Ga0450918_004109 Ga0450918_004109_566_1888 414
538 3300042876 Ga0451577_0012078 Ga0451577_0012078_6764_8080 414
539 3300044656 Ga0466969_0006251 Ga0466969_0006251_4596_5915 414
540 3300044684 Ga0466966_0018583 Ga0466966_0018583_2251_3570 414
541 3300044712 Ga0453684_0061027 Ga0453684_0061027_38_1354 414
542 3300044712 Ga0453684_0144005 Ga0453684_0144005_200_1564 414
543 3300045049 Ga0466959_0004682 Ga0466959_0004682_7276_8595 414
544 3300045051 Ga0451576_0040585 Ga0451576_0040585_1277_2641 414
545 3300046453 Ga0495627_001913 Ga0495627_001913_7723_9045 414
546 3300046515 Ga0495620_0002466 Ga0495620_0002466_3299_4621 414
547 3300046520 Ga0495637_0011635 Ga0495637_0011635_1028_2350 414
548 3300046530 Ga0495654_0037224 Ga0495654_0037224_166_1488 414
549 3300046660 Ga0495625_0000950 Ga0495625_0000950_35994_37316 414
550 3300046660 Ga0495625_0049703 Ga0495625_0049703_117_1439 414
551 3300047673 Ga0495593_0012263 Ga0495593_0012263_2890_4212 414
552 3300048904 Ga0496101_0113018 Ga0496101_0113018_708_2030 414
553 3300048912 Ga0496109_0078520 Ga0496109_0078520_234_1562 414
554 3300048921 Ga0496118_0006363 Ga0496118_0006363_8716_10050 414
555 3300048925 Ga0496122_0000612 Ga0496122_0000612_54002_55324 414
556 3300048926 Ga0496123_0000274 Ga0496123_0000274_46472_47794 414
557 3300048929 Ga0496126_0154066 Ga0496126_0154066_439_1761 414
558 3300049568 Ga0501031_0001576 Ga0501031_0001576_4199_5518 414
559 3300050490 nmdc:mga03n38_17836_c1 nmdc:mga03n38_17836_c1_727_2049 414
560 3300050495 nmdc:mga04h51_22746_c1 nmdc:mga04h51_22746_c1_48_1370 414
561 3300050496 nmdc:mga07m45_5257_c1 nmdc:mga07m45_5257_c1_3208_4542 414
562 3300050496 nmdc:mga07m45_6318_c1 nmdc:mga07m45_6318_c1_1312_2634 414
563 3300053079 Ga0500610_0018115 Ga0500610_0018115_627_1949 414
564 3300053093 Ga0500651_0000347 Ga0500651_0000347_10737_12059 414
565 3300053093 Ga0500651_0007319 Ga0500651_0007319_3801_5144 414
566 3300053117 Ga0500593_001062 Ga0500593_001062_6849_8171 414
567 3300053122 Ga0500608_053027 Ga0500608_053027_113_1483 414
568 3300053134 Ga0500658_0000560 Ga0500658_0000560_3177_4499 414
569 3300053134 Ga0500658_0000589 Ga0500658_0000589_2608_3930 414
570 3300053139 Ga0500568_0006650 Ga0500568_0006650_2841_4163 414
571 3300053161 Ga0500634_0035101 Ga0500634_0035101_1182_2504 414
572 3300053730 Ga0500645_001112 Ga0500645_001112_3397_4716 414
573 iso_pu_bacteria 2932422444 2932423988 414

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00815

Histidinol_dh

Histidinol dehydrogenase

22

449

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qyv-assembly1.cif.gz_A crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with nadp 0.6174 220 318
1up7-assembly1.cif.gz_A structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with nad and glucose-6-phosphate 0.5953 220 319
1up6-assembly1.cif.gz_B structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, nad+ and glucose-6-phosphate 0.5906 222 319
1up6-assembly1.cif.gz_A structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, nad+ and glucose-6-phosphate 0.5875 222 319
1iol-assembly1.cif.gz_A-2 estrogenic 17-beta hydroxysteroid dehydrogenase complexed 17-beta-estradiol 0.5874 220 318
ID Description Score Start End Superfamily
4g07A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9427 220 351 3.40.50.1980
af_P9WNW9_250_396_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9169 219 364 3.40.50.1980
af_Q2FUT8_220_366_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9071 218 364 3.40.50.1980
1k75B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9059 218 353 3.40.50.1980
af_P9WNW9_250_396_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.905 219 364 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A3D2F981-F1-model_v4 Histidinol dehydrogenase 0.9876 104 219 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-D1KBL0-F1-model_v4 Histidinol dehydrogenase 0.9792 221 323 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A3D2F981-F1-model_v4 Histidinol dehydrogenase 0.9792 104 219 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A6B5GY25-F1-model_v4 deleted 0.976 108 213
AF-A0A357D169-F1-model_v4 Histidinol dehydrogenase 0.9662 218 316 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287

Feature Viewer

pLDDT pTM Quality
78.6 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map