F465293

General Info

Members Datasets Scaffolds Average Seq Length
574 294 1148 137

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10012290|Ga0081538_100122902
Length 137
Sequence MDITIHASFLPHDDPDASLAFYRDILGFEVRGDVGNGKMRWITVGPPDQPDTSIVLEPXXXXGTGITDEERRTIAEMMAKGTYGFINLATKNLDGTFEQLQASDAEVVQEPTDQPYGIRDCAFRDPAGNLIRIQELR

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.85
Nodule 0
Rhizoplane 6.45
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10012290 3300005981 Bacteria 6873
2 JGI24746J21847_1005511 3300001977 Bacteria 1973
3 JGI24739J22299_10031098 3300001989 Bacteria 1847
4 JGI24737J22298_10055191 3300001990 Bacteria 1201
5 JGI24737J22298_10094541 3300001990 Bacteria 886
6 JGI24737J22298_10172141 3300001990 Bacteria 639
7 JGI24743J22301_10006415 3300001991 Bacteria 2005
8 JGI24745J21846_1003847 3300002073 Bacteria 1586
9 JGI24738J21930_10011625 3300002075 Bacteria 1932
10 JGI24744J21845_10007872 3300002077 Bacteria 2201
11 JGI24742J22300_10005704 3300002244 Bacteria 2048
12 JGI25156J39149_1027211 3300002705 Bacteria 896
13 JGI25154J39366_1028162 3300002738 Bacteria 502
14 JGI25157J39369_1007493 3300002741 Bacteria 1573
15 JGI25406J46586_10009256 3300003203 Bacteria 4415
16 JGI25407J50210_10038829 3300003373 Bacteria 1222
17 Ga0055527_1000071 3300003760 Bacteria 84489
18 Ga0055535_1000213 3300003761 Bacteria 61546
19 Ga0055542_1000161 3300003762 Bacteria 84490
20 Ga0055529_1000272 3300003763 Bacteria 61544
21 Ga0070658_10619519 3300005327 Bacteria 938
22 Ga0070676_10028008 3300005328 Bacteria 3199
23 Ga0070683_100032193 3300005329 Bacteria 4774
24 Ga0070683_101583279 3300005329 Bacteria 630
25 Ga0068869_100036967 3300005334 Bacteria 3470
26 Ga0070666_10002633 3300005335 Bacteria 10846
27 Ga0070680_100201705 3300005336 Bacteria 1678
28 Ga0070682_100016612 3300005337 Bacteria 4283
29 Ga0070682_100025176 3300005337 Bacteria 3549
30 Ga0070682_100418537 3300005337 Bacteria 1018
31 Ga0068868_100002656 3300005338 Bacteria 12403
32 Ga0068868_100634853 3300005338 Bacteria 949
33 Ga0070660_100060619 3300005339 Bacteria 2937
34 Ga0070660_100328157 3300005339 Bacteria 1258
35 Ga0070689_100016638 3300005340 Bacteria 5383
36 Ga0070691_10134204 3300005341 Bacteria 1256
37 Ga0070691_10274115 3300005341 Bacteria 913
38 Ga0070661_100085923 3300005344 Bacteria 2325
39 Ga0070668_100000347 3300005347 Bacteria 30543
40 Ga0070668_100001780 3300005347 Bacteria 15656
41 Ga0070668_100127838 3300005347 Bacteria 2037
42 Ga0070669_100039437 3300005353 Bacteria 3432
43 Ga0070675_100317031 3300005354 Bacteria 1377
44 Ga0070671_100029440 3300005355 Bacteria 4528
45 Ga0070674_100003233 3300005356 Bacteria 9094
46 Ga0070674_100514865 3300005356 Bacteria 999
47 Ga0070673_100090673 3300005364 Bacteria 2497
48 Ga0070688_100004005 3300005365 Bacteria 7639
49 Ga0070688_100031996 3300005365 Bacteria 3168
50 Ga0070659_100352474 3300005366 Bacteria 1235
51 Ga0070659_100373836 3300005366 Bacteria 1199
52 Ga0070659_100517068 3300005366 Bacteria 1019
53 Ga0070667_100005709 3300005367 Bacteria 10397
54 Ga0070667_100407087 3300005367 Bacteria 1239
55 Ga0070709_10004024 3300005434 Bacteria 7930
56 Ga0070714_100976032 3300005435 Bacteria 824
57 Ga0070710_10025644 3300005437 Bacteria 3123
58 Ga0070701_10002486 3300005438 Bacteria 7121
59 Ga0070701_10238996 3300005438 Bacteria 1092
60 Ga0070711_100000402 3300005439 Bacteria 22353
61 Ga0070711_100000860 3300005439 Bacteria 15973
62 Ga0070705_100031929 3300005440 Bacteria 2921
63 Ga0070705_100115944 3300005440 Bacteria 1721
64 Ga0070700_100005259 3300005441 Bacteria 6845
65 Ga0070694_100004412 3300005444 Bacteria 8459
66 Ga0070694_100305386 3300005444 Bacteria 1220
67 Ga0070708_101360309 3300005445 Bacteria 663
68 Ga0070663_100069326 3300005455 Bacteria 2561
69 Ga0070663_100182113 3300005455 Bacteria 1630
70 Ga0070678_100000273 3300005456 Bacteria 23976
71 Ga0070678_100026963 3300005456 Bacteria 3893
72 Ga0070662_100098007 3300005457 Bacteria 2213
73 Ga0070662_100182676 3300005457 Bacteria 1654
74 Ga0070662_100386958 3300005457 Bacteria 1152
75 Ga0068867_100002987 3300005459 Bacteria 11917
76 Ga0068867_100410188 3300005459 Bacteria 1145
77 Ga0070685_10026763 3300005466 Bacteria 3181
78 Ga0070707_100602719 3300005468 Bacteria 1061
79 Ga0070679_100653536 3300005530 Bacteria 994
80 Ga0070684_100026869 3300005535 Bacteria 4852
81 Ga0070697_100688219 3300005536 Bacteria 902
82 Ga0068853_100002811 3300005539 Bacteria 13177
83 Ga0068853_100510569 3300005539 Bacteria 1136
84 Ga0068853_100546987 3300005539 Bacteria 1096
85 Ga0070686_100331292 3300005544 Bacteria 1138
86 Ga0070695_100008824 3300005545 Bacteria 5990
87 Ga0070695_100114250 3300005545 Bacteria 1838
88 Ga0070696_100000796 3300005546 Bacteria 20313
89 Ga0070696_100174628 3300005546 Bacteria 1591
90 Ga0070693_100007039 3300005547 Bacteria 5478
91 Ga0070693_100818455 3300005547 Bacteria 692
92 Ga0070665_100000821 3300005548 Bacteria 40648
93 Ga0070665_100005361 3300005548 Bacteria 13239
94 Ga0070665_100049345 3300005548 Bacteria 4224
95 Ga0070704_100032789 3300005549 Bacteria 3507
96 Ga0070704_100069505 3300005549 Bacteria 2551
97 Ga0068855_100369885 3300005563 Bacteria 1576
98 Ga0068857_100008819 3300005577 Bacteria 8735
99 Ga0068854_100101132 3300005578 Bacteria 2161
100 Ga0068854_100297695 3300005578 Bacteria 1304
101 Ga0068856_100150028 3300005614 Bacteria 2340
102 Ga0070702_100007930 3300005615 Bacteria 5114
103 Ga0070702_100658501 3300005615 Bacteria 793
104 Ga0068852_100692397 3300005616 Bacteria 1029
105 Ga0068859_100005745 3300005617 Bacteria 12616
106 Ga0068864_100236513 3300005618 Bacteria 1691
107 Ga0068866_10000419 3300005718 Bacteria 19721
108 Ga0068866_10148991 3300005718 Bacteria 1352
109 Ga0068866_10259538 3300005718 Bacteria 1067
110 Ga0068861_100301020 3300005719 Bacteria 1389
111 Ga0068870_10663283 3300005840 Bacteria 716
112 Ga0068863_100048870 3300005841 Bacteria 4011
113 Ga0068863_100567042 3300005841 Bacteria 1122
114 Ga0068858_100022886 3300005842 Bacteria 5829
115 Ga0068858_100050241 3300005842 Bacteria 3859
116 Ga0068860_100000035 3300005843 Bacteria 238993
117 Ga0068860_100000775 3300005843 Bacteria 35961
118 Ga0068860_100498305 3300005843 Bacteria 1216
119 Ga0068862_100005734 3300005844 Bacteria 10366
120 Ga0068862_100199094 3300005844 Bacteria 1805
121 Ga0081455_10011687 3300005937 Bacteria 8804
122 Ga0081455_10077189 3300005937 Bacteria 2741
123 Ga0081455_10185414 3300005937 Bacteria 1572
124 Ga0081538_10004521 3300005981 Bacteria 12805
125 Ga0081538_10031865 3300005981 Bacteria 3546
126 Ga0081539_10003298 3300005985 Bacteria 20193
127 Ga0070717_10234650 3300006028 Bacteria 1616
128 Ga0075365_10049058 3300006038 Bacteria 2780
129 Ga0075365_10077920 3300006038 Bacteria 2240
130 Ga0075365_10265683 3300006038 Bacteria 1207
131 Ga0075365_10314292 3300006038 Bacteria 1103
132 Ga0075368_10090096 3300006042 Bacteria 1254
133 Ga0075363_100002031 3300006048 Bacteria 8070
134 Ga0075363_100013855 3300006048 Bacteria 3924
135 Ga0075363_100022561 3300006048 Bacteria 3183
136 Ga0075363_100023916 3300006048 Bacteria 3102
137 Ga0075363_100089770 3300006048 Bacteria 1690
138 Ga0075363_100093897 3300006048 Bacteria 1654
139 Ga0075364_10000303 3300006051 Bacteria 24056
140 Ga0075364_10011745 3300006051 Bacteria 5331
141 Ga0075364_10040679 3300006051 Bacteria 3015
142 Ga0075364_10084199 3300006051 Bacteria 2105
143 Ga0070716_100000471 3300006173 Bacteria 16672
144 Ga0070716_100017054 3300006173 Bacteria 3758
145 Ga0070712_100115385 3300006175 Bacteria 2012
146 Ga0070712_100212556 3300006175 Bacteria 1526
147 Ga0075362_10011769 3300006177 Bacteria 3454
148 Ga0075362_10060613 3300006177 Bacteria 1711
149 Ga0075369_10000129 3300006186 Bacteria 20893
150 Ga0075369_10242427 3300006186 Bacteria 836
151 Ga0075369_10256598 3300006186 Bacteria 812
152 Ga0075369_10286283 3300006186 Bacteria 768
153 Ga0097621_100033270 3300006237 Bacteria 4104
154 Ga0097621_100704384 3300006237 Bacteria 930
155 Ga0075370_10180480 3300006353 Bacteria 1242
156 Ga0075370_10372709 3300006353 Bacteria 855
157 Ga0068865_100004325 3300006881 Bacteria 8577
158 Ga0068865_100065650 3300006881 Bacteria 2558
159 Ga0068865_100505892 3300006881 Bacteria 1008
160 Ga0097620_100005745 3300006931 Bacteria 12616
161 Ga0105250_10452626 3300009092 Bacteria 576
162 Ga0105240_10593424 3300009093 Bacteria 1220
163 Ga0105245_10032532 3300009098 Bacteria 4617
164 Ga0105245_10037427 3300009098 Bacteria 4314
165 Ga0105247_10003162 3300009101 Bacteria 10855
166 Ga0105247_10120331 3300009101 Bacteria 1700
167 Ga0105247_10804061 3300009101 Bacteria 718
168 Ga0114129_10306156 3300009147 Bacteria 2116
169 Ga0105243_10001826 3300009148 Bacteria 18210
170 Ga0105243_10547090 3300009148 Bacteria 1105
171 Ga0105241_10059209 3300009174 Bacteria 2944
172 Ga0105241_10076888 3300009174 Bacteria 2604
173 Ga0105241_11566785 3300009174 Bacteria 636
174 Ga0105242_10000459 3300009176 Bacteria 32413
175 Ga0105242_10023936 3300009176 Bacteria 4819
176 Ga0105242_10841038 3300009176 Bacteria 912
177 Ga0105248_10003999 3300009177 Bacteria 16302
178 Ga0105248_10275424 3300009177 Bacteria 1895
179 Ga0105237_10108924 3300009545 Bacteria 2761
180 Ga0105237_10447552 3300009545 Bacteria 1297
181 Ga0105238_10091684 3300009551 Bacteria 3026
182 Ga0105238_10262247 3300009551 Bacteria 1707
183 Ga0105249_10006558 3300009553 Bacteria 10127
184 Ga0105249_10083288 3300009553 Bacteria 2977
185 Ga0105249_10367509 3300009553 Bacteria 1461
186 Ga0105249_10642350 3300009553 Bacteria 1118
187 Ga0105249_10866566 3300009553 Bacteria 969
188 Ga0105239_10012460 3300010375 Bacteria 9470
189 Ga0105239_10416493 3300010375 Bacteria 1521
190 Ga0105239_10571827 3300010375 Bacteria 1288
191 Ga0105239_10810185 3300010375 Bacteria 1073
192 Ga0105239_11461457 3300010375 Bacteria 790
193 Ga0105246_10002382 3300011119 Bacteria 11342
194 Ga0105246_10321670 3300011119 Bacteria 1257
195 Ga0157371_10647766 3300013102 Bacteria 788
196 Ga0157369_10019113 3300013105 Bacteria 7669
197 Ga0157369_10140861 3300013105 Bacteria 2552
198 Ga0157369_10531931 3300013105 Bacteria 1215
199 Ga0157369_11669617 3300013105 Bacteria 647
200 Ga0157374_10013307 3300013296 Bacteria 7179
201 Ga0157374_10252377 3300013296 Bacteria 1736
202 Ga0157378_10003979 3300013297 Bacteria 13058
203 Ga0157378_10170604 3300013297 Bacteria 2040
204 Ga0157378_12953374 3300013297 Bacteria 527
205 Ga0163162_10006338 3300013306 Bacteria 11457
206 Ga0163162_10240440 3300013306 Bacteria 1941
207 Ga0157372_10109161 3300013307 Bacteria 3168
208 Ga0157372_10239765 3300013307 Bacteria 2104
209 Ga0157372_10829356 3300013307 Bacteria 1074
210 Ga0157372_12365335 3300013307 Bacteria 610
211 Ga0157375_10009568 3300013308 Bacteria 8510
212 Ga0157375_10209038 3300013308 Bacteria 2108
213 Ga0163163_10088004 3300014325 Bacteria 3117
214 Ga0157380_10001560 3300014326 Bacteria 15073
215 Ga0157380_10407507 3300014326 Bacteria 1292
216 Ga0157377_10068682 3300014745 Bacteria 2043
217 Ga0157377_10086101 3300014745 Bacteria 1846
218 Ga0157377_10130474 3300014745 Bacteria 1534
219 Ga0157379_10013893 3300014968 Bacteria 7057
220 Ga0157379_10017352 3300014968 Bacteria 6342
221 Ga0157379_10033521 3300014968 Bacteria 4579
222 Ga0157376_10446008 3300014969 Bacteria 1261
223 Ga0163161_10003090 3300017792 Bacteria 11750
224 Ga0163161_10595014 3300017792 Bacteria 911
225 Ga0163161_10849656 3300017792 Bacteria 770
226 Ga0197907_10828368 3300020069 Bacteria 1799
227 Ga0213873_10037562 3300021358 Bacteria 1234
228 Ga0213875_10065288 3300021388 Bacteria 1701
229 Ga0224712_10075666 3300022467 Bacteria 1378
230 Ga0209672_100004 3300025228 Bacteria 1467504
231 Ga0209563_100028 3300025230 Bacteria 509539
232 Ga0209258_100003 3300025242 Bacteria 1467504
233 Ga0209646_1003803 3300025246 Bacteria 2885
234 Ga0209026_1000281 3300025250 Bacteria 58797
235 Ga0209148_1000016 3300025254 Bacteria 804369
236 Ga0209759_1008527 3300025256 Bacteria 3184
237 Ga0209455_1000004 3300025272 Bacteria 1467504
238 Ga0207642_10004024 3300025899 Bacteria 4702
239 Ga0207642_10085089 3300025899 Bacteria 1547
240 Ga0207642_10278779 3300025899 Bacteria 961
241 Ga0207710_10004040 3300025900 Bacteria 6454
242 Ga0207688_10010768 3300025901 Bacteria 4977
243 Ga0207680_10003070 3300025903 Bacteria 7838
244 Ga0207680_10010590 3300025903 Bacteria 4619
245 Ga0207647_10066300 3300025904 Bacteria 2189
246 Ga0207647_10080074 3300025904 Bacteria 1960
247 Ga0207647_10248643 3300025904 Bacteria 1020
248 Ga0207685_10001517 3300025905 Bacteria 4910
249 Ga0207699_10014305 3300025906 Bacteria 4087
250 Ga0207645_10038444 3300025907 Bacteria 3069
251 Ga0207645_10166126 3300025907 Bacteria 1445
252 Ga0207705_10765082 3300025909 Bacteria 750
253 Ga0207654_10139797 3300025911 Bacteria 1543
254 Ga0207654_10209233 3300025911 Bacteria 1288
255 Ga0207654_10709275 3300025911 Bacteria 723
256 Ga0207671_10410821 3300025914 Bacteria 1077
257 Ga0207671_10478155 3300025914 Bacteria 993
258 Ga0207671_10979625 3300025914 Bacteria 667
259 Ga0207693_10000381 3300025915 Bacteria 40785
260 Ga0207693_10001414 3300025915 Bacteria 21264
261 Ga0207663_10004663 3300025916 Bacteria 6840
262 Ga0207663_10324343 3300025916 Bacteria 1158
263 Ga0207663_10505795 3300025916 Bacteria 939
264 Ga0207660_10125433 3300025917 Bacteria 1949
265 Ga0207662_10089950 3300025918 Bacteria 1887
266 Ga0207657_10225338 3300025919 Bacteria 1501
267 Ga0207657_10605984 3300025919 Bacteria 854
268 Ga0207652_10361109 3300025921 Bacteria 1311
269 Ga0207652_10551588 3300025921 Bacteria 1036
270 Ga0207681_10112725 3300025923 Bacteria 1981
271 Ga0207681_10156179 3300025923 Bacteria 1715
272 Ga0207694_10099044 3300025924 Bacteria 2309
273 Ga0207694_10305147 3300025924 Bacteria 1311
274 Ga0207687_10000587 3300025927 Bacteria 24594
275 Ga0207687_10530327 3300025927 Bacteria 986
276 Ga0207664_10190289 3300025929 Bacteria 1766
277 Ga0207664_11069970 3300025929 Bacteria 722
278 Ga0207644_10308513 3300025931 Bacteria 1277
279 Ga0207690_10532665 3300025932 Bacteria 953
280 Ga0207690_10707389 3300025932 Bacteria 829
281 Ga0207706_10046021 3300025933 Bacteria 3864
282 Ga0207686_10015983 3300025934 Bacteria 4206
283 Ga0207709_10028683 3300025935 Bacteria 3220
284 Ga0207709_10210212 3300025935 Bacteria 1396
285 Ga0207670_10006540 3300025936 Bacteria 6470
286 Ga0207669_10001288 3300025937 Bacteria 10653
287 Ga0207704_10001708 3300025938 Bacteria 9820
288 Ga0207704_10055306 3300025938 Bacteria 2425
289 Ga0207704_10341437 3300025938 Bacteria 1162
290 Ga0207665_10021570 3300025939 Bacteria 4236
291 Ga0207665_10134296 3300025939 Bacteria 1759
292 Ga0207711_10029205 3300025941 Bacteria 4647
293 Ga0207711_10115504 3300025941 Bacteria 2392
294 Ga0207689_10016281 3300025942 Bacteria 6298
295 Ga0207689_10017429 3300025942 Bacteria 6077
296 Ga0207689_10474131 3300025942 Bacteria 1047
297 Ga0207661_10231513 3300025944 Bacteria 1636
298 Ga0207661_11814922 3300025944 Bacteria 555
299 Ga0207679_10804914 3300025945 Bacteria 857
300 Ga0207679_10986905 3300025945 Bacteria 772
301 Ga0207667_10363536 3300025949 Bacteria 1476
302 Ga0207651_10485760 3300025960 Bacteria 1065
303 Ga0207712_10033254 3300025961 Bacteria 3484
304 Ga0207712_10264942 3300025961 Bacteria 1395
305 Ga0207712_10361870 3300025961 Bacteria 1209
306 Ga0207712_10911101 3300025961 Bacteria 777
307 Ga0207712_11002999 3300025961 Bacteria 741
308 Ga0207668_10004077 3300025972 Bacteria 8587
309 Ga0207668_10007345 3300025972 Bacteria 6549
310 Ga0207668_11367761 3300025972 Bacteria 638
311 Ga0207640_10013690 3300025981 Bacteria 4654
312 Ga0207640_10274045 3300025981 Bacteria 1322
313 Ga0207640_10508933 3300025981 Bacteria 1004
314 Ga0207640_10848419 3300025981 Bacteria 795
315 Ga0207658_10017204 3300025986 Bacteria 4981
316 Ga0207677_10310657 3300026023 Bacteria 1306
317 Ga0207677_10690804 3300026023 Bacteria 904
318 Ga0207703_10039188 3300026035 Bacteria 3786
319 Ga0207703_10056148 3300026035 Bacteria 3206
320 Ga0207703_10385246 3300026035 Bacteria 1298
321 Ga0207639_10018307 3300026041 Bacteria 4977
322 Ga0207639_10133457 3300026041 Bacteria 2059
323 Ga0207678_10004848 3300026067 Bacteria 12086
324 Ga0207678_10093791 3300026067 Bacteria 2564
325 Ga0207708_10018949 3300026075 Bacteria 5183
326 Ga0207708_10176416 3300026075 Bacteria 1695
327 Ga0207702_10052727 3300026078 Bacteria 3443
328 Ga0207702_10377407 3300026078 Bacteria 1363
329 Ga0207641_10012729 3300026088 Bacteria 6897
330 Ga0207641_10464498 3300026088 Bacteria 1225
331 Ga0207648_10000462 3300026089 Bacteria 45206
332 Ga0207648_10073136 3300026089 Bacteria 2988
333 Ga0207676_10127111 3300026095 Bacteria 2161
334 Ga0207676_10526579 3300026095 Bacteria 1126
335 Ga0207674_10014897 3300026116 Bacteria 8573
336 Ga0207675_100000768 3300026118 Bacteria 31981
337 Ga0207675_100266320 3300026118 Bacteria 1662
338 Ga0207675_100447979 3300026118 Bacteria 1279
339 Ga0207683_10000575 3300026121 Bacteria 33996
340 Ga0207683_10150507 3300026121 Bacteria 2100
341 Ga0207698_10067881 3300026142 Bacteria 2814
342 Ga0207698_10967468 3300026142 Bacteria 861
343 Ga0268266_10003777 3300028379 Bacteria 14835
344 Ga0268266_10084714 3300028379 Bacteria 2768
345 Ga0268265_10014518 3300028380 Bacteria 5369
346 Ga0268265_10692889 3300028380 Bacteria 983
347 Ga0268264_10000031 3300028381 Bacteria 409525
348 Ga0268264_10004232 3300028381 Bacteria 12249
349 Ga0268264_10420373 3300028381 Bacteria 1289
350 Ga0268264_12157866 3300028381 Bacteria 565
351 Ga0265338_10027056 3300028800 Bacteria 5765
352 Ga0265327_10010227 3300031251 Bacteria 6627
353 Ga0307409_100604709 3300031995 Bacteria 1084
354 Ga0373949_0076523 3300035090 Bacteria 885
355 Ga0373949_0173788 3300035090 Bacteria 634
356 Ga0373923_0022109 3300035111 Bacteria 2490
357 Ga0373960_0356500 3300035121 Bacteria 556
358 Ga0373935_1288236 3300035692 Bacteria 545
359 Ga0436364_0332337 3300037853 Bacteria 1098
360 Ga0436364_0406475 3300037853 Bacteria 2798
361 Ga0436364_1019987 3300037853 Bacteria 1980
362 Ga0436362_0337613 3300039453 Bacteria 1541
363 Ga0451797_0578190 3300041453 Bacteria 1421
364 Ga0451807_2424073 3300041486 Bacteria 642
365 Ga0451843_0327092 3300041509 Bacteria 981
366 Ga0451853_2158879 3300041512 Bacteria 1305
367 Ga0466969_0065346 3300044656 Bacteria 1759
368 Ga0466969_0085665 3300044656 Bacteria 1498
369 Ga0466969_0099441 3300044656 Bacteria 1371
370 Ga0466972_0012804 3300044658 Bacteria 4212
371 Ga0466972_0016581 3300044658 Bacteria 3683
372 Ga0466972_0056586 3300044658 Bacteria 1886
373 Ga0466965_0000685 3300044683 Bacteria 12514
374 Ga0466965_0051130 3300044683 Bacteria 2050
375 Ga0466965_0407571 3300044683 Bacteria 752
376 Ga0466965_0519921 3300044683 Bacteria 669
377 Ga0466966_0013868 3300044684 Bacteria 5334
378 Ga0466966_0058391 3300044684 Bacteria 2438
379 Ga0466966_0067623 3300044684 Bacteria 2244
380 Ga0466966_0159544 3300044684 Bacteria 1373
381 Ga0466966_0196883 3300044684 Bacteria 1220
382 Ga0466961_0005936 3300044693 Bacteria 7741
383 Ga0466961_0054471 3300044693 Bacteria 2551
384 Ga0466961_0101936 3300044693 Bacteria 1808
385 Ga0466961_0142303 3300044693 Bacteria 1501
386 Ga0466961_0470870 3300044693 Bacteria 760
387 Ga0466963_0059216 3300044694 Bacteria 2556
388 Ga0466963_0107554 3300044694 Bacteria 1913
389 Ga0466963_0497531 3300044694 Bacteria 861
390 Ga0466963_0592075 3300044694 Bacteria 783
391 Ga0466964_0052557 3300044706 Bacteria 1675
392 Ga0466964_0086649 3300044706 Bacteria 1355
393 Ga0466964_0141666 3300044706 Bacteria 1106
394 Ga0466964_0202030 3300044706 Bacteria 955
395 Ga0466971_0024229 3300044719 Bacteria 2708
396 Ga0466971_0620940 3300044719 Bacteria 540
397 Ga0466968_0000928 3300044735 Bacteria 10322
398 Ga0466968_0260617 3300044735 Bacteria 825
399 Ga0466970_0077642 3300044765 Bacteria 1790
400 Ga0466970_0089151 3300044765 Bacteria 1673
401 Ga0466970_0157229 3300044765 Bacteria 1256
402 Ga0466970_0372336 3300044765 Bacteria 812
403 Ga0466970_0524568 3300044765 Bacteria 683
404 Ga0466957_0006881 3300044842 Bacteria 6425
405 Ga0466957_0065269 3300044842 Bacteria 2241
406 Ga0466957_0297004 3300044842 Bacteria 1084
407 Ga0466960_0108912 3300044901 Bacteria 1436
408 Ga0466960_0300440 3300044901 Bacteria 904
409 Ga0466960_0338013 3300044901 Bacteria 856
410 Ga0466959_0020726 3300045049 Bacteria 4844
411 Ga0466959_0032197 3300045049 Bacteria 3881
412 Ga0466959_0199351 3300045049 Bacteria 1394
413 Ga0466959_0302738 3300045049 Bacteria 1094
414 Ga0466959_0322550 3300045049 Bacteria 1056
415 Ga0466959_0459689 3300045049 Bacteria 862
416 Ga0466959_0527514 3300045049 Bacteria 797
417 Ga0451576_0250245 3300045051 Bacteria 1852
418 Ga0466958_0003414 3300045836 Bacteria 8245
419 Ga0466958_0006577 3300045836 Bacteria 6336
420 Ga0466958_0037102 3300045836 Bacteria 2919
421 Ga0466958_0095622 3300045836 Bacteria 1842
422 Ga0466958_0309393 3300045836 Bacteria 1015
423 Ga0466958_0326190 3300045836 Bacteria 987
424 Ga0466958_0459081 3300045836 Bacteria 825
425 Ga0466967_0007720 3300045976 Bacteria 7798
426 Ga0466967_0028377 3300045976 Bacteria 4672
427 Ga0466967_0089596 3300045976 Bacteria 2793
428 Ga0466967_0126986 3300045976 Bacteria 2363
429 Ga0466967_0262998 3300045976 Bacteria 1651
430 Ga0466967_0263007 3300045976 Bacteria 1651
431 Ga0466967_0464415 3300045976 Bacteria 1238
432 Ga0495638_0000563 3300046460 Bacteria 42248
433 Ga0495641_0121577 3300046461 Bacteria 1165
434 Ga0495582_0614298 3300046473 Bacteria 629
435 Ga0495639_0111775 3300046475 Bacteria 1297
436 Ga0495585_0120502 3300046492 Bacteria 1388
437 Ga0495608_0285103 3300046511 Bacteria 1024
438 Ga0495666_0095129 3300046526 Bacteria 1405
439 Ga0495652_0711185 3300046529 Bacteria 675
440 Ga0495665_0486225 3300046531 Bacteria 622
441 Ga0495640_0044374 3300046533 Bacteria 3091
442 Ga0495640_0461776 3300046533 Bacteria 775
443 Ga0495634_0091948 3300046642 Bacteria 1969
444 Ga0495611_0424511 3300046648 Bacteria 607
445 Ga0495625_0148674 3300046660 Bacteria 1576
446 Ga0495625_0534438 3300046660 Bacteria 712
447 Ga0495635_0457265 3300046663 Bacteria 843
448 Ga0495657_0350130 3300046675 Bacteria 874
449 Ga0495658_0188015 3300046683 Bacteria 1283
450 Ga0495613_0527106 3300046689 Bacteria 793
451 Ga0495649_0201929 3300046694 Bacteria 1032
452 Ga0495649_0415441 3300046694 Bacteria 674
453 Ga0495674_0514288 3300047319 Bacteria 956
454 Ga0495676_0648472 3300047321 Bacteria 685
455 Ga0495680_0072616 3300047322 Bacteria 2617
456 Ga0495593_0030322 3300047673 Bacteria 2960
457 Ga0495626_0267001 3300048091 Bacteria 683
458 Ga0496100_0007272 3300048903 Bacteria 6091
459 Ga0496100_0480218 3300048903 Bacteria 956
460 Ga0496101_0027794 3300048904 Bacteria 3944
461 Ga0496102_0001190 3300048905 Bacteria 23615
462 Ga0496102_0101907 3300048905 Bacteria 2668
463 Ga0496102_0833475 3300048905 Bacteria 844
464 Ga0496103_0001391 3300048906 Bacteria 16284
465 Ga0496103_0092510 3300048906 Bacteria 1909
466 Ga0496104_0073058 3300048907 Bacteria 3263
467 Ga0496106_0010229 3300048909 Bacteria 6934
468 Ga0496106_0186141 3300048909 Bacteria 1650
469 Ga0496106_0549226 3300048909 Bacteria 927
470 Ga0496107_0000760 3300048910 Bacteria 18575
471 Ga0496107_0160349 3300048910 Bacteria 1667
472 Ga0496107_0358006 3300048910 Bacteria 1086
473 Ga0496107_0522359 3300048910 Bacteria 880
474 Ga0496107_0558328 3300048910 Bacteria 848
475 Ga0496107_1270335 3300048910 Bacteria 527
476 Ga0496108_0010094 3300048911 Bacteria 7663
477 Ga0496108_0011269 3300048911 Bacteria 7264
478 Ga0496108_0034514 3300048911 Bacteria 4204
479 Ga0496108_0466524 3300048911 Bacteria 1103
480 Ga0496108_0738885 3300048911 Bacteria 852
481 Ga0496108_0848471 3300048911 Bacteria 786
482 Ga0496108_1753196 3300048911 Bacteria 510
483 Ga0496109_0002148 3300048912 Bacteria 16388
484 Ga0496109_0042367 3300048912 Bacteria 4123
485 Ga0496110_0380003 3300048913 Bacteria 1287
486 Ga0496111_0040429 3300048914 Bacteria 3345
487 Ga0496111_0085836 3300048914 Bacteria 2302
488 Ga0496111_0234739 3300048914 Bacteria 1362
489 Ga0496113_0165653 3300048916 Bacteria 1749
490 Ga0496113_0242246 3300048916 Bacteria 1439
491 Ga0496114_0001875 3300048917 Bacteria 15936
492 Ga0496115_0004439 3300048918 Bacteria 10169
493 Ga0501034_0003091 3300049571 Bacteria 19192
494 Ga0501034_0204785 3300049571 Bacteria 1930
495 Ga0501037_0439646 3300049573 Bacteria 891
496 Ga0501043_1131343 3300049579 Bacteria 552
497 Ga0501047_0642600 3300049581 Bacteria 881
498 Ga0501047_0857831 3300049581 Bacteria 722
499 Ga0501047_0903648 3300049581 Bacteria 696
500 Ga0501047_1063196 3300049581 Bacteria 623
501 Ga0501067_0026209 3300049583 Bacteria 3230
502 Ga0501067_0634284 3300049583 Bacteria 600
503 Ga0501068_0003128 3300049584 Bacteria 8856
504 Ga0501068_0083003 3300049584 Bacteria 1969
505 Ga0501069_0000052 3300049585 Bacteria 69909
506 Ga0501070_0000030 3300049586 Bacteria 139270
507 Ga0501070_0069240 3300049586 Bacteria 2921
508 Ga0501070_0420279 3300049586 Bacteria 1080
509 Ga0501070_0505064 3300049586 Bacteria 971
510 Ga0501070_0595798 3300049586 Bacteria 881
511 Ga0501071_0022503 3300049587 Bacteria 4394
512 Ga0501071_0241466 3300049587 Bacteria 1362
513 Ga0501071_1092998 3300049587 Bacteria 616
514 Ga0501072_0171672 3300049588 Bacteria 1730
515 Ga0501073_0017820 3300049589 Bacteria 5140
516 Ga0501073_0262430 3300049589 Bacteria 1192
517 Ga0501074_0035839 3300049590 Bacteria 3594
518 Ga0501080_0004387 3300049742 Bacteria 12532
519 Ga0501080_0019341 3300049742 Bacteria 6309
520 Ga0501080_0128721 3300049742 Bacteria 2344
521 Ga0501080_0529539 3300049742 Bacteria 1051
522 Ga0501083_0005470 3300049744 Bacteria 8996
523 Ga0501083_0622060 3300049744 Bacteria 702
524 Ga0501044_0265740 3300049823 Bacteria 1653
525 nmdc:mga03683_21876_c1 3300050489 Bacteria 2472
526 nmdc:mga03683_69745_c1 3300050489 Bacteria 1500
527 nmdc:mga03n38_10885_c1 3300050490 Bacteria 3368
528 nmdc:mga03n38_23297_c1 3300050490 Bacteria 2517
529 nmdc:mga03n38_3586_c1 3300050490 Bacteria 5012
530 nmdc:mga03n38_4344_c1 3300050490 Bacteria 4682
531 nmdc:mga03n38_789072_c1 3300050490 Bacteria 552
532 nmdc:mga03n38_8261_c1 3300050490 Bacteria 3727
533 nmdc:mga03n38_829130_c1 3300050490 Bacteria 540
534 nmdc:mga00v17_143508_c1 3300050491 Bacteria 1532
535 nmdc:mga00v17_206426_c1 3300050491 Bacteria 1271
536 nmdc:mga00v17_37521_c1 3300050491 Bacteria 2895
537 nmdc:mga00v17_39824_c1 3300050491 Bacteria 2816
538 nmdc:mga00v17_5446_c1 3300050491 Bacteria 6702
539 nmdc:mga0yw44_142464_c1 3300050492 Bacteria 1558
540 nmdc:mga0yw44_15301_c1 3300050492 Bacteria 4105
541 nmdc:mga0yw44_215454_c1 3300050492 Bacteria 1271
542 nmdc:mga0yw44_464056_c1 3300050492 Bacteria 858
543 nmdc:mga0yw44_758273_c1 3300050492 Bacteria 659
544 nmdc:mga0yw44_98777_c1 3300050492 Bacteria 1857
545 nmdc:mga06z11_140360_c1 3300050494 Bacteria 1365
546 nmdc:mga06z11_4117_c1 3300050494 Bacteria 5681
547 nmdc:mga06z11_86081_c1 3300050494 Bacteria 1697
548 nmdc:mga04h51_174928_c1 3300050495 Bacteria 833
549 nmdc:mga07m45_50544_c1 3300050496 Bacteria 2343
550 nmdc:mga07m45_80553_c1 3300050496 Bacteria 1859
551 nmdc:mga0qj67_419368_c1 3300050509 Bacteria 1079
552 nmdc:mga0sz30_2742_c1 3300050516 Bacteria 6286
553 nmdc:mga0sz30_73493_c1 3300050516 Bacteria 1474
554 nmdc:mga0sz30_93514_c1 3300050516 Bacteria 1309
555 Ga0500610_0245956 3300053079 Bacteria 828
556 Ga0495655_0003715 3300053083 Bacteria 2545
557 Ga0495619_0221785 3300053085 Bacteria 1310
558 Ga0495619_0268887 3300053085 Bacteria 1181
559 Ga0500644_0040039 3300053088 Bacteria 1549
560 Ga0500556_0253053 3300053104 Bacteria 693
561 Ga0500562_040357 3300053108 Bacteria 1241
562 Ga0500628_161399 3300053129 Bacteria 632
563 Ga0500577_0311419 3300053142 Bacteria 687
564 Ga0500604_0111155 3300053151 Bacteria 910
565 Ga0590071_008796 3300059421 Bacteria 2373
566 Ga0590074_015218 3300059423 Bacteria 1305
567 Ga0590075_002363 3300059424 Bacteria 4530
568 Ga0590075_022717 3300059424 Bacteria 1570
569 Ga0590077_003731 3300059426 Bacteria 3143
570 Ga0590077_051866 3300059426 Bacteria 921
571 Ga0501082_0392410 3300060353 Bacteria 1211
572 Ga0466962_0049026 3300061719 Bacteria 2018
573 Ga0466962_0537305 3300061719 Bacteria 593
574 Ga0466962_0546680 3300061719 Bacteria 588
575 Ga0081538_10012290
576 JGI24746J21847_1005511
577 JGI24739J22299_10031098
578 JGI24737J22298_10055191
579 JGI24737J22298_10094541
580 JGI24737J22298_10172141
581 JGI24743J22301_10006415
582 JGI24745J21846_1003847
583 JGI24738J21930_10011625
584 JGI24744J21845_10007872
585 JGI24742J22300_10005704
586 JGI25156J39149_1027211
587 JGI25154J39366_1028162
588 JGI25157J39369_1007493
589 JGI25406J46586_10009256
590 JGI25407J50210_10038829
591 Ga0055527_1000071
592 Ga0055535_1000213
593 Ga0055542_1000161
594 Ga0055529_1000272
595 Ga0070658_10619519
596 Ga0070676_10028008
597 Ga0070683_100032193
598 Ga0070683_101583279
599 Ga0068869_100036967
600 Ga0070666_10002633
601 Ga0070680_100201705
602 Ga0070682_100016612
603 Ga0070682_100025176
604 Ga0070682_100418537
605 Ga0068868_100002656
606 Ga0068868_100634853
607 Ga0070660_100060619
608 Ga0070660_100328157
609 Ga0070689_100016638
610 Ga0070691_10134204
611 Ga0070691_10274115
612 Ga0070661_100085923
613 Ga0070668_100000347
614 Ga0070668_100001780
615 Ga0070668_100127838
616 Ga0070669_100039437
617 Ga0070675_100317031
618 Ga0070671_100029440
619 Ga0070674_100003233
620 Ga0070674_100514865
621 Ga0070673_100090673
622 Ga0070688_100004005
623 Ga0070688_100031996
624 Ga0070659_100352474
625 Ga0070659_100373836
626 Ga0070659_100517068
627 Ga0070667_100005709
628 Ga0070667_100407087
629 Ga0070709_10004024
630 Ga0070714_100976032
631 Ga0070710_10025644
632 Ga0070701_10002486
633 Ga0070701_10238996
634 Ga0070711_100000402
635 Ga0070711_100000860
636 Ga0070705_100031929
637 Ga0070705_100115944
638 Ga0070700_100005259
639 Ga0070694_100004412
640 Ga0070694_100305386
641 Ga0070708_101360309
642 Ga0070663_100069326
643 Ga0070663_100182113
644 Ga0070678_100000273
645 Ga0070678_100026963
646 Ga0070662_100098007
647 Ga0070662_100182676
648 Ga0070662_100386958
649 Ga0068867_100002987
650 Ga0068867_100410188
651 Ga0070685_10026763
652 Ga0070707_100602719
653 Ga0070679_100653536
654 Ga0070684_100026869
655 Ga0070697_100688219
656 Ga0068853_100002811
657 Ga0068853_100510569
658 Ga0068853_100546987
659 Ga0070686_100331292
660 Ga0070695_100008824
661 Ga0070695_100114250
662 Ga0070696_100000796
663 Ga0070696_100174628
664 Ga0070693_100007039
665 Ga0070693_100818455
666 Ga0070665_100000821
667 Ga0070665_100005361
668 Ga0070665_100049345
669 Ga0070704_100032789
670 Ga0070704_100069505
671 Ga0068855_100369885
672 Ga0068857_100008819
673 Ga0068854_100101132
674 Ga0068854_100297695
675 Ga0068856_100150028
676 Ga0070702_100007930
677 Ga0070702_100658501
678 Ga0068852_100692397
679 Ga0068859_100005745
680 Ga0068864_100236513
681 Ga0068866_10000419
682 Ga0068866_10148991
683 Ga0068866_10259538
684 Ga0068861_100301020
685 Ga0068870_10663283
686 Ga0068863_100048870
687 Ga0068863_100567042
688 Ga0068858_100022886
689 Ga0068858_100050241
690 Ga0068860_100000035
691 Ga0068860_100000775
692 Ga0068860_100498305
693 Ga0068862_100005734
694 Ga0068862_100199094
695 Ga0081455_10011687
696 Ga0081455_10077189
697 Ga0081455_10185414
698 Ga0081538_10004521
699 Ga0081538_10031865
700 Ga0081539_10003298
701 Ga0070717_10234650
702 Ga0075365_10049058
703 Ga0075365_10077920
704 Ga0075365_10265683
705 Ga0075365_10314292
706 Ga0075368_10090096
707 Ga0075363_100002031
708 Ga0075363_100013855
709 Ga0075363_100022561
710 Ga0075363_100023916
711 Ga0075363_100089770
712 Ga0075363_100093897
713 Ga0075364_10000303
714 Ga0075364_10011745
715 Ga0075364_10040679
716 Ga0075364_10084199
717 Ga0070716_100000471
718 Ga0070716_100017054
719 Ga0070712_100115385
720 Ga0070712_100212556
721 Ga0075362_10011769
722 Ga0075362_10060613
723 Ga0075369_10000129
724 Ga0075369_10242427
725 Ga0075369_10256598
726 Ga0075369_10286283
727 Ga0097621_100033270
728 Ga0097621_100704384
729 Ga0075370_10180480
730 Ga0075370_10372709
731 Ga0068865_100004325
732 Ga0068865_100065650
733 Ga0068865_100505892
734 Ga0097620_100005745
735 Ga0105250_10452626
736 Ga0105240_10593424
737 Ga0105245_10032532
738 Ga0105245_10037427
739 Ga0105247_10003162
740 Ga0105247_10120331
741 Ga0105247_10804061
742 Ga0114129_10306156
743 Ga0105243_10001826
744 Ga0105243_10547090
745 Ga0105241_10059209
746 Ga0105241_10076888
747 Ga0105241_11566785
748 Ga0105242_10000459
749 Ga0105242_10023936
750 Ga0105242_10841038
751 Ga0105248_10003999
752 Ga0105248_10275424
753 Ga0105237_10108924
754 Ga0105237_10447552
755 Ga0105238_10091684
756 Ga0105238_10262247
757 Ga0105249_10006558
758 Ga0105249_10083288
759 Ga0105249_10367509
760 Ga0105249_10642350
761 Ga0105249_10866566
762 Ga0105239_10012460
763 Ga0105239_10416493
764 Ga0105239_10571827
765 Ga0105239_10810185
766 Ga0105239_11461457
767 Ga0105246_10002382
768 Ga0105246_10321670
769 Ga0157371_10647766
770 Ga0157369_10019113
771 Ga0157369_10140861
772 Ga0157369_10531931
773 Ga0157369_11669617
774 Ga0157374_10013307
775 Ga0157374_10252377
776 Ga0157378_10003979
777 Ga0157378_10170604
778 Ga0157378_12953374
779 Ga0163162_10006338
780 Ga0163162_10240440
781 Ga0157372_10109161
782 Ga0157372_10239765
783 Ga0157372_10829356
784 Ga0157372_12365335
785 Ga0157375_10009568
786 Ga0157375_10209038
787 Ga0163163_10088004
788 Ga0157380_10001560
789 Ga0157380_10407507
790 Ga0157377_10068682
791 Ga0157377_10086101
792 Ga0157377_10130474
793 Ga0157379_10013893
794 Ga0157379_10017352
795 Ga0157379_10033521
796 Ga0157376_10446008
797 Ga0163161_10003090
798 Ga0163161_10595014
799 Ga0163161_10849656
800 Ga0197907_10828368
801 Ga0213873_10037562
802 Ga0213875_10065288
803 Ga0224712_10075666
804 Ga0209672_100004
805 Ga0209563_100028
806 Ga0209258_100003
807 Ga0209646_1003803
808 Ga0209026_1000281
809 Ga0209148_1000016
810 Ga0209759_1008527
811 Ga0209455_1000004
812 Ga0207642_10004024
813 Ga0207642_10085089
814 Ga0207642_10278779
815 Ga0207710_10004040
816 Ga0207688_10010768
817 Ga0207680_10003070
818 Ga0207680_10010590
819 Ga0207647_10066300
820 Ga0207647_10080074
821 Ga0207647_10248643
822 Ga0207685_10001517
823 Ga0207699_10014305
824 Ga0207645_10038444
825 Ga0207645_10166126
826 Ga0207705_10765082
827 Ga0207654_10139797
828 Ga0207654_10209233
829 Ga0207654_10709275
830 Ga0207671_10410821
831 Ga0207671_10478155
832 Ga0207671_10979625
833 Ga0207693_10000381
834 Ga0207693_10001414
835 Ga0207663_10004663
836 Ga0207663_10324343
837 Ga0207663_10505795
838 Ga0207660_10125433
839 Ga0207662_10089950
840 Ga0207657_10225338
841 Ga0207657_10605984
842 Ga0207652_10361109
843 Ga0207652_10551588
844 Ga0207681_10112725
845 Ga0207681_10156179
846 Ga0207694_10099044
847 Ga0207694_10305147
848 Ga0207687_10000587
849 Ga0207687_10530327
850 Ga0207664_10190289
851 Ga0207664_11069970
852 Ga0207644_10308513
853 Ga0207690_10532665
854 Ga0207690_10707389
855 Ga0207706_10046021
856 Ga0207686_10015983
857 Ga0207709_10028683
858 Ga0207709_10210212
859 Ga0207670_10006540
860 Ga0207669_10001288
861 Ga0207704_10001708
862 Ga0207704_10055306
863 Ga0207704_10341437
864 Ga0207665_10021570
865 Ga0207665_10134296
866 Ga0207711_10029205
867 Ga0207711_10115504
868 Ga0207689_10016281
869 Ga0207689_10017429
870 Ga0207689_10474131
871 Ga0207661_10231513
872 Ga0207661_11814922
873 Ga0207679_10804914
874 Ga0207679_10986905
875 Ga0207667_10363536
876 Ga0207651_10485760
877 Ga0207712_10033254
878 Ga0207712_10264942
879 Ga0207712_10361870
880 Ga0207712_10911101
881 Ga0207712_11002999
882 Ga0207668_10004077
883 Ga0207668_10007345
884 Ga0207668_11367761
885 Ga0207640_10013690
886 Ga0207640_10274045
887 Ga0207640_10508933
888 Ga0207640_10848419
889 Ga0207658_10017204
890 Ga0207677_10310657
891 Ga0207677_10690804
892 Ga0207703_10039188
893 Ga0207703_10056148
894 Ga0207703_10385246
895 Ga0207639_10018307
896 Ga0207639_10133457
897 Ga0207678_10004848
898 Ga0207678_10093791
899 Ga0207708_10018949
900 Ga0207708_10176416
901 Ga0207702_10052727
902 Ga0207702_10377407
903 Ga0207641_10012729
904 Ga0207641_10464498
905 Ga0207648_10000462
906 Ga0207648_10073136
907 Ga0207676_10127111
908 Ga0207676_10526579
909 Ga0207674_10014897
910 Ga0207675_100000768
911 Ga0207675_100266320
912 Ga0207675_100447979
913 Ga0207683_10000575
914 Ga0207683_10150507
915 Ga0207698_10067881
916 Ga0207698_10967468
917 Ga0268266_10003777
918 Ga0268266_10084714
919 Ga0268265_10014518
920 Ga0268265_10692889
921 Ga0268264_10000031
922 Ga0268264_10004232
923 Ga0268264_10420373
924 Ga0268264_12157866
925 Ga0265338_10027056
926 Ga0265327_10010227
927 Ga0307409_100604709
928 Ga0373949_0076523
929 Ga0373949_0173788
930 Ga0373923_0022109
931 Ga0373960_0356500
932 Ga0373935_1288236
933 Ga0436364_0332337
934 Ga0436364_0406475
935 Ga0436364_1019987
936 Ga0436362_0337613
937 Ga0451797_0578190
938 Ga0451807_2424073
939 Ga0451843_0327092
940 Ga0451853_2158879
941 Ga0466969_0065346
942 Ga0466969_0085665
943 Ga0466969_0099441
944 Ga0466972_0012804
945 Ga0466972_0016581
946 Ga0466972_0056586
947 Ga0466965_0000685
948 Ga0466965_0051130
949 Ga0466965_0407571
950 Ga0466965_0519921
951 Ga0466966_0013868
952 Ga0466966_0058391
953 Ga0466966_0067623
954 Ga0466966_0159544
955 Ga0466966_0196883
956 Ga0466961_0005936
957 Ga0466961_0054471
958 Ga0466961_0101936
959 Ga0466961_0142303
960 Ga0466961_0470870
961 Ga0466963_0059216
962 Ga0466963_0107554
963 Ga0466963_0497531
964 Ga0466963_0592075
965 Ga0466964_0052557
966 Ga0466964_0086649
967 Ga0466964_0141666
968 Ga0466964_0202030
969 Ga0466971_0024229
970 Ga0466971_0620940
971 Ga0466968_0000928
972 Ga0466968_0260617
973 Ga0466970_0077642
974 Ga0466970_0089151
975 Ga0466970_0157229
976 Ga0466970_0372336
977 Ga0466970_0524568
978 Ga0466957_0006881
979 Ga0466957_0065269
980 Ga0466957_0297004
981 Ga0466960_0108912
982 Ga0466960_0300440
983 Ga0466960_0338013
984 Ga0466959_0020726
985 Ga0466959_0032197
986 Ga0466959_0199351
987 Ga0466959_0302738
988 Ga0466959_0322550
989 Ga0466959_0459689
990 Ga0466959_0527514
991 Ga0451576_0250245
992 Ga0466958_0003414
993 Ga0466958_0006577
994 Ga0466958_0037102
995 Ga0466958_0095622
996 Ga0466958_0309393
997 Ga0466958_0326190
998 Ga0466958_0459081
999 Ga0466967_0007720
1000 Ga0466967_0028377
1001 Ga0466967_0089596
1002 Ga0466967_0126986
1003 Ga0466967_0262998
1004 Ga0466967_0263007
1005 Ga0466967_0464415
1006 Ga0495638_0000563
1007 Ga0495641_0121577
1008 Ga0495582_0614298
1009 Ga0495639_0111775
1010 Ga0495585_0120502
1011 Ga0495608_0285103
1012 Ga0495666_0095129
1013 Ga0495652_0711185
1014 Ga0495665_0486225
1015 Ga0495640_0044374
1016 Ga0495640_0461776
1017 Ga0495634_0091948
1018 Ga0495611_0424511
1019 Ga0495625_0148674
1020 Ga0495625_0534438
1021 Ga0495635_0457265
1022 Ga0495657_0350130
1023 Ga0495658_0188015
1024 Ga0495613_0527106
1025 Ga0495649_0201929
1026 Ga0495649_0415441
1027 Ga0495674_0514288
1028 Ga0495676_0648472
1029 Ga0495680_0072616
1030 Ga0495593_0030322
1031 Ga0495626_0267001
1032 Ga0496100_0007272
1033 Ga0496100_0480218
1034 Ga0496101_0027794
1035 Ga0496102_0001190
1036 Ga0496102_0101907
1037 Ga0496102_0833475
1038 Ga0496103_0001391
1039 Ga0496103_0092510
1040 Ga0496104_0073058
1041 Ga0496106_0010229
1042 Ga0496106_0186141
1043 Ga0496106_0549226
1044 Ga0496107_0000760
1045 Ga0496107_0160349
1046 Ga0496107_0358006
1047 Ga0496107_0522359
1048 Ga0496107_0558328
1049 Ga0496107_1270335
1050 Ga0496108_0010094
1051 Ga0496108_0011269
1052 Ga0496108_0034514
1053 Ga0496108_0466524
1054 Ga0496108_0738885
1055 Ga0496108_0848471
1056 Ga0496108_1753196
1057 Ga0496109_0002148
1058 Ga0496109_0042367
1059 Ga0496110_0380003
1060 Ga0496111_0040429
1061 Ga0496111_0085836
1062 Ga0496111_0234739
1063 Ga0496113_0165653
1064 Ga0496113_0242246
1065 Ga0496114_0001875
1066 Ga0496115_0004439
1067 Ga0501034_0003091
1068 Ga0501034_0204785
1069 Ga0501037_0439646
1070 Ga0501043_1131343
1071 Ga0501047_0642600
1072 Ga0501047_0857831
1073 Ga0501047_0903648
1074 Ga0501047_1063196
1075 Ga0501067_0026209
1076 Ga0501067_0634284
1077 Ga0501068_0003128
1078 Ga0501068_0083003
1079 Ga0501069_0000052
1080 Ga0501070_0000030
1081 Ga0501070_0069240
1082 Ga0501070_0420279
1083 Ga0501070_0505064
1084 Ga0501070_0595798
1085 Ga0501071_0022503
1086 Ga0501071_0241466
1087 Ga0501071_1092998
1088 Ga0501072_0171672
1089 Ga0501073_0017820
1090 Ga0501073_0262430
1091 Ga0501074_0035839
1092 Ga0501080_0004387
1093 Ga0501080_0019341
1094 Ga0501080_0128721
1095 Ga0501080_0529539
1096 Ga0501083_0005470
1097 Ga0501083_0622060
1098 Ga0501044_0265740
1099 nmdc:mga03683_21876_c1
1100 nmdc:mga03683_69745_c1
1101 nmdc:mga03n38_10885_c1
1102 nmdc:mga03n38_23297_c1
1103 nmdc:mga03n38_3586_c1
1104 nmdc:mga03n38_4344_c1
1105 nmdc:mga03n38_789072_c1
1106 nmdc:mga03n38_8261_c1
1107 nmdc:mga03n38_829130_c1
1108 nmdc:mga00v17_143508_c1
1109 nmdc:mga00v17_206426_c1
1110 nmdc:mga00v17_37521_c1
1111 nmdc:mga00v17_39824_c1
1112 nmdc:mga00v17_5446_c1
1113 nmdc:mga0yw44_142464_c1
1114 nmdc:mga0yw44_15301_c1
1115 nmdc:mga0yw44_215454_c1
1116 nmdc:mga0yw44_464056_c1
1117 nmdc:mga0yw44_758273_c1
1118 nmdc:mga0yw44_98777_c1
1119 nmdc:mga06z11_140360_c1
1120 nmdc:mga06z11_4117_c1
1121 nmdc:mga06z11_86081_c1
1122 nmdc:mga04h51_174928_c1
1123 nmdc:mga07m45_50544_c1
1124 nmdc:mga07m45_80553_c1
1125 nmdc:mga0qj67_419368_c1
1126 nmdc:mga0sz30_2742_c1
1127 nmdc:mga0sz30_73493_c1
1128 nmdc:mga0sz30_93514_c1
1129 Ga0500610_0245956
1130 Ga0495655_0003715
1131 Ga0495619_0221785
1132 Ga0495619_0268887
1133 Ga0500644_0040039
1134 Ga0500556_0253053
1135 Ga0500562_040357
1136 Ga0500628_161399
1137 Ga0500577_0311419
1138 Ga0500604_0111155
1139 Ga0590071_008796
1140 Ga0590074_015218
1141 Ga0590075_002363
1142 Ga0590075_022717
1143 Ga0590077_003731
1144 Ga0590077_051866
1145 Ga0501082_0392410
1146 Ga0466962_0049026
1147 Ga0466962_0537305
1148 Ga0466962_0546680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

133

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

134

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8762 1 135
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8701 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8633 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8574 1 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8466 4 134
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9273 83 134 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.922 83 132 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8697 84 136 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8551 83 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.851 83 134 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6B3EIF2-F1-model_v4 VOC family protein 0.9831 85 136
AF-A0A7I9UZW0-F1-model_v4 Glyoxalase 0.9781 20 135
AF-A0A4V2YPG6-F1-model_v4 VOC family protein 0.9732 2 136
AF-A0A7W9QEY6-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9729 1 136
AF-A0A7Y9EC75-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9718 1 136 GO:0016829
GO:0051213

Map