F465323

General Info

Members Datasets Scaffolds Average Seq Length
574 293 574 240

Family's Representative Sequence

Representative Sequence 3300038996|Ga0242420_014811|Ga0242420_014811_245_1108
Length 287
Sequence MPDDLLAPLPSRLDRRQFLTRAGWTGVGAGALVAGAVEGARPAAERALVAERALVVIPTYNERINLPLIVPQILQQDPRLEVLVVDDNSPDGTGKLADELAGADRRIHVLHRPGKAGLGKAYLAGFRWALDQGYDLIFEMDADFSHDPKFLPDFLRAIEQADLVLGSRYAAGVNVINWPISRLLLSVGANEYARRITGLPIADSTGGFKCFRRKVLEAIDLDRVRSNGYSFQIEMSFRAWKKGFRVLEIPIVFTDRVEGQSKMNKRIVREAIWMVWWLRLQSMTGRL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
178 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
179 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
182 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
268 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
269 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
270 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
271 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
277 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.01
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7531960 2162886012 Bacteria 1189
2 rootL2_10210367 3300003322 Bacteria 4420
3 Ga0065715_10173894 3300005293 Bacteria 1517
4 Ga0065715_10394049 3300005293 Bacteria 890
5 Ga0070676_10001926 3300005328 Bacteria 10538
6 Ga0070690_100069907 3300005330 Bacteria 2279
7 Ga0070670_100494467 3300005331 Unclassified 1087
8 Ga0068869_100101962 3300005334 Bacteria 2172
9 Ga0070666_10166720 3300005335 Bacteria 1541
10 Ga0070680_100010891 3300005336 Bacteria 7025
11 Ga0070680_100244207 3300005336 Bacteria 1518
12 Ga0070680_100426969 3300005336 Bacteria 1131
13 Ga0070682_100116414 3300005337 Bacteria 1788
14 Ga0070660_100084929 3300005339 Bacteria 2489
15 Ga0070660_100118165 3300005339 Bacteria 2114
16 Ga0070689_100599267 3300005340 Bacteria 954
17 Ga0070661_100006568 3300005344 Bacteria 8020
18 Ga0070692_10129165 3300005345 Bacteria 1418
19 Ga0070668_100016539 3300005347 Bacteria 5514
20 Ga0070668_100541495 3300005347 Bacteria 1012
21 Ga0070669_100317337 3300005353 Bacteria 1257
22 Ga0070675_100087569 3300005354 Bacteria 2604
23 Ga0070675_100153607 3300005354 Bacteria 1975
24 Ga0070675_100280529 3300005354 Unclassified 1464
25 Ga0070674_100000378 3300005356 Bacteria 22336
26 Ga0070688_100487905 3300005365 Bacteria 927
27 Ga0070659_100307617 3300005366 Bacteria 1323
28 Ga0070667_100153437 3300005367 Bacteria 2025
29 Ga0070703_10078876 3300005406 Bacteria 1117
30 Ga0070714_100016523 3300005435 Bacteria 5962
31 Ga0070714_100440118 3300005435 Bacteria 1237
32 Ga0070701_10148546 3300005438 Unclassified 1347
33 Ga0070701_10253461 3300005438 Bacteria 1064
34 Ga0070705_100002647 3300005440 Bacteria 8956
35 Ga0070705_100273235 3300005440 Bacteria 1198
36 Ga0070705_100327785 3300005440 Bacteria 1108
37 Ga0070700_100021447 3300005441 Unclassified 3755
38 Ga0070694_100063760 3300005444 Bacteria 2521
39 Ga0070694_100078186 3300005444 Bacteria 2294
40 Ga0070694_100300410 3300005444 Bacteria 1230
41 Ga0070708_100120509 3300005445 Bacteria 2420
42 Ga0070708_100131902 3300005445 Bacteria 2313
43 Ga0070708_100555363 3300005445 Bacteria 1083
44 Ga0070708_100582265 3300005445 Bacteria 1055
45 Ga0070663_100014119 3300005455 Bacteria 5120
46 Ga0070663_100069299 3300005455 Bacteria 2562
47 Ga0070678_100350216 3300005456 Unclassified 1270
48 Ga0070662_100001016 3300005457 Bacteria 17162
49 Ga0070662_100486095 3300005457 Bacteria 1028
50 Ga0070681_10030540 3300005458 Bacteria 5406
51 Ga0070681_10101990 3300005458 Bacteria 2815
52 Ga0070681_10121484 3300005458 Bacteria 2547
53 Ga0070681_10147783 3300005458 Bacteria 2278
54 Ga0070681_10327806 3300005458 Bacteria 1441
55 Ga0070681_10424827 3300005458 Bacteria 1241
56 Ga0070681_10514507 3300005458 Bacteria 1110
57 Ga0068867_100001302 3300005459 Bacteria 17244
58 Ga0068867_100667149 3300005459 Bacteria 914
59 Ga0070706_100356695 3300005467 Bacteria 1363
60 Ga0070706_100598744 3300005467 Bacteria 1024
61 Ga0070707_100001911 3300005468 Bacteria 19959
62 Ga0070707_100010581 3300005468 Bacteria 8589
63 Ga0070707_100018305 3300005468 Bacteria 6592
64 Ga0070707_100084370 3300005468 Bacteria 3070
65 Ga0070707_100240996 3300005468 Bacteria 1760
66 Ga0070707_100457576 3300005468 Bacteria 1237
67 Ga0070707_100502881 3300005468 Bacteria 1174
68 Ga0070698_100012758 3300005471 Bacteria 8900
69 Ga0070698_100032678 3300005471 Bacteria 5388
70 Ga0070698_100444744 3300005471 Bacteria 1231
71 Ga0070699_100000719 3300005518 Bacteria 30756
72 Ga0070699_100009101 3300005518 Bacteria 8611
73 Ga0070699_100021678 3300005518 Bacteria 5540
74 Ga0070699_100297513 3300005518 Bacteria 1448
75 Ga0070699_100322234 3300005518 Bacteria 1389
76 Ga0070699_100395588 3300005518 Bacteria 1249
77 Ga0070679_100013124 3300005530 Bacteria 7934
78 Ga0070679_100084258 3300005530 Bacteria 3167
79 Ga0070679_100115444 3300005530 Bacteria 2670
80 Ga0070679_100172663 3300005530 Unclassified 2134
81 Ga0070679_100447328 3300005530 Bacteria 1237
82 Ga0070684_100535366 3300005535 Bacteria 1086
83 Ga0070697_100189387 3300005536 Bacteria 1746
84 Ga0068853_100003056 3300005539 Bacteria 12778
85 Ga0070686_100000372 3300005544 Bacteria 28575
86 Ga0070695_100004631 3300005545 Bacteria 8082
87 Ga0070695_100101427 3300005545 Bacteria 1939
88 Ga0070695_100116220 3300005545 Bacteria 1823
89 Ga0070696_100000510 3300005546 Bacteria 24577
90 Ga0070696_100017080 3300005546 Bacteria 4897
91 Ga0070696_100108888 3300005546 Bacteria 1993
92 Ga0070696_100331815 3300005546 Bacteria 1173
93 Ga0070696_100578439 3300005546 Bacteria 903
94 Ga0070693_100064464 3300005547 Bacteria 2139
95 Ga0070693_100206139 3300005547 Unclassified 1280
96 Ga0070665_100091648 3300005548 Bacteria 3044
97 Ga0070665_100151284 3300005548 Bacteria 2324
98 Ga0070704_100008201 3300005549 Bacteria 6249
99 Ga0070704_100033367 3300005549 Bacteria 3479
100 Ga0070704_100056684 3300005549 Bacteria 2783
101 Ga0070704_100089528 3300005549 Bacteria 2289
102 Ga0070704_100410782 3300005549 Bacteria 1157
103 Ga0068855_100180020 3300005563 Bacteria 2390
104 Ga0070664_100025286 3300005564 Archaea 4920
105 Ga0070664_100083922 3300005564 Unclassified 2749
106 Ga0068857_100009128 3300005577 Bacteria 8605
107 Ga0068854_100001114 3300005578 Bacteria 16150
108 Ga0068854_100042943 3300005578 Bacteria 3203
109 Ga0068854_100431843 3300005578 Bacteria 1096
110 Ga0068856_100182582 3300005614 Bacteria 2111
111 Ga0070702_100012760 3300005615 Bacteria 4225
112 Ga0068852_100065540 3300005616 Bacteria 3169
113 Ga0068859_100102114 3300005617 Unclassified 2925
114 Ga0068859_100246529 3300005617 Unclassified 1876
115 Ga0068864_100017240 3300005618 Bacteria 6022
116 Ga0068864_100451721 3300005618 Bacteria 1229
117 Ga0068866_10000401 3300005718 Bacteria 20182
118 Ga0068861_100427727 3300005719 Unclassified 1181
119 Ga0068863_100117734 3300005841 Bacteria 2532
120 Ga0068858_100111338 3300005842 Bacteria 2557
121 Ga0068860_100008736 3300005843 Bacteria 10090
122 Ga0068862_100056882 3300005844 Unclassified 3352
123 Ga0068862_100605133 3300005844 Bacteria 1053
124 Ga0081455_10034051 3300005937 Bacteria 4569
125 Ga0097621_100303788 3300006237 Bacteria 1410
126 Ga0068871_100048210 3300006358 Bacteria 3438
127 Ga0075428_100030083 3300006844 Bacteria 6006
128 Ga0075428_100086178 3300006844 Bacteria 3425
129 Ga0075431_100026654 3300006847 Bacteria 5929
130 Ga0075431_100080916 3300006847 Bacteria 3354
131 Ga0075431_100398785 3300006847 Unclassified 1377
132 Ga0075433_10013983 3300006852 Bacteria 6545
133 Ga0075433_10033996 3300006852 Unclassified 4375
134 Ga0075434_100426234 3300006871 Unclassified 1348
135 Ga0075434_100744058 3300006871 Bacteria 997
136 Ga0075429_100001523 3300006880 Bacteria 19059
137 Ga0075429_100012245 3300006880 Bacteria 7438
138 Ga0068865_100003327 3300006881 Bacteria 9628
139 Ga0068865_100549996 3300006881 Bacteria 969
140 Ga0075436_100023748 3300006914 Bacteria 4213
141 Ga0097620_100102109 3300006931 Unclassified 2925
142 Ga0097620_100246525 3300006931 Unclassified 1876
143 Ga0075435_100201213 3300007076 Bacteria 1688
144 Ga0105240_10278983 3300009093 Bacteria 1920
145 Ga0105240_10313889 3300009093 Bacteria 1789
146 Ga0111539_10294262 3300009094 Bacteria 1889
147 Ga0111539_10619571 3300009094 Bacteria 1260
148 Ga0105245_10917646 3300009098 Bacteria 918
149 Ga0114129_10001639 3300009147 Bacteria 30412
150 Ga0114129_10051641 3300009147 Bacteria 5771
151 Ga0114129_10136860 3300009147 Bacteria 3360
152 Ga0114129_10174961 3300009147 Bacteria 2924
153 Ga0114129_10584928 3300009147 Bacteria 1448
154 Ga0105243_10002610 3300009148 Bacteria 15026
155 Ga0105241_10138880 3300009174 Bacteria 1976
156 Ga0105242_10001397 3300009176 Bacteria 19028
157 Ga0105248_10000658 3300009177 Bacteria 39283
158 Ga0105248_10109728 3300009177 Bacteria 3111
159 Ga0105238_10124695 3300009551 Bacteria 2555
160 Ga0105249_10001200 3300009553 Bacteria 22851
161 Ga0105249_10059863 3300009553 Unclassified 3493
162 Ga0105249_10725676 3300009553 Bacteria 1055
163 Ga0105239_10004859 3300010375 Bacteria 15900
164 Ga0105239_10015079 3300010375 Bacteria 8567
165 Ga0105246_10073971 3300011119 Unclassified 2407
166 Ga0157370_10040142 3300013104 Bacteria 4519
167 Ga0157369_10118975 3300013105 Bacteria 2804
168 Ga0157378_10002774 3300013297 Bacteria 15611
169 Ga0163162_10019177 3300013306 Bacteria 6708
170 Ga0163162_10091556 3300013306 Unclassified 3124
171 Ga0157372_10205882 3300013307 Bacteria 2280
172 Ga0163163_10083756 3300014325 Bacteria 3194
173 Ga0163163_10369075 3300014325 Bacteria 1492
174 Ga0157380_10067813 3300014326 Bacteria 2874
175 Ga0157379_10011031 3300014968 Bacteria 7876
176 Ga0157379_10244055 3300014968 Bacteria 1629
177 Ga0157379_10479461 3300014968 Bacteria 1151
178 Ga0157376_10034127 3300014969 Bacteria 4105
179 Ga0163161_10231693 3300017792 Bacteria 1433
180 Ga0207642_10001323 3300025899 Bacteria 7656
181 Ga0207680_10151671 3300025903 Bacteria 1545
182 Ga0207647_10232235 3300025904 Bacteria 1061
183 Ga0207699_10335926 3300025906 Unclassified 1063
184 Ga0207645_10000145 3300025907 Bacteria 55543
185 Ga0207643_10014125 3300025908 Bacteria 4336
186 Ga0207684_10010542 3300025910 Bacteria 8125
187 Ga0207684_10135852 3300025910 Bacteria 2112
188 Ga0207684_10407326 3300025910 Bacteria 1169
189 Ga0207684_10489390 3300025910 Unclassified 1055
190 Ga0207654_10008013 3300025911 Bacteria 5325
191 Ga0207707_10019193 3300025912 Bacteria 5966
192 Ga0207707_10040209 3300025912 Bacteria 4084
193 Ga0207707_10053560 3300025912 Bacteria 3512
194 Ga0207707_10166988 3300025912 Bacteria 1923
195 Ga0207707_10430404 3300025912 Bacteria 1130
196 Ga0207707_10542950 3300025912 Bacteria 988
197 Ga0207660_10108453 3300025917 Bacteria 2085
198 Ga0207660_10279177 3300025917 Bacteria 1325
199 Ga0207660_10328911 3300025917 Bacteria 1222
200 Ga0207657_10048349 3300025919 Bacteria 3714
201 Ga0207649_10086984 3300025920 Bacteria 2038
202 Ga0207649_10214558 3300025920 Bacteria 1367
203 Ga0207652_10014603 3300025921 Bacteria 6367
204 Ga0207652_10082609 3300025921 Bacteria 2811
205 Ga0207652_10445503 3300025921 Bacteria 1167
206 Ga0207652_10637245 3300025921 Bacteria 954
207 Ga0207646_10006308 3300025922 Bacteria 12292
208 Ga0207646_10018162 3300025922 Bacteria 6565
209 Ga0207646_10027616 3300025922 Bacteria 5173
210 Ga0207646_10094828 3300025922 Bacteria 2673
211 Ga0207646_10352811 3300025922 Bacteria 1329
212 Ga0207646_10376581 3300025922 Bacteria 1282
213 Ga0207681_10070013 3300025923 Unclassified 2442
214 Ga0207694_10011630 3300025924 Bacteria 6641
215 Ga0207650_10415766 3300025925 Unclassified 1115
216 Ga0207659_10109836 3300025926 Bacteria 2094
217 Ga0207659_10168134 3300025926 Bacteria 1728
218 Ga0207659_10664409 3300025926 Bacteria 891
219 Ga0207687_10493269 3300025927 Bacteria 1021
220 Ga0207664_10473158 3300025929 Bacteria 1120
221 Ga0207644_10046746 3300025931 Bacteria 3085
222 Ga0207690_10117926 3300025932 Bacteria 1923
223 Ga0207690_10296174 3300025932 Bacteria 1264
224 Ga0207706_10000146 3300025933 Bacteria 76821
225 Ga0207706_10145791 3300025933 Bacteria 2082
226 Ga0207706_10250761 3300025933 Bacteria 1546
227 Ga0207706_10310757 3300025933 Bacteria 1372
228 Ga0207706_10404970 3300025933 Bacteria 1182
229 Ga0207686_10000067 3300025934 Bacteria 94339
230 Ga0207709_10001445 3300025935 Bacteria 16588
231 Ga0207670_10230892 3300025936 Bacteria 1421
232 Ga0207669_10001177 3300025937 Bacteria 11105
233 Ga0207704_10049442 3300025938 Bacteria 2530
234 Ga0207691_10133322 3300025940 Bacteria 2193
235 Ga0207691_10294965 3300025940 Bacteria 1394
236 Ga0207711_10002609 3300025941 Bacteria 16005
237 Ga0207679_10018948 3300025945 Bacteria 4618
238 Ga0207712_10000079 3300025961 Bacteria 115164
239 Ga0207712_10001918 3300025961 Bacteria 13678
240 Ga0207712_10017489 3300025961 Bacteria 4657
241 Ga0207668_10010985 3300025972 Bacteria 5491
242 Ga0207668_10217969 3300025972 Bacteria 1530
243 Ga0207640_10003844 3300025981 Bacteria 8103
244 Ga0207640_10297825 3300025981 Bacteria 1275
245 Ga0207639_10054591 3300026041 Bacteria 3054
246 Ga0207678_10222635 3300026067 Bacteria 1615
247 Ga0207708_10101362 3300026075 Bacteria 2229
248 Ga0207702_10433271 3300026078 Bacteria 1273
249 Ga0207641_10189724 3300026088 Bacteria 1888
250 Ga0207641_10423877 3300026088 Bacteria 1282
251 Ga0207648_10001390 3300026089 Bacteria 26643
252 Ga0207648_10173691 3300026089 Bacteria 1905
253 Ga0207676_10021625 3300026095 Bacteria 4721
254 Ga0207674_10418525 3300026116 Unclassified 1295
255 Ga0207675_100501359 3300026118 Unclassified 1208
256 Ga0207675_100780150 3300026118 Bacteria 968
257 Ga0207683_10005089 3300026121 Bacteria 11283
258 Ga0207698_10082023 3300026142 Bacteria 2605
259 Ga0209969_1009284 3300027360 Bacteria 1400
260 Ga0209998_10036451 3300027717 Bacteria 1105
261 Ga0209974_10039404 3300027876 Bacteria 1572
262 Ga0268266_10108349 3300028379 Bacteria 2458
263 Ga0268266_10507500 3300028379 Bacteria 1152
264 Ga0268265_10123590 3300028380 Unclassified 2137
265 Ga0268264_10028037 3300028381 Bacteria 4605
266 Ga0268264_10125498 3300028381 Unclassified 2268
267 Ga0265338_10001746 3300028800 Bacteria 34367
268 Ga0307408_100004762 3300031548 Bacteria 9148
269 Ga0307408_100048901 3300031548 Bacteria 3035
270 Ga0307408_100087641 3300031548 Bacteria 2343
271 Ga0307408_100159922 3300031548 Bacteria 1788
272 Ga0307408_100166047 3300031548 Unclassified 1758
273 Ga0307408_100284006 3300031548 Bacteria 1379
274 Ga0307408_100304151 3300031548 Bacteria 1337
275 Ga0307405_10063670 3300031731 Unclassified 2340
276 Ga0307405_10101985 3300031731 Bacteria 1926
277 Ga0307405_10250177 3300031731 Unclassified 1318
278 Ga0307413_10003010 3300031824 Bacteria 6996
279 Ga0307413_10003985 3300031824 Bacteria 6340
280 Ga0307413_10052635 3300031824 Bacteria 2460
281 Ga0307413_10058187 3300031824 Archaea 2368
282 Ga0307410_10001996 3300031852 Bacteria 9612
283 Ga0307410_10024856 3300031852 Bacteria 3748
284 Ga0307410_10056168 3300031852 Bacteria 2676
285 Ga0307410_10063680 3300031852 Bacteria 2530
286 Ga0307410_10067745 3300031852 Bacteria 2463
287 Ga0307410_10112921 3300031852 Bacteria 1968
288 Ga0307410_10167042 3300031852 Unclassified 1654
289 Ga0307406_10047823 3300031901 Bacteria 2698
290 Ga0307406_10053445 3300031901 Unclassified 2573
291 Ga0307406_10064837 3300031901 Bacteria 2372
292 Ga0307406_10144876 3300031901 Bacteria 1687
293 Ga0307407_10017198 3300031903 Bacteria 3621
294 Ga0307407_10021217 3300031903 Bacteria 3345
295 Ga0307407_10023656 3300031903 Bacteria 3208
296 Ga0307407_10034610 3300031903 Bacteria 2767
297 Ga0307407_10193364 3300031903 Bacteria 1358
298 Ga0307407_10259623 3300031903 Bacteria 1194
299 Ga0307412_10020347 3300031911 Bacteria 4037
300 Ga0307412_10586077 3300031911 Bacteria 942
301 Ga0307409_100000308 3300031995 Bacteria 19988
302 Ga0307409_100006784 3300031995 Bacteria 6773
303 Ga0307409_100061431 3300031995 Bacteria 2936
304 Ga0307409_100105924 3300031995 Unclassified 2345
305 Ga0307409_100112811 3300031995 Bacteria 2283
306 Ga0307409_100178521 3300031995 Bacteria 1877
307 Ga0307409_100222747 3300031995 Bacteria 1704
308 Ga0307409_100239768 3300031995 Unclassified 1650
309 Ga0307409_100451439 3300031995 Bacteria 1241
310 Ga0307409_100673217 3300031995 Unclassified 1031
311 Ga0307416_100002827 3300032002 Bacteria 10095
312 Ga0307416_100005003 3300032002 Bacteria 8081
313 Ga0307416_100011070 3300032002 Bacteria 5995
314 Ga0307416_100030262 3300032002 Bacteria 4059
315 Ga0307416_100050239 3300032002 Bacteria 3323
316 Ga0307416_100075129 3300032002 Bacteria 2827
317 Ga0307416_100159447 3300032002 Bacteria 2083
318 Ga0307416_100201144 3300032002 Bacteria 1890
319 Ga0307416_100278133 3300032002 Bacteria 1648
320 Ga0307416_100297187 3300032002 Bacteria 1603
321 Ga0307416_100586677 3300032002 Bacteria 1193
322 Ga0307416_100899816 3300032002 Bacteria 985
323 Ga0307416_100960228 3300032002 Bacteria 957
324 Ga0307414_10022522 3300032004 Bacteria 3976
325 Ga0307414_10081152 3300032004 Bacteria 2374
326 Ga0307414_10088499 3300032004 Bacteria 2292
327 Ga0307414_10098608 3300032004 Bacteria 2193
328 Ga0307414_10243491 3300032004 Bacteria 1490
329 Ga0307411_10002519 3300032005 Bacteria 8151
330 Ga0307411_10033227 3300032005 Bacteria 3198
331 Ga0307411_10045926 3300032005 Bacteria 2812
332 Ga0307411_10091076 3300032005 Bacteria 2129
333 Ga0307411_10219910 3300032005 Bacteria 1473
334 Ga0307415_100000203 3300032126 Bacteria 26255
335 Ga0307415_100001513 3300032126 Bacteria 11158
336 Ga0307415_100292266 3300032126 Bacteria 1346
337 Ga0307415_100365496 3300032126 Bacteria 1220
338 Ga0373929_0021808 3300035085 Bacteria 1303
339 Ga0373934_0000216 3300035086 Bacteria 21032
340 Ga0373940_0016091 3300035088 Bacteria 1849
341 Ga0373940_0032565 3300035088 Bacteria 1398
342 Ga0373949_0021123 3300035090 Bacteria 1495
343 Ga0373923_0008948 3300035111 Bacteria 3593
344 Ga0373945_0029975 3300035116 Bacteria 1915
345 Ga0373956_0000127 3300035119 Bacteria 26808
346 Ga0373957_0014563 3300035120 Bacteria 2691
347 Ga0373955_0004911 3300035172 Bacteria 5966
348 Ga0316574_0015633 3300035398 Bacteria 4406
349 Ga0373924_0121700 3300035410 Bacteria 1132
350 Ga0373931_0085384 3300035691 Bacteria 1750
351 Ga0373935_0071348 3300035692 Bacteria 2241
352 Ga0373933_0000353 3300035724 Bacteria 29440
353 Ga0373937_0000195 3300036401 Bacteria 59262
354 Ga0373937_0152366 3300036401 Bacteria 2166
355 Ga0395901_0113783 3300038443 Bacteria 2842
356 Ga0242420_000375 3300038996 Bacteria 4931
357 Ga0242420_014811 3300038996 Bacteria 1342
358 Ga0242420_015847 3300038996 Bacteria 1307
359 Ga0242420_052098 3300038996 Bacteria 802
360 Ga0439439_0013110 3300041406 Bacteria 2008
361 Ga0439453_0054999 3300041408 Bacteria 812
362 Ga0451807_0948721 3300041486 Bacteria 1142
363 Ga0451849_1163722 3300041505 Bacteria 1764
364 Ga0439443_032612 3300042003 Bacteria 864
365 Ga0439448_0057315 3300042005 Unclassified 1284
366 Ga0450908_031118 3300042184 Bacteria 927
367 Ga0451577_0525891 3300042876 Bacteria 1074
368 Ga0466972_0008333 3300044658 Bacteria 5196
369 Ga0453683_0102758 3300044673 Bacteria 1795
370 Ga0453683_0269610 3300044673 Bacteria 1086
371 Ga0466965_0000955 3300044683 Bacteria 11152
372 Ga0466964_0093155 3300044706 Bacteria 1315
373 Ga0453684_0855203 3300044712 Bacteria 977
374 Ga0466968_0002692 3300044735 Bacteria 6549
375 Ga0451576_0034935 3300045051 Bacteria 5335
376 Ga0451576_0133286 3300045051 Bacteria 2590
377 Ga0451576_0611109 3300045051 Bacteria 1146
378 Ga0451576_1098540 3300045051 Bacteria 832
379 Ga0495592_0003659 3300046454 Bacteria 11071
380 Ga0495603_0058591 3300046455 Bacteria 2277
381 Ga0495603_0108964 3300046455 Bacteria 1616
382 Ga0495641_0107243 3300046461 Bacteria 1246
383 Ga0495651_0000050 3300046462 Bacteria 87816
384 Ga0495653_0000134 3300046463 Bacteria 61770
385 Ga0495582_0021166 3300046473 Bacteria 3561
386 Ga0495639_0011198 3300046475 Bacteria 3864
387 Ga0495594_0026408 3300046499 Bacteria 3124
388 Ga0495608_0000381 3300046511 Bacteria 30883
389 Ga0495618_0060276 3300046514 Bacteria 2406
390 Ga0495628_0001309 3300046516 Bacteria 22847
391 Ga0495628_0233857 3300046516 Bacteria 1377
392 Ga0495630_0004360 3300046517 Bacteria 9937
393 Ga0495630_0023250 3300046517 Bacteria 4581
394 Ga0495643_0000104 3300046522 Bacteria 140570
395 Ga0495666_0002485 3300046526 Bacteria 9162
396 Ga0495652_0003898 3300046529 Bacteria 14519
397 Ga0495640_0058174 3300046533 Bacteria 2637
398 Ga0495586_0007463 3300046535 Bacteria 5834
399 Ga0495587_0000114 3300046536 Bacteria 61671
400 Ga0495645_0000065 3300046543 Bacteria 73256
401 Ga0495645_0063735 3300046543 Bacteria 2668
402 Ga0495622_0092018 3300046557 Bacteria 1393
403 Ga0495667_0000316 3300046559 Bacteria 30681
404 Ga0495667_0156542 3300046559 Bacteria 1466
405 Ga0495634_0010164 3300046642 Bacteria 6906
406 Ga0495635_0000103 3300046663 Bacteria 50496
407 Ga0495657_0001662 3300046675 Bacteria 19126
408 Ga0495657_0235271 3300046675 Bacteria 1107
409 Ga0495599_0005532 3300046678 Bacteria 7571
410 Ga0495623_0000086 3300046679 Bacteria 55086
411 Ga0495646_0091304 3300046680 Bacteria 1758
412 Ga0495647_0031139 3300046681 Bacteria 1983
413 Ga0495658_0009713 3300046683 Bacteria 4798
414 Ga0495669_0039435 3300046684 Bacteria 2092
415 Ga0495613_0067652 3300046689 Bacteria 2607
416 Ga0495600_0003319 3300046809 Bacteria 9447
417 Ga0495604_0001195 3300047317 Bacteria 21435
418 Ga0495636_0021340 3300047318 Unclassified 2615
419 Ga0495674_0000339 3300047319 Bacteria 41326
420 Ga0495674_0023282 3300047319 Bacteria 5711
421 Ga0495674_0149410 3300047319 Bacteria 1960
422 Ga0495680_0016313 3300047322 Bacteria 6387
423 Ga0495680_0021286 3300047322 Bacteria 5431
424 Ga0495684_0000141 3300047471 Bacteria 53032
425 Ga0495602_0003470 3300048088 Bacteria 16312
426 Ga0496100_0482066 3300048903 Bacteria 954
427 Ga0496101_0009147 3300048904 Bacteria 6503
428 Ga0496102_0015699 3300048905 Bacteria 6598
429 Ga0496102_0229646 3300048905 Bacteria 1750
430 Ga0496102_0269122 3300048905 Bacteria 1606
431 Ga0496102_0506620 3300048905 Bacteria 1129
432 Ga0496103_0016315 3300048906 Bacteria 4432
433 Ga0496103_0135937 3300048906 Bacteria 1571
434 Ga0496103_0258246 3300048906 Bacteria 1121
435 Ga0496104_0010276 3300048907 Bacteria 8359
436 Ga0496104_0041712 3300048907 Bacteria 4304
437 Ga0496105_0069739 3300048908 Bacteria 2905
438 Ga0496105_0132732 3300048908 Bacteria 2052
439 Ga0496106_0022907 3300048909 Bacteria 4639
440 Ga0496106_0042473 3300048909 Unclassified 3410
441 Ga0496106_0125496 3300048909 Bacteria 2009
442 Ga0496106_0250541 3300048909 Bacteria 1416
443 Ga0496107_0073904 3300048910 Bacteria 2480
444 Ga0496107_0204239 3300048910 Bacteria 1469
445 Ga0496108_0001782 3300048911 Bacteria 17164
446 Ga0496108_0002171 3300048911 Bacteria 15736
447 Ga0496108_0003640 3300048911 Bacteria 12354
448 Ga0496108_0065357 3300048911 Bacteria 3066
449 Ga0496108_0313513 3300048911 Bacteria 1367
450 Ga0496109_0001037 3300048912 Bacteria 22996
451 Ga0496109_0007936 3300048912 Bacteria 8995
452 Ga0496109_0099260 3300048912 Bacteria 2700
453 Ga0496109_0106569 3300048912 Bacteria 2603
454 Ga0496109_0204457 3300048912 Bacteria 1857
455 Ga0496110_0016427 3300048913 Bacteria 6180
456 Ga0496110_0025168 3300048913 Bacteria 5083
457 Ga0496110_0089740 3300048913 Bacteria 2748
458 Ga0496111_0015616 3300048914 Bacteria 5217
459 Ga0496111_0020367 3300048914 Bacteria 4617
460 Ga0496111_0035368 3300048914 Bacteria 3569
461 Ga0496112_0000129 3300048915 Bacteria 47173
462 Ga0496112_0026745 3300048915 Bacteria 5558
463 Ga0496112_0047190 3300048915 Bacteria 4225
464 Ga0496112_0148982 3300048915 Bacteria 2307
465 Ga0496112_0720710 3300048915 Bacteria 925
466 Ga0496113_0000062 3300048916 Bacteria 46801
467 Ga0496113_0082719 3300048916 Bacteria 2462
468 Ga0496114_0191002 3300048917 Bacteria 1792
469 Ga0496114_0288412 3300048917 Bacteria 1448
470 Ga0496115_0186306 3300048918 Bacteria 1715
471 Ga0501298_019236 3300049521 Bacteria 1264
472 Ga0501034_0008504 3300049571 Bacteria 10838
473 Ga0501034_0063733 3300049571 Bacteria 3700
474 Ga0501039_0098097 3300049575 Bacteria 2286
475 Ga0501040_0118525 3300049576 Bacteria 1856
476 Ga0501041_0367092 3300049577 Bacteria 910
477 Ga0501042_0069774 3300049578 Bacteria 2514
478 Ga0501042_0130499 3300049578 Bacteria 1811
479 Ga0501042_0249194 3300049578 Bacteria 1281
480 Ga0501046_0139275 3300049580 Bacteria 1837
481 Ga0501047_0002324 3300049581 Bacteria 18172
482 Ga0501047_0698113 3300049581 Bacteria 832
483 Ga0501047_0724022 3300049581 Bacteria 812
484 Ga0501048_0071460 3300049582 Bacteria 2450
485 Ga0501067_0002448 3300049583 Bacteria 10258
486 Ga0501067_0013916 3300049583 Bacteria 4455
487 Ga0501067_0036646 3300049583 Bacteria 2723
488 Ga0501067_0042648 3300049583 Bacteria 2519
489 Ga0501068_0000311 3300049584 Bacteria 24353
490 Ga0501068_0006064 3300049584 Bacteria 6642
491 Ga0501068_0153822 3300049584 Bacteria 1447
492 Ga0501069_0001105 3300049585 Bacteria 13017
493 Ga0501069_0001912 3300049585 Bacteria 10402
494 Ga0501070_0004182 3300049586 Bacteria 12426
495 Ga0501070_0018009 3300049586 Bacteria 5926
496 Ga0501070_0060202 3300049586 Bacteria 3148
497 Ga0501070_0424747 3300049586 Bacteria 1073
498 Ga0501071_0002649 3300049587 Bacteria 10959
499 Ga0501071_0008604 3300049587 Bacteria 6745
500 Ga0501071_0038976 3300049587 Bacteria 3398
501 Ga0501072_0017501 3300049588 Bacteria 5508
502 Ga0501072_0033860 3300049588 Bacteria 4003
503 Ga0501072_0039701 3300049588 Bacteria 3695
504 Ga0501072_0058662 3300049588 Bacteria 3034
505 Ga0501072_0115737 3300049588 Bacteria 2135
506 Ga0501073_0015044 3300049589 Bacteria 5612
507 Ga0501074_0113482 3300049590 Bacteria 1939
508 Ga0501074_0136211 3300049590 Bacteria 1756
509 Ga0501075_0073623 3300049591 Bacteria 2583
510 Ga0501075_0175770 3300049591 Bacteria 1634
511 Ga0501076_0011216 3300049592 Bacteria 6671
512 Ga0501076_0178823 3300049592 Bacteria 1729
513 Ga0501076_0190694 3300049592 Bacteria 1672
514 Ga0501076_0498352 3300049592 Bacteria 1004
515 Ga0501076_0581978 3300049592 Bacteria 923
516 Ga0501077_0033274 3300049593 Bacteria 3281
517 Ga0501209_002545 3300049656 Bacteria 2833
518 Ga0501243_012653 3300049675 Bacteria 1334
519 Ga0501247_014704 3300049677 Bacteria 972
520 Ga0501249_012149 3300049679 Bacteria 1817
521 Ga0501257_006396 3300049686 Bacteria 2614
522 Ga0501257_013681 3300049686 Bacteria 1861
523 Ga0501079_0009697 3300049741 Bacteria 7300
524 Ga0501079_0054981 3300049741 Bacteria 3071
525 Ga0501079_0065143 3300049741 Bacteria 2811
526 Ga0501079_0103136 3300049741 Bacteria 2212
527 Ga0501079_0127696 3300049741 Bacteria 1978
528 Ga0501080_0002229 3300049742 Bacteria 16855
529 Ga0501080_0002645 3300049742 Bacteria 15668
530 Ga0501080_0010834 3300049742 Bacteria 8342
531 Ga0501080_0205454 3300049742 Bacteria 1807
532 Ga0501080_0500691 3300049742 Bacteria 1086
533 Ga0501081_0220150 3300049743 Bacteria 1380
534 Ga0501083_0001221 3300049744 Bacteria 17390
535 Ga0501083_0002285 3300049744 Bacteria 13120
536 Ga0501262_004576 3300049759 Bacteria 1608
537 Ga0501273_002720 3300049770 Bacteria 1821
538 Ga0501045_0017170 3300049824 Bacteria 5138
539 Ga0501045_0078665 3300049824 Bacteria 2431
540 Ga0501045_0089452 3300049824 Bacteria 2274
541 Ga0501045_0126992 3300049824 Bacteria 1895
542 Ga0501212_017063 3300049851 Bacteria 1096
543 nmdc:mga05p37_17760_c2 3300050507 Bacteria 3596
544 nmdc:mga05p37_273526_c1 3300050507 Bacteria 2017
545 nmdc:mga05p37_70267_c1 3300050507 Unclassified 4307
546 nmdc:mga09592_102541_c1 3300050508 Bacteria 2451
547 nmdc:mga09592_1219_c1 3300050508 Bacteria 20601
548 nmdc:mga0qj67_129765_c1 3300050509 Bacteria 2041
549 nmdc:mga06r32_193097_c1 3300050510 Bacteria 2023
550 nmdc:mga06r32_63445_c1 3300050510 Bacteria 3561
551 nmdc:mga0n895_467454_c1 3300050512 Bacteria 1272
552 nmdc:mga0n895_470891_c1 3300050512 Unclassified 1267
553 nmdc:mga08x19_28405_c1 3300050514 Bacteria 3503
554 Ga0495601_0009524 3300053077 Bacteria 5750
555 Ga0495612_0005188 3300053078 Bacteria 5384
556 Ga0495595_0010877 3300053084 Bacteria 3795
557 Ga0501084_0001049 3300054114 Bacteria 21463
558 Ga0501084_0022098 3300054114 Bacteria 5306
559 Ga0501084_0032371 3300054114 Bacteria 4374
560 Ga0501084_0056519 3300054114 Bacteria 3283
561 Ga0501084_0084552 3300054114 Bacteria 2663
562 Ga0501084_0323761 3300054114 Bacteria 1302
563 Ga0501084_0858725 3300054114 Bacteria 764
564 Ga0590071_000553 3300059421 Bacteria 10824
565 Ga0590071_013855 3300059421 Bacteria 1890
566 Ga0590071_016339 3300059421 Bacteria 1741
567 Ga0590074_018326 3300059423 Unclassified 1197
568 Ga0590074_030196 3300059423 Bacteria 955
569 Ga0590075_019466 3300059424 Bacteria 1685
570 Ga0590075_052075 3300059424 Bacteria 1050
571 Ga0501082_0019260 3300060353 Bacteria 5882
572 Ga0501082_0108395 3300060353 Bacteria 2403
573 Ga0501082_0132652 3300060353 Bacteria 2161
574 Ga0501082_0147609 3300060353 Bacteria 2042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025932 Ga0207690_10296174 Ga0207690_102961741 225
2 3300049686 Ga0501257_006396 Ga0501257_006396_1096_1836 230
3 3300035398 Ga0316574_0015633 Ga0316574_0015633_501_1232 231
4 3300005458 Ga0070681_10147783 Ga0070681_101477832 232
5 3300005530 Ga0070679_100115444 Ga0070679_1001154443 232
6 3300005564 Ga0070664_100083922 Ga0070664_1000839222 232
7 3300025912 Ga0207707_10053560 Ga0207707_100535602 232
8 3300025917 Ga0207660_10108453 Ga0207660_101084531 232
9 3300025920 Ga0207649_10086984 Ga0207649_100869843 232
10 3300025921 Ga0207652_10082609 Ga0207652_100826092 232
11 3300031548 Ga0307408_100087641 Ga0307408_1000876411 232
12 3300049581 Ga0501047_0002324 Ga0501047_0002324_16809_17510 232
13 3300031548 Ga0307408_100304151 Ga0307408_1003041512 233
14 3300031731 Ga0307405_10063670 Ga0307405_100636703 233
15 3300031824 Ga0307413_10003010 Ga0307413_100030102 233
16 3300031852 Ga0307410_10001996 Ga0307410_100019962 233
17 3300031995 Ga0307409_100451439 Ga0307409_1004514392 233
18 3300032002 Ga0307416_100075129 Ga0307416_1000751294 233
19 3300032002 Ga0307416_100297187 Ga0307416_1002971872 233
20 3300044658 Ga0466972_0008333 Ga0466972_0008333_2746_3498 233
21 3300044683 Ga0466965_0000955 Ga0466965_0000955_3788_4492 233
22 3300044706 Ga0466964_0093155 Ga0466964_0093155_392_1147 233
23 3300044735 Ga0466968_0002692 Ga0466968_0002692_2046_2750 233
24 3300005458 Ga0070681_10121484 Ga0070681_101214842 234
25 3300045051 Ga0451576_0034935 Ga0451576_0034935_1675_2379 234
26 3300047318 Ga0495636_0021340 Ga0495636_0021340_337_1041 234
27 3300005617 Ga0068859_100246529 Ga0068859_1002465292 235
28 3300006844 Ga0075428_100030083 Ga0075428_1000300836 235
29 3300006880 Ga0075429_100012245 Ga0075429_1000122454 235
30 3300006881 Ga0068865_100549996 Ga0068865_1005499962 235
31 3300006931 Ga0097620_100246525 Ga0097620_1002465252 235
32 3300009147 Ga0114129_10001639 Ga0114129_1000163913 235
33 3300025936 Ga0207670_10230892 Ga0207670_102308922 235
34 3300026078 Ga0207702_10433271 Ga0207702_104332712 235
35 3300035116 Ga0373945_0029975 Ga0373945_0029975_187_897 235
36 3300035691 Ga0373931_0085384 Ga0373931_0085384_228_935 235
37 3300042005 Ga0439448_0057315 Ga0439448_0057315_539_1246 235
38 3300045051 Ga0451576_1098540 Ga0451576_1098540_41_754 235
39 3300048904 Ga0496101_0009147 Ga0496101_0009147_5399_6106 235
40 3300048905 Ga0496102_0015699 Ga0496102_0015699_2606_3313 235
41 3300048906 Ga0496103_0016315 Ga0496103_0016315_1339_2046 235
42 3300048907 Ga0496104_0041712 Ga0496104_0041712_2490_3197 235
43 3300048908 Ga0496105_0132732 Ga0496105_0132732_1162_1869 235
44 3300048910 Ga0496107_0073904 Ga0496107_0073904_1413_2120 235
45 3300048911 Ga0496108_0065357 Ga0496108_0065357_1129_1836 235
46 3300048912 Ga0496109_0106569 Ga0496109_0106569_59_766 235
47 3300048913 Ga0496110_0025168 Ga0496110_0025168_632_1339 235
48 3300048914 Ga0496111_0035368 Ga0496111_0035368_1606_2313 235
49 3300048915 Ga0496112_0026745 Ga0496112_0026745_2044_2751 235
50 3300048916 Ga0496113_0082719 Ga0496113_0082719_477_1184 235
51 3300048917 Ga0496114_0288412 Ga0496114_0288412_615_1322 235
52 3300048918 Ga0496115_0186306 Ga0496115_0186306_820_1527 235
53 3300049584 Ga0501068_0153822 Ga0501068_0153822_430_1137 235
54 3300050507 nmdc:mga05p37_70267_c1 nmdc:mga05p37_70267_c1_3236_3943 235
55 3300050508 nmdc:mga09592_102541_c1 nmdc:mga09592_102541_c1_1076_1783 235
56 3300050514 nmdc:mga08x19_28405_c1 nmdc:mga08x19_28405_c1_1433_2140 235
57 3300005467 Ga0070706_100598744 Ga0070706_1005987441 237
58 3300005471 Ga0070698_100444744 Ga0070698_1004447441 237
59 3300014968 Ga0157379_10244055 Ga0157379_102440552 237
60 3300025910 Ga0207684_10010542 Ga0207684_100105424 237
61 3300025910 Ga0207684_10489390 Ga0207684_104893901 237
62 3300005347 Ga0070668_100541495 Ga0070668_1005414951 238
63 3300005354 Ga0070675_100087569 Ga0070675_1000875692 238
64 3300005468 Ga0070707_100502881 Ga0070707_1005028811 238
65 3300005471 Ga0070698_100012758 Ga0070698_1000127587 238
66 3300005544 Ga0070686_100000372 Ga0070686_1000003728 238
67 3300009094 Ga0111539_10294262 Ga0111539_102942622 238
68 3300009147 Ga0114129_10136860 Ga0114129_101368602 238
69 3300025910 Ga0207684_10135852 Ga0207684_101358522 238
70 3300025921 Ga0207652_10637245 Ga0207652_106372452 238
71 3300025926 Ga0207659_10109836 Ga0207659_101098362 238
72 3300025933 Ga0207706_10310757 Ga0207706_103107572 238
73 3300032002 Ga0307416_100586677 Ga0307416_1005866772 238
74 3300046522 Ga0495643_0000104 Ga0495643_0000104_77210_77971 238
75 3300046684 Ga0495669_0039435 Ga0495669_0039435_614_1333 238
76 3300049581 Ga0501047_0724022 Ga0501047_0724022_39_770 238
77 3300050512 nmdc:mga0n895_467454_c1 nmdc:mga0n895_467454_c1_215_931 238
78 2162886012 MBSR1b_contig_7531960 MBSR1b_0457.00003120 239
79 3300003322 rootL2_10210367 rootL2_102103672 239
80 3300005293 Ga0065715_10173894 Ga0065715_101738942 239
81 3300005293 Ga0065715_10394049 Ga0065715_103940491 239
82 3300005328 Ga0070676_10001926 Ga0070676_100019264 239
83 3300005330 Ga0070690_100069907 Ga0070690_1000699072 239
84 3300005331 Ga0070670_100494467 Ga0070670_1004944671 239
85 3300005334 Ga0068869_100101962 Ga0068869_1001019622 239
86 3300005335 Ga0070666_10166720 Ga0070666_101667202 239
87 3300005336 Ga0070680_100010891 Ga0070680_1000108914 239
88 3300005336 Ga0070680_100244207 Ga0070680_1002442071 239
89 3300005336 Ga0070680_100426969 Ga0070680_1004269691 239
90 3300005337 Ga0070682_100116414 Ga0070682_1001164142 239
91 3300005339 Ga0070660_100084929 Ga0070660_1000849292 239
92 3300005339 Ga0070660_100118165 Ga0070660_1001181652 239
93 3300005340 Ga0070689_100599267 Ga0070689_1005992671 239
94 3300005344 Ga0070661_100006568 Ga0070661_1000065682 239
95 3300005345 Ga0070692_10129165 Ga0070692_101291652 239
96 3300005347 Ga0070668_100016539 Ga0070668_1000165394 239
97 3300005353 Ga0070669_100317337 Ga0070669_1003173372 239
98 3300005354 Ga0070675_100153607 Ga0070675_1001536072 239
99 3300005354 Ga0070675_100280529 Ga0070675_1002805292 239
100 3300005356 Ga0070674_100000378 Ga0070674_10000037819 239
101 3300005365 Ga0070688_100487905 Ga0070688_1004879051 239
102 3300005366 Ga0070659_100307617 Ga0070659_1003076172 239
103 3300005367 Ga0070667_100153437 Ga0070667_1001534372 239
104 3300005406 Ga0070703_10078876 Ga0070703_100788762 239
105 3300005435 Ga0070714_100016523 Ga0070714_1000165232 239
106 3300005435 Ga0070714_100440118 Ga0070714_1004401182 239
107 3300005438 Ga0070701_10148546 Ga0070701_101485462 239
108 3300005438 Ga0070701_10253461 Ga0070701_102534612 239
109 3300005440 Ga0070705_100002647 Ga0070705_10000264711 239
110 3300005440 Ga0070705_100273235 Ga0070705_1002732352 239
111 3300005440 Ga0070705_100327785 Ga0070705_1003277852 239
112 3300005441 Ga0070700_100021447 Ga0070700_1000214472 239
113 3300005444 Ga0070694_100063760 Ga0070694_1000637602 239
114 3300005444 Ga0070694_100078186 Ga0070694_1000781862 239
115 3300005444 Ga0070694_100300410 Ga0070694_1003004102 239
116 3300005445 Ga0070708_100120509 Ga0070708_1001205092 239
117 3300005445 Ga0070708_100131902 Ga0070708_1001319022 239
118 3300005445 Ga0070708_100555363 Ga0070708_1005553632 239
119 3300005445 Ga0070708_100582265 Ga0070708_1005822651 239
120 3300005455 Ga0070663_100014119 Ga0070663_1000141192 239
121 3300005455 Ga0070663_100069299 Ga0070663_1000692992 239
122 3300005456 Ga0070678_100350216 Ga0070678_1003502161 239
123 3300005457 Ga0070662_100001016 Ga0070662_1000010162 239
124 3300005457 Ga0070662_100486095 Ga0070662_1004860952 239
125 3300005458 Ga0070681_10030540 Ga0070681_100305403 239
126 3300005458 Ga0070681_10101990 Ga0070681_101019902 239
127 3300005458 Ga0070681_10327806 Ga0070681_103278062 239
128 3300005458 Ga0070681_10424827 Ga0070681_104248271 239
129 3300005458 Ga0070681_10514507 Ga0070681_105145072 239
130 3300005459 Ga0068867_100001302 Ga0068867_1000013022 239
131 3300005459 Ga0068867_100667149 Ga0068867_1006671491 239
132 3300005467 Ga0070706_100356695 Ga0070706_1003566952 239
133 3300005468 Ga0070707_100001911 Ga0070707_1000019112 239
134 3300005468 Ga0070707_100010581 Ga0070707_10001058112 239
135 3300005468 Ga0070707_100018305 Ga0070707_1000183051 239
136 3300005468 Ga0070707_100084370 Ga0070707_1000843703 239
137 3300005468 Ga0070707_100240996 Ga0070707_1002409962 239
138 3300005468 Ga0070707_100457576 Ga0070707_1004575762 239
139 3300005471 Ga0070698_100032678 Ga0070698_1000326782 239
140 3300005518 Ga0070699_100000719 Ga0070699_1000007196 239
141 3300005518 Ga0070699_100009101 Ga0070699_1000091013 239
142 3300005518 Ga0070699_100021678 Ga0070699_1000216783 239
143 3300005518 Ga0070699_100297513 Ga0070699_1002975132 239
144 3300005518 Ga0070699_100322234 Ga0070699_1003222342 239
145 3300005518 Ga0070699_100395588 Ga0070699_1003955882 239
146 3300005530 Ga0070679_100013124 Ga0070679_1000131242 239
147 3300005530 Ga0070679_100084258 Ga0070679_1000842582 239
148 3300005530 Ga0070679_100172663 Ga0070679_1001726633 239
149 3300005530 Ga0070679_100447328 Ga0070679_1004473282 239
150 3300005535 Ga0070684_100535366 Ga0070684_1005353662 239
151 3300005536 Ga0070697_100189387 Ga0070697_1001893872 239
152 3300005539 Ga0068853_100003056 Ga0068853_1000030562 239
153 3300005545 Ga0070695_100004631 Ga0070695_1000046318 239
154 3300005545 Ga0070695_100101427 Ga0070695_1001014272 239
155 3300005545 Ga0070695_100116220 Ga0070695_1001162202 239
156 3300005546 Ga0070696_100000510 Ga0070696_10000051021 239
157 3300005546 Ga0070696_100017080 Ga0070696_1000170803 239
158 3300005546 Ga0070696_100108888 Ga0070696_1001088882 239
159 3300005546 Ga0070696_100331815 Ga0070696_1003318151 239
160 3300005546 Ga0070696_100578439 Ga0070696_1005784392 239
161 3300005547 Ga0070693_100064464 Ga0070693_1000644642 239
162 3300005547 Ga0070693_100206139 Ga0070693_1002061392 239
163 3300005548 Ga0070665_100091648 Ga0070665_1000916482 239
164 3300005548 Ga0070665_100151284 Ga0070665_1001512842 239
165 3300005549 Ga0070704_100008201 Ga0070704_1000082012 239
166 3300005549 Ga0070704_100033367 Ga0070704_1000333673 239
167 3300005549 Ga0070704_100056684 Ga0070704_1000566842 239
168 3300005549 Ga0070704_100089528 Ga0070704_1000895282 239
169 3300005549 Ga0070704_100410782 Ga0070704_1004107822 239
170 3300005563 Ga0068855_100180020 Ga0068855_1001800202 239
171 3300005564 Ga0070664_100025286 Ga0070664_1000252863 239
172 3300005577 Ga0068857_100009128 Ga0068857_1000091282 239
173 3300005578 Ga0068854_100001114 Ga0068854_10000111415 239
174 3300005578 Ga0068854_100042943 Ga0068854_1000429432 239
175 3300005578 Ga0068854_100431843 Ga0068854_1004318432 239
176 3300005614 Ga0068856_100182582 Ga0068856_1001825822 239
177 3300005615 Ga0070702_100012760 Ga0070702_1000127607 239
178 3300005616 Ga0068852_100065540 Ga0068852_1000655403 239
179 3300005617 Ga0068859_100102114 Ga0068859_1001021142 239
180 3300005618 Ga0068864_100017240 Ga0068864_1000172407 239
181 3300005618 Ga0068864_100451721 Ga0068864_1004517212 239
182 3300005718 Ga0068866_10000401 Ga0068866_1000040112 239
183 3300005719 Ga0068861_100427727 Ga0068861_1004277272 239
184 3300005841 Ga0068863_100117734 Ga0068863_1001177342 239
185 3300005842 Ga0068858_100111338 Ga0068858_1001113382 239
186 3300005843 Ga0068860_100008736 Ga0068860_1000087367 239
187 3300005844 Ga0068862_100056882 Ga0068862_1000568823 239
188 3300005844 Ga0068862_100605133 Ga0068862_1006051332 239
189 3300005937 Ga0081455_10034051 Ga0081455_100340513 239
190 3300006237 Ga0097621_100303788 Ga0097621_1003037882 239
191 3300006358 Ga0068871_100048210 Ga0068871_1000482105 239
192 3300006844 Ga0075428_100086178 Ga0075428_1000861782 239
193 3300006847 Ga0075431_100026654 Ga0075431_1000266542 239
194 3300006847 Ga0075431_100080916 Ga0075431_1000809162 239
195 3300006847 Ga0075431_100398785 Ga0075431_1003987852 239
196 3300006852 Ga0075433_10013983 Ga0075433_100139832 239
197 3300006852 Ga0075433_10033996 Ga0075433_100339963 239
198 3300006871 Ga0075434_100426234 Ga0075434_1004262342 239
199 3300006871 Ga0075434_100744058 Ga0075434_1007440582 239
200 3300006880 Ga0075429_100001523 Ga0075429_10000152315 239
201 3300006881 Ga0068865_100003327 Ga0068865_1000033278 239
202 3300006914 Ga0075436_100023748 Ga0075436_1000237484 239
203 3300006931 Ga0097620_100102109 Ga0097620_1001021092 239
204 3300007076 Ga0075435_100201213 Ga0075435_1002012132 239
205 3300009093 Ga0105240_10278983 Ga0105240_102789832 239
206 3300009093 Ga0105240_10313889 Ga0105240_103138892 239
207 3300009094 Ga0111539_10619571 Ga0111539_106195712 239
208 3300009098 Ga0105245_10917646 Ga0105245_109176462 239
209 3300009147 Ga0114129_10051641 Ga0114129_100516413 239
210 3300009147 Ga0114129_10174961 Ga0114129_101749612 239
211 3300009147 Ga0114129_10584928 Ga0114129_105849282 239
212 3300009148 Ga0105243_10002610 Ga0105243_1000261014 239
213 3300009174 Ga0105241_10138880 Ga0105241_101388802 239
214 3300009176 Ga0105242_10001397 Ga0105242_100013975 239
215 3300009177 Ga0105248_10000658 Ga0105248_1000065822 239
216 3300009177 Ga0105248_10109728 Ga0105248_101097282 239
217 3300009551 Ga0105238_10124695 Ga0105238_101246952 239
218 3300009553 Ga0105249_10001200 Ga0105249_100012006 239
219 3300009553 Ga0105249_10059863 Ga0105249_100598632 239
220 3300009553 Ga0105249_10725676 Ga0105249_107256762 239
221 3300010375 Ga0105239_10004859 Ga0105239_1000485919 239
222 3300010375 Ga0105239_10015079 Ga0105239_100150792 239
223 3300011119 Ga0105246_10073971 Ga0105246_100739713 239
224 3300013104 Ga0157370_10040142 Ga0157370_100401422 239
225 3300013105 Ga0157369_10118975 Ga0157369_101189753 239
226 3300013297 Ga0157378_10002774 Ga0157378_1000277420 239
227 3300013306 Ga0163162_10019177 Ga0163162_100191774 239
228 3300013306 Ga0163162_10091556 Ga0163162_100915563 239
229 3300013307 Ga0157372_10205882 Ga0157372_102058823 239
230 3300014325 Ga0163163_10083756 Ga0163163_100837562 239
231 3300014325 Ga0163163_10369075 Ga0163163_103690752 239
232 3300014326 Ga0157380_10067813 Ga0157380_100678132 239
233 3300014968 Ga0157379_10011031 Ga0157379_100110315 239
234 3300014968 Ga0157379_10479461 Ga0157379_104794612 239
235 3300014969 Ga0157376_10034127 Ga0157376_100341274 239
236 3300017792 Ga0163161_10231693 Ga0163161_102316932 239
237 3300025899 Ga0207642_10001323 Ga0207642_100013238 239
238 3300025903 Ga0207680_10151671 Ga0207680_101516712 239
239 3300025904 Ga0207647_10232235 Ga0207647_102322352 239
240 3300025906 Ga0207699_10335926 Ga0207699_103359261 239
241 3300025907 Ga0207645_10000145 Ga0207645_1000014529 239
242 3300025908 Ga0207643_10014125 Ga0207643_100141252 239
243 3300025910 Ga0207684_10407326 Ga0207684_104073262 239
244 3300025911 Ga0207654_10008013 Ga0207654_100080132 239
245 3300025912 Ga0207707_10019193 Ga0207707_100191934 239
246 3300025912 Ga0207707_10040209 Ga0207707_100402093 239
247 3300025912 Ga0207707_10166988 Ga0207707_101669882 239
248 3300025912 Ga0207707_10430404 Ga0207707_104304042 239
249 3300025912 Ga0207707_10542950 Ga0207707_105429501 239
250 3300025917 Ga0207660_10279177 Ga0207660_102791772 239
251 3300025917 Ga0207660_10328911 Ga0207660_103289112 239
252 3300025919 Ga0207657_10048349 Ga0207657_100483492 239
253 3300025920 Ga0207649_10214558 Ga0207649_102145582 239
254 3300025921 Ga0207652_10014603 Ga0207652_100146033 239
255 3300025921 Ga0207652_10445503 Ga0207652_104455031 239
256 3300025922 Ga0207646_10006308 Ga0207646_100063089 239
257 3300025922 Ga0207646_10018162 Ga0207646_100181622 239
258 3300025922 Ga0207646_10027616 Ga0207646_100276162 239
259 3300025922 Ga0207646_10094828 Ga0207646_100948282 239
260 3300025922 Ga0207646_10352811 Ga0207646_103528112 239
261 3300025922 Ga0207646_10376581 Ga0207646_103765812 239
262 3300025923 Ga0207681_10070013 Ga0207681_100700133 239
263 3300025924 Ga0207694_10011630 Ga0207694_100116302 239
264 3300025925 Ga0207650_10415766 Ga0207650_104157662 239
265 3300025926 Ga0207659_10168134 Ga0207659_101681341 239
266 3300025926 Ga0207659_10664409 Ga0207659_106644092 239
267 3300025927 Ga0207687_10493269 Ga0207687_104932692 239
268 3300025929 Ga0207664_10473158 Ga0207664_104731581 239
269 3300025931 Ga0207644_10046746 Ga0207644_100467462 239
270 3300025932 Ga0207690_10117926 Ga0207690_101179262 239
271 3300025933 Ga0207706_10000146 Ga0207706_1000014626 239
272 3300025933 Ga0207706_10145791 Ga0207706_101457912 239
273 3300025933 Ga0207706_10250761 Ga0207706_102507612 239
274 3300025933 Ga0207706_10404970 Ga0207706_104049702 239
275 3300025934 Ga0207686_10000067 Ga0207686_1000006786 239
276 3300025935 Ga0207709_10001445 Ga0207709_1000144511 239
277 3300025937 Ga0207669_10001177 Ga0207669_100011779 239
278 3300025938 Ga0207704_10049442 Ga0207704_100494422 239
279 3300025940 Ga0207691_10133322 Ga0207691_101333222 239
280 3300025940 Ga0207691_10294965 Ga0207691_102949652 239
281 3300025941 Ga0207711_10002609 Ga0207711_100026094 239
282 3300025945 Ga0207679_10018948 Ga0207679_100189485 239
283 3300025961 Ga0207712_10000079 Ga0207712_1000007989 239
284 3300025961 Ga0207712_10001918 Ga0207712_1000191811 239
285 3300025961 Ga0207712_10017489 Ga0207712_100174894 239
286 3300025972 Ga0207668_10010985 Ga0207668_100109854 239
287 3300025972 Ga0207668_10217969 Ga0207668_102179692 239
288 3300025981 Ga0207640_10003844 Ga0207640_100038444 239
289 3300025981 Ga0207640_10297825 Ga0207640_102978252 239
290 3300026041 Ga0207639_10054591 Ga0207639_100545913 239
291 3300026067 Ga0207678_10222635 Ga0207678_102226352 239
292 3300026075 Ga0207708_10101362 Ga0207708_101013622 239
293 3300026088 Ga0207641_10189724 Ga0207641_101897242 239
294 3300026088 Ga0207641_10423877 Ga0207641_104238771 239
295 3300026089 Ga0207648_10001390 Ga0207648_1000139019 239
296 3300026089 Ga0207648_10173691 Ga0207648_101736912 239
297 3300026095 Ga0207676_10021625 Ga0207676_100216252 239
298 3300026116 Ga0207674_10418525 Ga0207674_104185252 239
299 3300026118 Ga0207675_100501359 Ga0207675_1005013592 239
300 3300026118 Ga0207675_100780150 Ga0207675_1007801502 239
301 3300026121 Ga0207683_10005089 Ga0207683_100050893 239
302 3300026142 Ga0207698_10082023 Ga0207698_100820232 239
303 3300027360 Ga0209969_1009284 Ga0209969_10092842 239
304 3300027717 Ga0209998_10036451 Ga0209998_100364512 239
305 3300027876 Ga0209974_10039404 Ga0209974_100394042 239
306 3300028379 Ga0268266_10108349 Ga0268266_101083492 239
307 3300028379 Ga0268266_10507500 Ga0268266_105075002 239
308 3300028380 Ga0268265_10123590 Ga0268265_101235903 239
309 3300028381 Ga0268264_10028037 Ga0268264_100280374 239
310 3300028381 Ga0268264_10125498 Ga0268264_101254982 239
311 3300028800 Ga0265338_10001746 Ga0265338_1000174629 239
312 3300031548 Ga0307408_100004762 Ga0307408_1000047622 239
313 3300031548 Ga0307408_100048901 Ga0307408_1000489012 239
314 3300031548 Ga0307408_100159922 Ga0307408_1001599222 239
315 3300031548 Ga0307408_100166047 Ga0307408_1001660472 239
316 3300031548 Ga0307408_100284006 Ga0307408_1002840062 239
317 3300031731 Ga0307405_10101985 Ga0307405_101019852 239
318 3300031731 Ga0307405_10250177 Ga0307405_102501772 239
319 3300031824 Ga0307413_10003985 Ga0307413_100039851 239
320 3300031824 Ga0307413_10052635 Ga0307413_100526352 239
321 3300031824 Ga0307413_10058187 Ga0307413_100581873 239
322 3300031852 Ga0307410_10024856 Ga0307410_100248562 239
323 3300031852 Ga0307410_10056168 Ga0307410_100561682 239
324 3300031852 Ga0307410_10063680 Ga0307410_100636802 239
325 3300031852 Ga0307410_10067745 Ga0307410_100677452 239
326 3300031852 Ga0307410_10112921 Ga0307410_101129212 239
327 3300031852 Ga0307410_10167042 Ga0307410_101670422 239
328 3300031901 Ga0307406_10047823 Ga0307406_100478232 239
329 3300031901 Ga0307406_10053445 Ga0307406_100534452 239
330 3300031901 Ga0307406_10064837 Ga0307406_100648372 239
331 3300031901 Ga0307406_10144876 Ga0307406_101448762 239
332 3300031903 Ga0307407_10017198 Ga0307407_100171982 239
333 3300031903 Ga0307407_10021217 Ga0307407_100212172 239
334 3300031903 Ga0307407_10023656 Ga0307407_100236562 239
335 3300031903 Ga0307407_10034610 Ga0307407_100346102 239
336 3300031903 Ga0307407_10193364 Ga0307407_101933642 239
337 3300031903 Ga0307407_10259623 Ga0307407_102596231 239
338 3300031911 Ga0307412_10020347 Ga0307412_100203472 239
339 3300031911 Ga0307412_10586077 Ga0307412_105860772 239
340 3300031995 Ga0307409_100000308 Ga0307409_10000030818 239
341 3300031995 Ga0307409_100006784 Ga0307409_1000067844 239
342 3300031995 Ga0307409_100061431 Ga0307409_1000614312 239
343 3300031995 Ga0307409_100105924 Ga0307409_1001059242 239
344 3300031995 Ga0307409_100112811 Ga0307409_1001128112 239
345 3300031995 Ga0307409_100178521 Ga0307409_1001785212 239
346 3300031995 Ga0307409_100222747 Ga0307409_1002227472 239
347 3300031995 Ga0307409_100239768 Ga0307409_1002397682 239
348 3300031995 Ga0307409_100673217 Ga0307409_1006732172 239
349 3300032002 Ga0307416_100002827 Ga0307416_1000028276 239
350 3300032002 Ga0307416_100005003 Ga0307416_10000500311 239
351 3300032002 Ga0307416_100011070 Ga0307416_1000110702 239
352 3300032002 Ga0307416_100030262 Ga0307416_1000302622 239
353 3300032002 Ga0307416_100050239 Ga0307416_1000502392 239
354 3300032002 Ga0307416_100159447 Ga0307416_1001594472 239
355 3300032002 Ga0307416_100201144 Ga0307416_1002011442 239
356 3300032002 Ga0307416_100278133 Ga0307416_1002781332 239
357 3300032002 Ga0307416_100899816 Ga0307416_1008998162 239
358 3300032002 Ga0307416_100960228 Ga0307416_1009602282 239
359 3300032004 Ga0307414_10022522 Ga0307414_100225223 239
360 3300032004 Ga0307414_10081152 Ga0307414_100811522 239
361 3300032004 Ga0307414_10088499 Ga0307414_100884992 239
362 3300032004 Ga0307414_10098608 Ga0307414_100986082 239
363 3300032004 Ga0307414_10243491 Ga0307414_102434912 239
364 3300032005 Ga0307411_10002519 Ga0307411_100025192 239
365 3300032005 Ga0307411_10033227 Ga0307411_100332272 239
366 3300032005 Ga0307411_10045926 Ga0307411_100459262 239
367 3300032005 Ga0307411_10091076 Ga0307411_100910762 239
368 3300032005 Ga0307411_10219910 Ga0307411_102199101 239
369 3300032126 Ga0307415_100000203 Ga0307415_10000020323 239
370 3300032126 Ga0307415_100001513 Ga0307415_10000151312 239
371 3300032126 Ga0307415_100292266 Ga0307415_1002922662 239
372 3300032126 Ga0307415_100365496 Ga0307415_1003654962 239
373 3300035085 Ga0373929_0021808 Ga0373929_0021808_486_1205 239
374 3300035086 Ga0373934_0000216 Ga0373934_0000216_13050_13772 239
375 3300035088 Ga0373940_0016091 Ga0373940_0016091_264_983 239
376 3300035088 Ga0373940_0032565 Ga0373940_0032565_83_802 239
377 3300035090 Ga0373949_0021123 Ga0373949_0021123_169_888 239
378 3300035111 Ga0373923_0008948 Ga0373923_0008948_2295_3017 239
379 3300035119 Ga0373956_0000127 Ga0373956_0000127_6826_7548 239
380 3300035120 Ga0373957_0014563 Ga0373957_0014563_222_944 239
381 3300035172 Ga0373955_0004911 Ga0373955_0004911_201_923 239
382 3300035410 Ga0373924_0121700 Ga0373924_0121700_242_964 239
383 3300035692 Ga0373935_0071348 Ga0373935_0071348_918_1640 239
384 3300035724 Ga0373933_0000353 Ga0373933_0000353_1778_2500 239
385 3300036401 Ga0373937_0000195 Ga0373937_0000195_12480_13202 239
386 3300036401 Ga0373937_0152366 Ga0373937_0152366_331_1053 239
387 3300038443 Ga0395901_0113783 Ga0395901_0113783_930_1649 239
388 3300038996 Ga0242420_000375 Ga0242420_000375_2644_3363 239
389 3300038996 Ga0242420_014811 Ga0242420_014811_245_1108 239
390 3300038996 Ga0242420_015847 Ga0242420_015847_310_1032 239
391 3300038996 Ga0242420_052098 Ga0242420_052098_30_749 239
392 3300041406 Ga0439439_0013110 Ga0439439_0013110_708_1427 239
393 3300041408 Ga0439453_0054999 Ga0439453_0054999_57_782 239
394 3300041486 Ga0451807_0948721 Ga0451807_0948721_378_1097 239
395 3300041505 Ga0451849_1163722 Ga0451849_1163722_454_1173 239
396 3300042003 Ga0439443_032612 Ga0439443_032612_113_838 239
397 3300042184 Ga0450908_031118 Ga0450908_031118_119_838 239
398 3300042876 Ga0451577_0525891 Ga0451577_0525891_161_880 239
399 3300044673 Ga0453683_0102758 Ga0453683_0102758_559_1278 239
400 3300044673 Ga0453683_0269610 Ga0453683_0269610_257_976 239
401 3300044712 Ga0453684_0855203 Ga0453684_0855203_70_789 239
402 3300045051 Ga0451576_0133286 Ga0451576_0133286_1492_2223 239
403 3300045051 Ga0451576_0611109 Ga0451576_0611109_125_844 239
404 3300046454 Ga0495592_0003659 Ga0495592_0003659_4909_5631 239
405 3300046455 Ga0495603_0058591 Ga0495603_0058591_38_760 239
406 3300046455 Ga0495603_0108964 Ga0495603_0108964_862_1581 239
407 3300046461 Ga0495641_0107243 Ga0495641_0107243_12_734 239
408 3300046462 Ga0495651_0000050 Ga0495651_0000050_37890_38612 239
409 3300046463 Ga0495653_0000134 Ga0495653_0000134_46395_47117 239
410 3300046473 Ga0495582_0021166 Ga0495582_0021166_2058_2780 239
411 3300046475 Ga0495639_0011198 Ga0495639_0011198_974_1696 239
412 3300046499 Ga0495594_0026408 Ga0495594_0026408_1068_1790 239
413 3300046511 Ga0495608_0000381 Ga0495608_0000381_13647_14369 239
414 3300046514 Ga0495618_0060276 Ga0495618_0060276_905_1627 239
415 3300046516 Ga0495628_0001309 Ga0495628_0001309_2344_3066 239
416 3300046516 Ga0495628_0233857 Ga0495628_0233857_90_812 239
417 3300046517 Ga0495630_0004360 Ga0495630_0004360_1925_2647 239
418 3300046517 Ga0495630_0023250 Ga0495630_0023250_2783_3505 239
419 3300046526 Ga0495666_0002485 Ga0495666_0002485_7373_8095 239
420 3300046529 Ga0495652_0003898 Ga0495652_0003898_6957_7679 239
421 3300046533 Ga0495640_0058174 Ga0495640_0058174_1795_2517 239
422 3300046535 Ga0495586_0007463 Ga0495586_0007463_1224_1946 239
423 3300046536 Ga0495587_0000114 Ga0495587_0000114_52153_52875 239
424 3300046543 Ga0495645_0000065 Ga0495645_0000065_57950_58672 239
425 3300046543 Ga0495645_0063735 Ga0495645_0063735_516_1238 239
426 3300046557 Ga0495622_0092018 Ga0495622_0092018_624_1343 239
427 3300046559 Ga0495667_0000316 Ga0495667_0000316_24177_24899 239
428 3300046559 Ga0495667_0156542 Ga0495667_0156542_215_937 239
429 3300046642 Ga0495634_0010164 Ga0495634_0010164_1318_2040 239
430 3300046663 Ga0495635_0000103 Ga0495635_0000103_3704_4426 239
431 3300046675 Ga0495657_0001662 Ga0495657_0001662_13849_14571 239
432 3300046675 Ga0495657_0235271 Ga0495657_0235271_362_1081 239
433 3300046678 Ga0495599_0005532 Ga0495599_0005532_1349_2071 239
434 3300046679 Ga0495623_0000086 Ga0495623_0000086_48212_48934 239
435 3300046680 Ga0495646_0091304 Ga0495646_0091304_962_1684 239
436 3300046681 Ga0495647_0031139 Ga0495647_0031139_542_1264 239
437 3300046683 Ga0495658_0009713 Ga0495658_0009713_2671_3393 239
438 3300046689 Ga0495613_0067652 Ga0495613_0067652_1052_1774 239
439 3300046809 Ga0495600_0003319 Ga0495600_0003319_6313_7035 239
440 3300047317 Ga0495604_0001195 Ga0495604_0001195_14087_14809 239
441 3300047319 Ga0495674_0000339 Ga0495674_0000339_24374_25096 239
442 3300047319 Ga0495674_0023282 Ga0495674_0023282_1550_2272 239
443 3300047319 Ga0495674_0149410 Ga0495674_0149410_870_1592 239
444 3300047322 Ga0495680_0016313 Ga0495680_0016313_469_1191 239
445 3300047322 Ga0495680_0021286 Ga0495680_0021286_1126_1848 239
446 3300047471 Ga0495684_0000141 Ga0495684_0000141_46066_46788 239
447 3300048088 Ga0495602_0003470 Ga0495602_0003470_6021_6743 239
448 3300048903 Ga0496100_0482066 Ga0496100_0482066_68_787 239
449 3300048905 Ga0496102_0229646 Ga0496102_0229646_20_739 239
450 3300048905 Ga0496102_0269122 Ga0496102_0269122_872_1591 239
451 3300048905 Ga0496102_0506620 Ga0496102_0506620_137_856 239
452 3300048906 Ga0496103_0135937 Ga0496103_0135937_623_1342 239
453 3300048906 Ga0496103_0258246 Ga0496103_0258246_285_1004 239
454 3300048907 Ga0496104_0010276 Ga0496104_0010276_6685_7404 239
455 3300048908 Ga0496105_0069739 Ga0496105_0069739_2124_2843 239
456 3300048909 Ga0496106_0022907 Ga0496106_0022907_1461_2180 239
457 3300048909 Ga0496106_0042473 Ga0496106_0042473_249_968 239
458 3300048909 Ga0496106_0125496 Ga0496106_0125496_333_1052 239
459 3300048909 Ga0496106_0250541 Ga0496106_0250541_502_1221 239
460 3300048910 Ga0496107_0204239 Ga0496107_0204239_583_1302 239
461 3300048911 Ga0496108_0001782 Ga0496108_0001782_4899_5618 239
462 3300048911 Ga0496108_0002171 Ga0496108_0002171_6181_6900 239
463 3300048911 Ga0496108_0003640 Ga0496108_0003640_4442_5161 239
464 3300048911 Ga0496108_0313513 Ga0496108_0313513_403_1122 239
465 3300048912 Ga0496109_0001037 Ga0496109_0001037_480_1199 239
466 3300048912 Ga0496109_0007936 Ga0496109_0007936_860_1579 239
467 3300048912 Ga0496109_0099260 Ga0496109_0099260_682_1401 239
468 3300048912 Ga0496109_0204457 Ga0496109_0204457_909_1628 239
469 3300048913 Ga0496110_0016427 Ga0496110_0016427_3235_3954 239
470 3300048913 Ga0496110_0089740 Ga0496110_0089740_1743_2462 239
471 3300048914 Ga0496111_0015616 Ga0496111_0015616_2394_3113 239
472 3300048914 Ga0496111_0020367 Ga0496111_0020367_2491_3210 239
473 3300048915 Ga0496112_0000129 Ga0496112_0000129_39568_40287 239
474 3300048915 Ga0496112_0047190 Ga0496112_0047190_3018_3737 239
475 3300048915 Ga0496112_0148982 Ga0496112_0148982_1101_1820 239
476 3300048915 Ga0496112_0720710 Ga0496112_0720710_111_830 239
477 3300048916 Ga0496113_0000062 Ga0496113_0000062_39224_39943 239
478 3300048917 Ga0496114_0191002 Ga0496114_0191002_1026_1745 239
479 3300049521 Ga0501298_019236 Ga0501298_019236_278_997 239
480 3300049571 Ga0501034_0008504 Ga0501034_0008504_1016_1735 239
481 3300049571 Ga0501034_0063733 Ga0501034_0063733_1185_1904 239
482 3300049575 Ga0501039_0098097 Ga0501039_0098097_1368_2087 239
483 3300049576 Ga0501040_0118525 Ga0501040_0118525_299_1018 239
484 3300049577 Ga0501041_0367092 Ga0501041_0367092_75_794 239
485 3300049578 Ga0501042_0069774 Ga0501042_0069774_1081_1800 239
486 3300049578 Ga0501042_0130499 Ga0501042_0130499_815_1534 239
487 3300049578 Ga0501042_0249194 Ga0501042_0249194_95_814 239
488 3300049580 Ga0501046_0139275 Ga0501046_0139275_19_738 239
489 3300049581 Ga0501047_0698113 Ga0501047_0698113_92_811 239
490 3300049582 Ga0501048_0071460 Ga0501048_0071460_656_1375 239
491 3300049583 Ga0501067_0002448 Ga0501067_0002448_1033_1752 239
492 3300049583 Ga0501067_0013916 Ga0501067_0013916_2571_3290 239
493 3300049583 Ga0501067_0036646 Ga0501067_0036646_709_1428 239
494 3300049583 Ga0501067_0042648 Ga0501067_0042648_580_1365 239
495 3300049584 Ga0501068_0000311 Ga0501068_0000311_11787_12506 239
496 3300049584 Ga0501068_0006064 Ga0501068_0006064_4895_5614 239
497 3300049585 Ga0501069_0001105 Ga0501069_0001105_551_1270 239
498 3300049585 Ga0501069_0001912 Ga0501069_0001912_9121_9840 239
499 3300049586 Ga0501070_0004182 Ga0501070_0004182_10688_11407 239
500 3300049586 Ga0501070_0018009 Ga0501070_0018009_3814_4533 239
501 3300049586 Ga0501070_0060202 Ga0501070_0060202_1020_1742 239
502 3300049586 Ga0501070_0424747 Ga0501070_0424747_192_911 239
503 3300049587 Ga0501071_0002649 Ga0501071_0002649_92_811 239
504 3300049587 Ga0501071_0008604 Ga0501071_0008604_5022_5741 239
505 3300049587 Ga0501071_0038976 Ga0501071_0038976_976_1695 239
506 3300049588 Ga0501072_0017501 Ga0501072_0017501_892_1611 239
507 3300049588 Ga0501072_0033860 Ga0501072_0033860_2762_3481 239
508 3300049588 Ga0501072_0039701 Ga0501072_0039701_1999_2718 239
509 3300049588 Ga0501072_0058662 Ga0501072_0058662_1965_2684 239
510 3300049588 Ga0501072_0115737 Ga0501072_0115737_1064_1783 239
511 3300049589 Ga0501073_0015044 Ga0501073_0015044_1080_1799 239
512 3300049590 Ga0501074_0113482 Ga0501074_0113482_852_1571 239
513 3300049590 Ga0501074_0136211 Ga0501074_0136211_1021_1740 239
514 3300049591 Ga0501075_0073623 Ga0501075_0073623_1181_1900 239
515 3300049591 Ga0501075_0175770 Ga0501075_0175770_259_978 239
516 3300049592 Ga0501076_0011216 Ga0501076_0011216_5390_6109 239
517 3300049592 Ga0501076_0178823 Ga0501076_0178823_122_841 239
518 3300049592 Ga0501076_0190694 Ga0501076_0190694_135_854 239
519 3300049592 Ga0501076_0498352 Ga0501076_0498352_198_917 239
520 3300049592 Ga0501076_0581978 Ga0501076_0581978_144_863 239
521 3300049593 Ga0501077_0033274 Ga0501077_0033274_1716_2435 239
522 3300049656 Ga0501209_002545 Ga0501209_002545_1039_1788 239
523 3300049675 Ga0501243_012653 Ga0501243_012653_493_1242 239
524 3300049677 Ga0501247_014704 Ga0501247_014704_11_760 239
525 3300049679 Ga0501249_012149 Ga0501249_012149_433_1182 239
526 3300049686 Ga0501257_013681 Ga0501257_013681_211_960 239
527 3300049741 Ga0501079_0009697 Ga0501079_0009697_690_1409 239
528 3300049741 Ga0501079_0054981 Ga0501079_0054981_408_1127 239
529 3300049741 Ga0501079_0065143 Ga0501079_0065143_89_808 239
530 3300049741 Ga0501079_0103136 Ga0501079_0103136_861_1580 239
531 3300049741 Ga0501079_0127696 Ga0501079_0127696_22_741 239
532 3300049742 Ga0501080_0002229 Ga0501080_0002229_1980_2699 239
533 3300049742 Ga0501080_0002645 Ga0501080_0002645_2919_3638 239
534 3300049742 Ga0501080_0010834 Ga0501080_0010834_5457_6176 239
535 3300049742 Ga0501080_0205454 Ga0501080_0205454_464_1183 239
536 3300049742 Ga0501080_0500691 Ga0501080_0500691_331_1050 239
537 3300049743 Ga0501081_0220150 Ga0501081_0220150_516_1235 239
538 3300049744 Ga0501083_0001221 Ga0501083_0001221_15572_16291 239
539 3300049744 Ga0501083_0002285 Ga0501083_0002285_5509_6228 239
540 3300049759 Ga0501262_004576 Ga0501262_004576_159_908 239
541 3300049770 Ga0501273_002720 Ga0501273_002720_180_929 239
542 3300049824 Ga0501045_0017170 Ga0501045_0017170_3812_4531 239
543 3300049824 Ga0501045_0078665 Ga0501045_0078665_22_741 239
544 3300049824 Ga0501045_0089452 Ga0501045_0089452_818_1537 239
545 3300049824 Ga0501045_0126992 Ga0501045_0126992_111_830 239
546 3300049851 Ga0501212_017063 Ga0501212_017063_315_1064 239
547 3300050507 nmdc:mga05p37_17760_c2 nmdc:mga05p37_17760_c2_2158_2877 239
548 3300050507 nmdc:mga05p37_273526_c1 nmdc:mga05p37_273526_c1_151_870 239
549 3300050508 nmdc:mga09592_1219_c1 nmdc:mga09592_1219_c1_10205_10924 239
550 3300050509 nmdc:mga0qj67_129765_c1 nmdc:mga0qj67_129765_c1_632_1351 239
551 3300050510 nmdc:mga06r32_193097_c1 nmdc:mga06r32_193097_c1_924_1643 239
552 3300050510 nmdc:mga06r32_63445_c1 nmdc:mga06r32_63445_c1_507_1256 239
553 3300050512 nmdc:mga0n895_470891_c1 nmdc:mga0n895_470891_c1_524_1243 239
554 3300053077 Ga0495601_0009524 Ga0495601_0009524_277_999 239
555 3300053078 Ga0495612_0005188 Ga0495612_0005188_1087_1809 239
556 3300053084 Ga0495595_0010877 Ga0495595_0010877_2087_2809 239
557 3300054114 Ga0501084_0001049 Ga0501084_0001049_6755_7474 239
558 3300054114 Ga0501084_0022098 Ga0501084_0022098_4229_4948 239
559 3300054114 Ga0501084_0032371 Ga0501084_0032371_2550_3269 239
560 3300054114 Ga0501084_0056519 Ga0501084_0056519_2448_3167 239
561 3300054114 Ga0501084_0084552 Ga0501084_0084552_920_1639 239
562 3300054114 Ga0501084_0323761 Ga0501084_0323761_67_786 239
563 3300054114 Ga0501084_0858725 Ga0501084_0858725_11_730 239
564 3300059421 Ga0590071_000553 Ga0590071_000553_10031_10750 239
565 3300059421 Ga0590071_013855 Ga0590071_013855_294_1013 239
566 3300059421 Ga0590071_016339 Ga0590071_016339_204_923 239
567 3300059423 Ga0590074_018326 Ga0590074_018326_79_798 239
568 3300059423 Ga0590074_030196 Ga0590074_030196_53_772 239
569 3300059424 Ga0590075_019466 Ga0590075_019466_359_1078 239
570 3300059424 Ga0590075_052075 Ga0590075_052075_185_904 239
571 3300060353 Ga0501082_0019260 Ga0501082_0019260_1993_2712 239
572 3300060353 Ga0501082_0108395 Ga0501082_0108395_617_1336 239
573 3300060353 Ga0501082_0132652 Ga0501082_0132652_1250_1969 239
574 3300060353 Ga0501082_0147609 Ga0501082_0147609_879_1598 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

54

220

0.98

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

51

275

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8563 3 230
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8537 4 238
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8025 3 230
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8012 4 238
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7548 3 237
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9425 3 238 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9274 3 238 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8716 4 227 3.90.550.10
af_A0A0R0GWU7_24_252_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8641 3 224 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8636 7 232 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D4G0G2-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9918 2 208 GO:0004582
GO:0009247
GO:0016020
AF-A0A7X4C4G6-F1-model_v4 deleted 0.9895 3 239
AF-A0A1V0DD11-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9839 2 239 GO:0004582
GO:0009247
GO:0016020
AF-A0A660SCN6-F1-model_v4 Polyprenol monophosphomannose synthase 0.9821 69 239 GO:0004582
GO:0009247
GO:0016020
AF-A0A7V0IGF1-F1-model_v4 Polyprenol monophosphomannose synthase 0.9793 3 239 GO:0004582
GO:0009247
GO:0016020

Feature Viewer

pLDDT pTM Quality
92.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map