F465323
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 293 | 574 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300038996|Ga0242420_014811|Ga0242420_014811_245_1108 |
| Length | 287 |
| Sequence | MPDDLLAPLPSRLDRRQFLTRAGWTGVGAGALVAGAVEGARPAAERALVAERALVVIPTYNERINLPLIVPQILQQDPRLEVLVVDDNSPDGTGKLADELAGADRRIHVLHRPGKAGLGKAYLAGFRWALDQGYDLIFEMDADFSHDPKFLPDFLRAIEQADLVLGSRYAAGVNVINWPISRLLLSVGANEYARRITGLPIADSTGGFKCFRRKVLEAIDLDRVRSNGYSFQIEMSFRAWKKGFRVLEIPIVFTDRVEGQSKMNKRIVREAIWMVWWLRLQSMTGRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 162 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 178 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 179 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 180 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 182 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 183 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 184 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 187 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 191 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 268 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 269 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 270 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 291 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 292 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.01 |
| Rhizosphere | 91.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_7531960 | 2162886012 | Bacteria | 1189 |
| 2 | rootL2_10210367 | 3300003322 | Bacteria | 4420 |
| 3 | Ga0065715_10173894 | 3300005293 | Bacteria | 1517 |
| 4 | Ga0065715_10394049 | 3300005293 | Bacteria | 890 |
| 5 | Ga0070676_10001926 | 3300005328 | Bacteria | 10538 |
| 6 | Ga0070690_100069907 | 3300005330 | Bacteria | 2279 |
| 7 | Ga0070670_100494467 | 3300005331 | Unclassified | 1087 |
| 8 | Ga0068869_100101962 | 3300005334 | Bacteria | 2172 |
| 9 | Ga0070666_10166720 | 3300005335 | Bacteria | 1541 |
| 10 | Ga0070680_100010891 | 3300005336 | Bacteria | 7025 |
| 11 | Ga0070680_100244207 | 3300005336 | Bacteria | 1518 |
| 12 | Ga0070680_100426969 | 3300005336 | Bacteria | 1131 |
| 13 | Ga0070682_100116414 | 3300005337 | Bacteria | 1788 |
| 14 | Ga0070660_100084929 | 3300005339 | Bacteria | 2489 |
| 15 | Ga0070660_100118165 | 3300005339 | Bacteria | 2114 |
| 16 | Ga0070689_100599267 | 3300005340 | Bacteria | 954 |
| 17 | Ga0070661_100006568 | 3300005344 | Bacteria | 8020 |
| 18 | Ga0070692_10129165 | 3300005345 | Bacteria | 1418 |
| 19 | Ga0070668_100016539 | 3300005347 | Bacteria | 5514 |
| 20 | Ga0070668_100541495 | 3300005347 | Bacteria | 1012 |
| 21 | Ga0070669_100317337 | 3300005353 | Bacteria | 1257 |
| 22 | Ga0070675_100087569 | 3300005354 | Bacteria | 2604 |
| 23 | Ga0070675_100153607 | 3300005354 | Bacteria | 1975 |
| 24 | Ga0070675_100280529 | 3300005354 | Unclassified | 1464 |
| 25 | Ga0070674_100000378 | 3300005356 | Bacteria | 22336 |
| 26 | Ga0070688_100487905 | 3300005365 | Bacteria | 927 |
| 27 | Ga0070659_100307617 | 3300005366 | Bacteria | 1323 |
| 28 | Ga0070667_100153437 | 3300005367 | Bacteria | 2025 |
| 29 | Ga0070703_10078876 | 3300005406 | Bacteria | 1117 |
| 30 | Ga0070714_100016523 | 3300005435 | Bacteria | 5962 |
| 31 | Ga0070714_100440118 | 3300005435 | Bacteria | 1237 |
| 32 | Ga0070701_10148546 | 3300005438 | Unclassified | 1347 |
| 33 | Ga0070701_10253461 | 3300005438 | Bacteria | 1064 |
| 34 | Ga0070705_100002647 | 3300005440 | Bacteria | 8956 |
| 35 | Ga0070705_100273235 | 3300005440 | Bacteria | 1198 |
| 36 | Ga0070705_100327785 | 3300005440 | Bacteria | 1108 |
| 37 | Ga0070700_100021447 | 3300005441 | Unclassified | 3755 |
| 38 | Ga0070694_100063760 | 3300005444 | Bacteria | 2521 |
| 39 | Ga0070694_100078186 | 3300005444 | Bacteria | 2294 |
| 40 | Ga0070694_100300410 | 3300005444 | Bacteria | 1230 |
| 41 | Ga0070708_100120509 | 3300005445 | Bacteria | 2420 |
| 42 | Ga0070708_100131902 | 3300005445 | Bacteria | 2313 |
| 43 | Ga0070708_100555363 | 3300005445 | Bacteria | 1083 |
| 44 | Ga0070708_100582265 | 3300005445 | Bacteria | 1055 |
| 45 | Ga0070663_100014119 | 3300005455 | Bacteria | 5120 |
| 46 | Ga0070663_100069299 | 3300005455 | Bacteria | 2562 |
| 47 | Ga0070678_100350216 | 3300005456 | Unclassified | 1270 |
| 48 | Ga0070662_100001016 | 3300005457 | Bacteria | 17162 |
| 49 | Ga0070662_100486095 | 3300005457 | Bacteria | 1028 |
| 50 | Ga0070681_10030540 | 3300005458 | Bacteria | 5406 |
| 51 | Ga0070681_10101990 | 3300005458 | Bacteria | 2815 |
| 52 | Ga0070681_10121484 | 3300005458 | Bacteria | 2547 |
| 53 | Ga0070681_10147783 | 3300005458 | Bacteria | 2278 |
| 54 | Ga0070681_10327806 | 3300005458 | Bacteria | 1441 |
| 55 | Ga0070681_10424827 | 3300005458 | Bacteria | 1241 |
| 56 | Ga0070681_10514507 | 3300005458 | Bacteria | 1110 |
| 57 | Ga0068867_100001302 | 3300005459 | Bacteria | 17244 |
| 58 | Ga0068867_100667149 | 3300005459 | Bacteria | 914 |
| 59 | Ga0070706_100356695 | 3300005467 | Bacteria | 1363 |
| 60 | Ga0070706_100598744 | 3300005467 | Bacteria | 1024 |
| 61 | Ga0070707_100001911 | 3300005468 | Bacteria | 19959 |
| 62 | Ga0070707_100010581 | 3300005468 | Bacteria | 8589 |
| 63 | Ga0070707_100018305 | 3300005468 | Bacteria | 6592 |
| 64 | Ga0070707_100084370 | 3300005468 | Bacteria | 3070 |
| 65 | Ga0070707_100240996 | 3300005468 | Bacteria | 1760 |
| 66 | Ga0070707_100457576 | 3300005468 | Bacteria | 1237 |
| 67 | Ga0070707_100502881 | 3300005468 | Bacteria | 1174 |
| 68 | Ga0070698_100012758 | 3300005471 | Bacteria | 8900 |
| 69 | Ga0070698_100032678 | 3300005471 | Bacteria | 5388 |
| 70 | Ga0070698_100444744 | 3300005471 | Bacteria | 1231 |
| 71 | Ga0070699_100000719 | 3300005518 | Bacteria | 30756 |
| 72 | Ga0070699_100009101 | 3300005518 | Bacteria | 8611 |
| 73 | Ga0070699_100021678 | 3300005518 | Bacteria | 5540 |
| 74 | Ga0070699_100297513 | 3300005518 | Bacteria | 1448 |
| 75 | Ga0070699_100322234 | 3300005518 | Bacteria | 1389 |
| 76 | Ga0070699_100395588 | 3300005518 | Bacteria | 1249 |
| 77 | Ga0070679_100013124 | 3300005530 | Bacteria | 7934 |
| 78 | Ga0070679_100084258 | 3300005530 | Bacteria | 3167 |
| 79 | Ga0070679_100115444 | 3300005530 | Bacteria | 2670 |
| 80 | Ga0070679_100172663 | 3300005530 | Unclassified | 2134 |
| 81 | Ga0070679_100447328 | 3300005530 | Bacteria | 1237 |
| 82 | Ga0070684_100535366 | 3300005535 | Bacteria | 1086 |
| 83 | Ga0070697_100189387 | 3300005536 | Bacteria | 1746 |
| 84 | Ga0068853_100003056 | 3300005539 | Bacteria | 12778 |
| 85 | Ga0070686_100000372 | 3300005544 | Bacteria | 28575 |
| 86 | Ga0070695_100004631 | 3300005545 | Bacteria | 8082 |
| 87 | Ga0070695_100101427 | 3300005545 | Bacteria | 1939 |
| 88 | Ga0070695_100116220 | 3300005545 | Bacteria | 1823 |
| 89 | Ga0070696_100000510 | 3300005546 | Bacteria | 24577 |
| 90 | Ga0070696_100017080 | 3300005546 | Bacteria | 4897 |
| 91 | Ga0070696_100108888 | 3300005546 | Bacteria | 1993 |
| 92 | Ga0070696_100331815 | 3300005546 | Bacteria | 1173 |
| 93 | Ga0070696_100578439 | 3300005546 | Bacteria | 903 |
| 94 | Ga0070693_100064464 | 3300005547 | Bacteria | 2139 |
| 95 | Ga0070693_100206139 | 3300005547 | Unclassified | 1280 |
| 96 | Ga0070665_100091648 | 3300005548 | Bacteria | 3044 |
| 97 | Ga0070665_100151284 | 3300005548 | Bacteria | 2324 |
| 98 | Ga0070704_100008201 | 3300005549 | Bacteria | 6249 |
| 99 | Ga0070704_100033367 | 3300005549 | Bacteria | 3479 |
| 100 | Ga0070704_100056684 | 3300005549 | Bacteria | 2783 |
| 101 | Ga0070704_100089528 | 3300005549 | Bacteria | 2289 |
| 102 | Ga0070704_100410782 | 3300005549 | Bacteria | 1157 |
| 103 | Ga0068855_100180020 | 3300005563 | Bacteria | 2390 |
| 104 | Ga0070664_100025286 | 3300005564 | Archaea | 4920 |
| 105 | Ga0070664_100083922 | 3300005564 | Unclassified | 2749 |
| 106 | Ga0068857_100009128 | 3300005577 | Bacteria | 8605 |
| 107 | Ga0068854_100001114 | 3300005578 | Bacteria | 16150 |
| 108 | Ga0068854_100042943 | 3300005578 | Bacteria | 3203 |
| 109 | Ga0068854_100431843 | 3300005578 | Bacteria | 1096 |
| 110 | Ga0068856_100182582 | 3300005614 | Bacteria | 2111 |
| 111 | Ga0070702_100012760 | 3300005615 | Bacteria | 4225 |
| 112 | Ga0068852_100065540 | 3300005616 | Bacteria | 3169 |
| 113 | Ga0068859_100102114 | 3300005617 | Unclassified | 2925 |
| 114 | Ga0068859_100246529 | 3300005617 | Unclassified | 1876 |
| 115 | Ga0068864_100017240 | 3300005618 | Bacteria | 6022 |
| 116 | Ga0068864_100451721 | 3300005618 | Bacteria | 1229 |
| 117 | Ga0068866_10000401 | 3300005718 | Bacteria | 20182 |
| 118 | Ga0068861_100427727 | 3300005719 | Unclassified | 1181 |
| 119 | Ga0068863_100117734 | 3300005841 | Bacteria | 2532 |
| 120 | Ga0068858_100111338 | 3300005842 | Bacteria | 2557 |
| 121 | Ga0068860_100008736 | 3300005843 | Bacteria | 10090 |
| 122 | Ga0068862_100056882 | 3300005844 | Unclassified | 3352 |
| 123 | Ga0068862_100605133 | 3300005844 | Bacteria | 1053 |
| 124 | Ga0081455_10034051 | 3300005937 | Bacteria | 4569 |
| 125 | Ga0097621_100303788 | 3300006237 | Bacteria | 1410 |
| 126 | Ga0068871_100048210 | 3300006358 | Bacteria | 3438 |
| 127 | Ga0075428_100030083 | 3300006844 | Bacteria | 6006 |
| 128 | Ga0075428_100086178 | 3300006844 | Bacteria | 3425 |
| 129 | Ga0075431_100026654 | 3300006847 | Bacteria | 5929 |
| 130 | Ga0075431_100080916 | 3300006847 | Bacteria | 3354 |
| 131 | Ga0075431_100398785 | 3300006847 | Unclassified | 1377 |
| 132 | Ga0075433_10013983 | 3300006852 | Bacteria | 6545 |
| 133 | Ga0075433_10033996 | 3300006852 | Unclassified | 4375 |
| 134 | Ga0075434_100426234 | 3300006871 | Unclassified | 1348 |
| 135 | Ga0075434_100744058 | 3300006871 | Bacteria | 997 |
| 136 | Ga0075429_100001523 | 3300006880 | Bacteria | 19059 |
| 137 | Ga0075429_100012245 | 3300006880 | Bacteria | 7438 |
| 138 | Ga0068865_100003327 | 3300006881 | Bacteria | 9628 |
| 139 | Ga0068865_100549996 | 3300006881 | Bacteria | 969 |
| 140 | Ga0075436_100023748 | 3300006914 | Bacteria | 4213 |
| 141 | Ga0097620_100102109 | 3300006931 | Unclassified | 2925 |
| 142 | Ga0097620_100246525 | 3300006931 | Unclassified | 1876 |
| 143 | Ga0075435_100201213 | 3300007076 | Bacteria | 1688 |
| 144 | Ga0105240_10278983 | 3300009093 | Bacteria | 1920 |
| 145 | Ga0105240_10313889 | 3300009093 | Bacteria | 1789 |
| 146 | Ga0111539_10294262 | 3300009094 | Bacteria | 1889 |
| 147 | Ga0111539_10619571 | 3300009094 | Bacteria | 1260 |
| 148 | Ga0105245_10917646 | 3300009098 | Bacteria | 918 |
| 149 | Ga0114129_10001639 | 3300009147 | Bacteria | 30412 |
| 150 | Ga0114129_10051641 | 3300009147 | Bacteria | 5771 |
| 151 | Ga0114129_10136860 | 3300009147 | Bacteria | 3360 |
| 152 | Ga0114129_10174961 | 3300009147 | Bacteria | 2924 |
| 153 | Ga0114129_10584928 | 3300009147 | Bacteria | 1448 |
| 154 | Ga0105243_10002610 | 3300009148 | Bacteria | 15026 |
| 155 | Ga0105241_10138880 | 3300009174 | Bacteria | 1976 |
| 156 | Ga0105242_10001397 | 3300009176 | Bacteria | 19028 |
| 157 | Ga0105248_10000658 | 3300009177 | Bacteria | 39283 |
| 158 | Ga0105248_10109728 | 3300009177 | Bacteria | 3111 |
| 159 | Ga0105238_10124695 | 3300009551 | Bacteria | 2555 |
| 160 | Ga0105249_10001200 | 3300009553 | Bacteria | 22851 |
| 161 | Ga0105249_10059863 | 3300009553 | Unclassified | 3493 |
| 162 | Ga0105249_10725676 | 3300009553 | Bacteria | 1055 |
| 163 | Ga0105239_10004859 | 3300010375 | Bacteria | 15900 |
| 164 | Ga0105239_10015079 | 3300010375 | Bacteria | 8567 |
| 165 | Ga0105246_10073971 | 3300011119 | Unclassified | 2407 |
| 166 | Ga0157370_10040142 | 3300013104 | Bacteria | 4519 |
| 167 | Ga0157369_10118975 | 3300013105 | Bacteria | 2804 |
| 168 | Ga0157378_10002774 | 3300013297 | Bacteria | 15611 |
| 169 | Ga0163162_10019177 | 3300013306 | Bacteria | 6708 |
| 170 | Ga0163162_10091556 | 3300013306 | Unclassified | 3124 |
| 171 | Ga0157372_10205882 | 3300013307 | Bacteria | 2280 |
| 172 | Ga0163163_10083756 | 3300014325 | Bacteria | 3194 |
| 173 | Ga0163163_10369075 | 3300014325 | Bacteria | 1492 |
| 174 | Ga0157380_10067813 | 3300014326 | Bacteria | 2874 |
| 175 | Ga0157379_10011031 | 3300014968 | Bacteria | 7876 |
| 176 | Ga0157379_10244055 | 3300014968 | Bacteria | 1629 |
| 177 | Ga0157379_10479461 | 3300014968 | Bacteria | 1151 |
| 178 | Ga0157376_10034127 | 3300014969 | Bacteria | 4105 |
| 179 | Ga0163161_10231693 | 3300017792 | Bacteria | 1433 |
| 180 | Ga0207642_10001323 | 3300025899 | Bacteria | 7656 |
| 181 | Ga0207680_10151671 | 3300025903 | Bacteria | 1545 |
| 182 | Ga0207647_10232235 | 3300025904 | Bacteria | 1061 |
| 183 | Ga0207699_10335926 | 3300025906 | Unclassified | 1063 |
| 184 | Ga0207645_10000145 | 3300025907 | Bacteria | 55543 |
| 185 | Ga0207643_10014125 | 3300025908 | Bacteria | 4336 |
| 186 | Ga0207684_10010542 | 3300025910 | Bacteria | 8125 |
| 187 | Ga0207684_10135852 | 3300025910 | Bacteria | 2112 |
| 188 | Ga0207684_10407326 | 3300025910 | Bacteria | 1169 |
| 189 | Ga0207684_10489390 | 3300025910 | Unclassified | 1055 |
| 190 | Ga0207654_10008013 | 3300025911 | Bacteria | 5325 |
| 191 | Ga0207707_10019193 | 3300025912 | Bacteria | 5966 |
| 192 | Ga0207707_10040209 | 3300025912 | Bacteria | 4084 |
| 193 | Ga0207707_10053560 | 3300025912 | Bacteria | 3512 |
| 194 | Ga0207707_10166988 | 3300025912 | Bacteria | 1923 |
| 195 | Ga0207707_10430404 | 3300025912 | Bacteria | 1130 |
| 196 | Ga0207707_10542950 | 3300025912 | Bacteria | 988 |
| 197 | Ga0207660_10108453 | 3300025917 | Bacteria | 2085 |
| 198 | Ga0207660_10279177 | 3300025917 | Bacteria | 1325 |
| 199 | Ga0207660_10328911 | 3300025917 | Bacteria | 1222 |
| 200 | Ga0207657_10048349 | 3300025919 | Bacteria | 3714 |
| 201 | Ga0207649_10086984 | 3300025920 | Bacteria | 2038 |
| 202 | Ga0207649_10214558 | 3300025920 | Bacteria | 1367 |
| 203 | Ga0207652_10014603 | 3300025921 | Bacteria | 6367 |
| 204 | Ga0207652_10082609 | 3300025921 | Bacteria | 2811 |
| 205 | Ga0207652_10445503 | 3300025921 | Bacteria | 1167 |
| 206 | Ga0207652_10637245 | 3300025921 | Bacteria | 954 |
| 207 | Ga0207646_10006308 | 3300025922 | Bacteria | 12292 |
| 208 | Ga0207646_10018162 | 3300025922 | Bacteria | 6565 |
| 209 | Ga0207646_10027616 | 3300025922 | Bacteria | 5173 |
| 210 | Ga0207646_10094828 | 3300025922 | Bacteria | 2673 |
| 211 | Ga0207646_10352811 | 3300025922 | Bacteria | 1329 |
| 212 | Ga0207646_10376581 | 3300025922 | Bacteria | 1282 |
| 213 | Ga0207681_10070013 | 3300025923 | Unclassified | 2442 |
| 214 | Ga0207694_10011630 | 3300025924 | Bacteria | 6641 |
| 215 | Ga0207650_10415766 | 3300025925 | Unclassified | 1115 |
| 216 | Ga0207659_10109836 | 3300025926 | Bacteria | 2094 |
| 217 | Ga0207659_10168134 | 3300025926 | Bacteria | 1728 |
| 218 | Ga0207659_10664409 | 3300025926 | Bacteria | 891 |
| 219 | Ga0207687_10493269 | 3300025927 | Bacteria | 1021 |
| 220 | Ga0207664_10473158 | 3300025929 | Bacteria | 1120 |
| 221 | Ga0207644_10046746 | 3300025931 | Bacteria | 3085 |
| 222 | Ga0207690_10117926 | 3300025932 | Bacteria | 1923 |
| 223 | Ga0207690_10296174 | 3300025932 | Bacteria | 1264 |
| 224 | Ga0207706_10000146 | 3300025933 | Bacteria | 76821 |
| 225 | Ga0207706_10145791 | 3300025933 | Bacteria | 2082 |
| 226 | Ga0207706_10250761 | 3300025933 | Bacteria | 1546 |
| 227 | Ga0207706_10310757 | 3300025933 | Bacteria | 1372 |
| 228 | Ga0207706_10404970 | 3300025933 | Bacteria | 1182 |
| 229 | Ga0207686_10000067 | 3300025934 | Bacteria | 94339 |
| 230 | Ga0207709_10001445 | 3300025935 | Bacteria | 16588 |
| 231 | Ga0207670_10230892 | 3300025936 | Bacteria | 1421 |
| 232 | Ga0207669_10001177 | 3300025937 | Bacteria | 11105 |
| 233 | Ga0207704_10049442 | 3300025938 | Bacteria | 2530 |
| 234 | Ga0207691_10133322 | 3300025940 | Bacteria | 2193 |
| 235 | Ga0207691_10294965 | 3300025940 | Bacteria | 1394 |
| 236 | Ga0207711_10002609 | 3300025941 | Bacteria | 16005 |
| 237 | Ga0207679_10018948 | 3300025945 | Bacteria | 4618 |
| 238 | Ga0207712_10000079 | 3300025961 | Bacteria | 115164 |
| 239 | Ga0207712_10001918 | 3300025961 | Bacteria | 13678 |
| 240 | Ga0207712_10017489 | 3300025961 | Bacteria | 4657 |
| 241 | Ga0207668_10010985 | 3300025972 | Bacteria | 5491 |
| 242 | Ga0207668_10217969 | 3300025972 | Bacteria | 1530 |
| 243 | Ga0207640_10003844 | 3300025981 | Bacteria | 8103 |
| 244 | Ga0207640_10297825 | 3300025981 | Bacteria | 1275 |
| 245 | Ga0207639_10054591 | 3300026041 | Bacteria | 3054 |
| 246 | Ga0207678_10222635 | 3300026067 | Bacteria | 1615 |
| 247 | Ga0207708_10101362 | 3300026075 | Bacteria | 2229 |
| 248 | Ga0207702_10433271 | 3300026078 | Bacteria | 1273 |
| 249 | Ga0207641_10189724 | 3300026088 | Bacteria | 1888 |
| 250 | Ga0207641_10423877 | 3300026088 | Bacteria | 1282 |
| 251 | Ga0207648_10001390 | 3300026089 | Bacteria | 26643 |
| 252 | Ga0207648_10173691 | 3300026089 | Bacteria | 1905 |
| 253 | Ga0207676_10021625 | 3300026095 | Bacteria | 4721 |
| 254 | Ga0207674_10418525 | 3300026116 | Unclassified | 1295 |
| 255 | Ga0207675_100501359 | 3300026118 | Unclassified | 1208 |
| 256 | Ga0207675_100780150 | 3300026118 | Bacteria | 968 |
| 257 | Ga0207683_10005089 | 3300026121 | Bacteria | 11283 |
| 258 | Ga0207698_10082023 | 3300026142 | Bacteria | 2605 |
| 259 | Ga0209969_1009284 | 3300027360 | Bacteria | 1400 |
| 260 | Ga0209998_10036451 | 3300027717 | Bacteria | 1105 |
| 261 | Ga0209974_10039404 | 3300027876 | Bacteria | 1572 |
| 262 | Ga0268266_10108349 | 3300028379 | Bacteria | 2458 |
| 263 | Ga0268266_10507500 | 3300028379 | Bacteria | 1152 |
| 264 | Ga0268265_10123590 | 3300028380 | Unclassified | 2137 |
| 265 | Ga0268264_10028037 | 3300028381 | Bacteria | 4605 |
| 266 | Ga0268264_10125498 | 3300028381 | Unclassified | 2268 |
| 267 | Ga0265338_10001746 | 3300028800 | Bacteria | 34367 |
| 268 | Ga0307408_100004762 | 3300031548 | Bacteria | 9148 |
| 269 | Ga0307408_100048901 | 3300031548 | Bacteria | 3035 |
| 270 | Ga0307408_100087641 | 3300031548 | Bacteria | 2343 |
| 271 | Ga0307408_100159922 | 3300031548 | Bacteria | 1788 |
| 272 | Ga0307408_100166047 | 3300031548 | Unclassified | 1758 |
| 273 | Ga0307408_100284006 | 3300031548 | Bacteria | 1379 |
| 274 | Ga0307408_100304151 | 3300031548 | Bacteria | 1337 |
| 275 | Ga0307405_10063670 | 3300031731 | Unclassified | 2340 |
| 276 | Ga0307405_10101985 | 3300031731 | Bacteria | 1926 |
| 277 | Ga0307405_10250177 | 3300031731 | Unclassified | 1318 |
| 278 | Ga0307413_10003010 | 3300031824 | Bacteria | 6996 |
| 279 | Ga0307413_10003985 | 3300031824 | Bacteria | 6340 |
| 280 | Ga0307413_10052635 | 3300031824 | Bacteria | 2460 |
| 281 | Ga0307413_10058187 | 3300031824 | Archaea | 2368 |
| 282 | Ga0307410_10001996 | 3300031852 | Bacteria | 9612 |
| 283 | Ga0307410_10024856 | 3300031852 | Bacteria | 3748 |
| 284 | Ga0307410_10056168 | 3300031852 | Bacteria | 2676 |
| 285 | Ga0307410_10063680 | 3300031852 | Bacteria | 2530 |
| 286 | Ga0307410_10067745 | 3300031852 | Bacteria | 2463 |
| 287 | Ga0307410_10112921 | 3300031852 | Bacteria | 1968 |
| 288 | Ga0307410_10167042 | 3300031852 | Unclassified | 1654 |
| 289 | Ga0307406_10047823 | 3300031901 | Bacteria | 2698 |
| 290 | Ga0307406_10053445 | 3300031901 | Unclassified | 2573 |
| 291 | Ga0307406_10064837 | 3300031901 | Bacteria | 2372 |
| 292 | Ga0307406_10144876 | 3300031901 | Bacteria | 1687 |
| 293 | Ga0307407_10017198 | 3300031903 | Bacteria | 3621 |
| 294 | Ga0307407_10021217 | 3300031903 | Bacteria | 3345 |
| 295 | Ga0307407_10023656 | 3300031903 | Bacteria | 3208 |
| 296 | Ga0307407_10034610 | 3300031903 | Bacteria | 2767 |
| 297 | Ga0307407_10193364 | 3300031903 | Bacteria | 1358 |
| 298 | Ga0307407_10259623 | 3300031903 | Bacteria | 1194 |
| 299 | Ga0307412_10020347 | 3300031911 | Bacteria | 4037 |
| 300 | Ga0307412_10586077 | 3300031911 | Bacteria | 942 |
| 301 | Ga0307409_100000308 | 3300031995 | Bacteria | 19988 |
| 302 | Ga0307409_100006784 | 3300031995 | Bacteria | 6773 |
| 303 | Ga0307409_100061431 | 3300031995 | Bacteria | 2936 |
| 304 | Ga0307409_100105924 | 3300031995 | Unclassified | 2345 |
| 305 | Ga0307409_100112811 | 3300031995 | Bacteria | 2283 |
| 306 | Ga0307409_100178521 | 3300031995 | Bacteria | 1877 |
| 307 | Ga0307409_100222747 | 3300031995 | Bacteria | 1704 |
| 308 | Ga0307409_100239768 | 3300031995 | Unclassified | 1650 |
| 309 | Ga0307409_100451439 | 3300031995 | Bacteria | 1241 |
| 310 | Ga0307409_100673217 | 3300031995 | Unclassified | 1031 |
| 311 | Ga0307416_100002827 | 3300032002 | Bacteria | 10095 |
| 312 | Ga0307416_100005003 | 3300032002 | Bacteria | 8081 |
| 313 | Ga0307416_100011070 | 3300032002 | Bacteria | 5995 |
| 314 | Ga0307416_100030262 | 3300032002 | Bacteria | 4059 |
| 315 | Ga0307416_100050239 | 3300032002 | Bacteria | 3323 |
| 316 | Ga0307416_100075129 | 3300032002 | Bacteria | 2827 |
| 317 | Ga0307416_100159447 | 3300032002 | Bacteria | 2083 |
| 318 | Ga0307416_100201144 | 3300032002 | Bacteria | 1890 |
| 319 | Ga0307416_100278133 | 3300032002 | Bacteria | 1648 |
| 320 | Ga0307416_100297187 | 3300032002 | Bacteria | 1603 |
| 321 | Ga0307416_100586677 | 3300032002 | Bacteria | 1193 |
| 322 | Ga0307416_100899816 | 3300032002 | Bacteria | 985 |
| 323 | Ga0307416_100960228 | 3300032002 | Bacteria | 957 |
| 324 | Ga0307414_10022522 | 3300032004 | Bacteria | 3976 |
| 325 | Ga0307414_10081152 | 3300032004 | Bacteria | 2374 |
| 326 | Ga0307414_10088499 | 3300032004 | Bacteria | 2292 |
| 327 | Ga0307414_10098608 | 3300032004 | Bacteria | 2193 |
| 328 | Ga0307414_10243491 | 3300032004 | Bacteria | 1490 |
| 329 | Ga0307411_10002519 | 3300032005 | Bacteria | 8151 |
| 330 | Ga0307411_10033227 | 3300032005 | Bacteria | 3198 |
| 331 | Ga0307411_10045926 | 3300032005 | Bacteria | 2812 |
| 332 | Ga0307411_10091076 | 3300032005 | Bacteria | 2129 |
| 333 | Ga0307411_10219910 | 3300032005 | Bacteria | 1473 |
| 334 | Ga0307415_100000203 | 3300032126 | Bacteria | 26255 |
| 335 | Ga0307415_100001513 | 3300032126 | Bacteria | 11158 |
| 336 | Ga0307415_100292266 | 3300032126 | Bacteria | 1346 |
| 337 | Ga0307415_100365496 | 3300032126 | Bacteria | 1220 |
| 338 | Ga0373929_0021808 | 3300035085 | Bacteria | 1303 |
| 339 | Ga0373934_0000216 | 3300035086 | Bacteria | 21032 |
| 340 | Ga0373940_0016091 | 3300035088 | Bacteria | 1849 |
| 341 | Ga0373940_0032565 | 3300035088 | Bacteria | 1398 |
| 342 | Ga0373949_0021123 | 3300035090 | Bacteria | 1495 |
| 343 | Ga0373923_0008948 | 3300035111 | Bacteria | 3593 |
| 344 | Ga0373945_0029975 | 3300035116 | Bacteria | 1915 |
| 345 | Ga0373956_0000127 | 3300035119 | Bacteria | 26808 |
| 346 | Ga0373957_0014563 | 3300035120 | Bacteria | 2691 |
| 347 | Ga0373955_0004911 | 3300035172 | Bacteria | 5966 |
| 348 | Ga0316574_0015633 | 3300035398 | Bacteria | 4406 |
| 349 | Ga0373924_0121700 | 3300035410 | Bacteria | 1132 |
| 350 | Ga0373931_0085384 | 3300035691 | Bacteria | 1750 |
| 351 | Ga0373935_0071348 | 3300035692 | Bacteria | 2241 |
| 352 | Ga0373933_0000353 | 3300035724 | Bacteria | 29440 |
| 353 | Ga0373937_0000195 | 3300036401 | Bacteria | 59262 |
| 354 | Ga0373937_0152366 | 3300036401 | Bacteria | 2166 |
| 355 | Ga0395901_0113783 | 3300038443 | Bacteria | 2842 |
| 356 | Ga0242420_000375 | 3300038996 | Bacteria | 4931 |
| 357 | Ga0242420_014811 | 3300038996 | Bacteria | 1342 |
| 358 | Ga0242420_015847 | 3300038996 | Bacteria | 1307 |
| 359 | Ga0242420_052098 | 3300038996 | Bacteria | 802 |
| 360 | Ga0439439_0013110 | 3300041406 | Bacteria | 2008 |
| 361 | Ga0439453_0054999 | 3300041408 | Bacteria | 812 |
| 362 | Ga0451807_0948721 | 3300041486 | Bacteria | 1142 |
| 363 | Ga0451849_1163722 | 3300041505 | Bacteria | 1764 |
| 364 | Ga0439443_032612 | 3300042003 | Bacteria | 864 |
| 365 | Ga0439448_0057315 | 3300042005 | Unclassified | 1284 |
| 366 | Ga0450908_031118 | 3300042184 | Bacteria | 927 |
| 367 | Ga0451577_0525891 | 3300042876 | Bacteria | 1074 |
| 368 | Ga0466972_0008333 | 3300044658 | Bacteria | 5196 |
| 369 | Ga0453683_0102758 | 3300044673 | Bacteria | 1795 |
| 370 | Ga0453683_0269610 | 3300044673 | Bacteria | 1086 |
| 371 | Ga0466965_0000955 | 3300044683 | Bacteria | 11152 |
| 372 | Ga0466964_0093155 | 3300044706 | Bacteria | 1315 |
| 373 | Ga0453684_0855203 | 3300044712 | Bacteria | 977 |
| 374 | Ga0466968_0002692 | 3300044735 | Bacteria | 6549 |
| 375 | Ga0451576_0034935 | 3300045051 | Bacteria | 5335 |
| 376 | Ga0451576_0133286 | 3300045051 | Bacteria | 2590 |
| 377 | Ga0451576_0611109 | 3300045051 | Bacteria | 1146 |
| 378 | Ga0451576_1098540 | 3300045051 | Bacteria | 832 |
| 379 | Ga0495592_0003659 | 3300046454 | Bacteria | 11071 |
| 380 | Ga0495603_0058591 | 3300046455 | Bacteria | 2277 |
| 381 | Ga0495603_0108964 | 3300046455 | Bacteria | 1616 |
| 382 | Ga0495641_0107243 | 3300046461 | Bacteria | 1246 |
| 383 | Ga0495651_0000050 | 3300046462 | Bacteria | 87816 |
| 384 | Ga0495653_0000134 | 3300046463 | Bacteria | 61770 |
| 385 | Ga0495582_0021166 | 3300046473 | Bacteria | 3561 |
| 386 | Ga0495639_0011198 | 3300046475 | Bacteria | 3864 |
| 387 | Ga0495594_0026408 | 3300046499 | Bacteria | 3124 |
| 388 | Ga0495608_0000381 | 3300046511 | Bacteria | 30883 |
| 389 | Ga0495618_0060276 | 3300046514 | Bacteria | 2406 |
| 390 | Ga0495628_0001309 | 3300046516 | Bacteria | 22847 |
| 391 | Ga0495628_0233857 | 3300046516 | Bacteria | 1377 |
| 392 | Ga0495630_0004360 | 3300046517 | Bacteria | 9937 |
| 393 | Ga0495630_0023250 | 3300046517 | Bacteria | 4581 |
| 394 | Ga0495643_0000104 | 3300046522 | Bacteria | 140570 |
| 395 | Ga0495666_0002485 | 3300046526 | Bacteria | 9162 |
| 396 | Ga0495652_0003898 | 3300046529 | Bacteria | 14519 |
| 397 | Ga0495640_0058174 | 3300046533 | Bacteria | 2637 |
| 398 | Ga0495586_0007463 | 3300046535 | Bacteria | 5834 |
| 399 | Ga0495587_0000114 | 3300046536 | Bacteria | 61671 |
| 400 | Ga0495645_0000065 | 3300046543 | Bacteria | 73256 |
| 401 | Ga0495645_0063735 | 3300046543 | Bacteria | 2668 |
| 402 | Ga0495622_0092018 | 3300046557 | Bacteria | 1393 |
| 403 | Ga0495667_0000316 | 3300046559 | Bacteria | 30681 |
| 404 | Ga0495667_0156542 | 3300046559 | Bacteria | 1466 |
| 405 | Ga0495634_0010164 | 3300046642 | Bacteria | 6906 |
| 406 | Ga0495635_0000103 | 3300046663 | Bacteria | 50496 |
| 407 | Ga0495657_0001662 | 3300046675 | Bacteria | 19126 |
| 408 | Ga0495657_0235271 | 3300046675 | Bacteria | 1107 |
| 409 | Ga0495599_0005532 | 3300046678 | Bacteria | 7571 |
| 410 | Ga0495623_0000086 | 3300046679 | Bacteria | 55086 |
| 411 | Ga0495646_0091304 | 3300046680 | Bacteria | 1758 |
| 412 | Ga0495647_0031139 | 3300046681 | Bacteria | 1983 |
| 413 | Ga0495658_0009713 | 3300046683 | Bacteria | 4798 |
| 414 | Ga0495669_0039435 | 3300046684 | Bacteria | 2092 |
| 415 | Ga0495613_0067652 | 3300046689 | Bacteria | 2607 |
| 416 | Ga0495600_0003319 | 3300046809 | Bacteria | 9447 |
| 417 | Ga0495604_0001195 | 3300047317 | Bacteria | 21435 |
| 418 | Ga0495636_0021340 | 3300047318 | Unclassified | 2615 |
| 419 | Ga0495674_0000339 | 3300047319 | Bacteria | 41326 |
| 420 | Ga0495674_0023282 | 3300047319 | Bacteria | 5711 |
| 421 | Ga0495674_0149410 | 3300047319 | Bacteria | 1960 |
| 422 | Ga0495680_0016313 | 3300047322 | Bacteria | 6387 |
| 423 | Ga0495680_0021286 | 3300047322 | Bacteria | 5431 |
| 424 | Ga0495684_0000141 | 3300047471 | Bacteria | 53032 |
| 425 | Ga0495602_0003470 | 3300048088 | Bacteria | 16312 |
| 426 | Ga0496100_0482066 | 3300048903 | Bacteria | 954 |
| 427 | Ga0496101_0009147 | 3300048904 | Bacteria | 6503 |
| 428 | Ga0496102_0015699 | 3300048905 | Bacteria | 6598 |
| 429 | Ga0496102_0229646 | 3300048905 | Bacteria | 1750 |
| 430 | Ga0496102_0269122 | 3300048905 | Bacteria | 1606 |
| 431 | Ga0496102_0506620 | 3300048905 | Bacteria | 1129 |
| 432 | Ga0496103_0016315 | 3300048906 | Bacteria | 4432 |
| 433 | Ga0496103_0135937 | 3300048906 | Bacteria | 1571 |
| 434 | Ga0496103_0258246 | 3300048906 | Bacteria | 1121 |
| 435 | Ga0496104_0010276 | 3300048907 | Bacteria | 8359 |
| 436 | Ga0496104_0041712 | 3300048907 | Bacteria | 4304 |
| 437 | Ga0496105_0069739 | 3300048908 | Bacteria | 2905 |
| 438 | Ga0496105_0132732 | 3300048908 | Bacteria | 2052 |
| 439 | Ga0496106_0022907 | 3300048909 | Bacteria | 4639 |
| 440 | Ga0496106_0042473 | 3300048909 | Unclassified | 3410 |
| 441 | Ga0496106_0125496 | 3300048909 | Bacteria | 2009 |
| 442 | Ga0496106_0250541 | 3300048909 | Bacteria | 1416 |
| 443 | Ga0496107_0073904 | 3300048910 | Bacteria | 2480 |
| 444 | Ga0496107_0204239 | 3300048910 | Bacteria | 1469 |
| 445 | Ga0496108_0001782 | 3300048911 | Bacteria | 17164 |
| 446 | Ga0496108_0002171 | 3300048911 | Bacteria | 15736 |
| 447 | Ga0496108_0003640 | 3300048911 | Bacteria | 12354 |
| 448 | Ga0496108_0065357 | 3300048911 | Bacteria | 3066 |
| 449 | Ga0496108_0313513 | 3300048911 | Bacteria | 1367 |
| 450 | Ga0496109_0001037 | 3300048912 | Bacteria | 22996 |
| 451 | Ga0496109_0007936 | 3300048912 | Bacteria | 8995 |
| 452 | Ga0496109_0099260 | 3300048912 | Bacteria | 2700 |
| 453 | Ga0496109_0106569 | 3300048912 | Bacteria | 2603 |
| 454 | Ga0496109_0204457 | 3300048912 | Bacteria | 1857 |
| 455 | Ga0496110_0016427 | 3300048913 | Bacteria | 6180 |
| 456 | Ga0496110_0025168 | 3300048913 | Bacteria | 5083 |
| 457 | Ga0496110_0089740 | 3300048913 | Bacteria | 2748 |
| 458 | Ga0496111_0015616 | 3300048914 | Bacteria | 5217 |
| 459 | Ga0496111_0020367 | 3300048914 | Bacteria | 4617 |
| 460 | Ga0496111_0035368 | 3300048914 | Bacteria | 3569 |
| 461 | Ga0496112_0000129 | 3300048915 | Bacteria | 47173 |
| 462 | Ga0496112_0026745 | 3300048915 | Bacteria | 5558 |
| 463 | Ga0496112_0047190 | 3300048915 | Bacteria | 4225 |
| 464 | Ga0496112_0148982 | 3300048915 | Bacteria | 2307 |
| 465 | Ga0496112_0720710 | 3300048915 | Bacteria | 925 |
| 466 | Ga0496113_0000062 | 3300048916 | Bacteria | 46801 |
| 467 | Ga0496113_0082719 | 3300048916 | Bacteria | 2462 |
| 468 | Ga0496114_0191002 | 3300048917 | Bacteria | 1792 |
| 469 | Ga0496114_0288412 | 3300048917 | Bacteria | 1448 |
| 470 | Ga0496115_0186306 | 3300048918 | Bacteria | 1715 |
| 471 | Ga0501298_019236 | 3300049521 | Bacteria | 1264 |
| 472 | Ga0501034_0008504 | 3300049571 | Bacteria | 10838 |
| 473 | Ga0501034_0063733 | 3300049571 | Bacteria | 3700 |
| 474 | Ga0501039_0098097 | 3300049575 | Bacteria | 2286 |
| 475 | Ga0501040_0118525 | 3300049576 | Bacteria | 1856 |
| 476 | Ga0501041_0367092 | 3300049577 | Bacteria | 910 |
| 477 | Ga0501042_0069774 | 3300049578 | Bacteria | 2514 |
| 478 | Ga0501042_0130499 | 3300049578 | Bacteria | 1811 |
| 479 | Ga0501042_0249194 | 3300049578 | Bacteria | 1281 |
| 480 | Ga0501046_0139275 | 3300049580 | Bacteria | 1837 |
| 481 | Ga0501047_0002324 | 3300049581 | Bacteria | 18172 |
| 482 | Ga0501047_0698113 | 3300049581 | Bacteria | 832 |
| 483 | Ga0501047_0724022 | 3300049581 | Bacteria | 812 |
| 484 | Ga0501048_0071460 | 3300049582 | Bacteria | 2450 |
| 485 | Ga0501067_0002448 | 3300049583 | Bacteria | 10258 |
| 486 | Ga0501067_0013916 | 3300049583 | Bacteria | 4455 |
| 487 | Ga0501067_0036646 | 3300049583 | Bacteria | 2723 |
| 488 | Ga0501067_0042648 | 3300049583 | Bacteria | 2519 |
| 489 | Ga0501068_0000311 | 3300049584 | Bacteria | 24353 |
| 490 | Ga0501068_0006064 | 3300049584 | Bacteria | 6642 |
| 491 | Ga0501068_0153822 | 3300049584 | Bacteria | 1447 |
| 492 | Ga0501069_0001105 | 3300049585 | Bacteria | 13017 |
| 493 | Ga0501069_0001912 | 3300049585 | Bacteria | 10402 |
| 494 | Ga0501070_0004182 | 3300049586 | Bacteria | 12426 |
| 495 | Ga0501070_0018009 | 3300049586 | Bacteria | 5926 |
| 496 | Ga0501070_0060202 | 3300049586 | Bacteria | 3148 |
| 497 | Ga0501070_0424747 | 3300049586 | Bacteria | 1073 |
| 498 | Ga0501071_0002649 | 3300049587 | Bacteria | 10959 |
| 499 | Ga0501071_0008604 | 3300049587 | Bacteria | 6745 |
| 500 | Ga0501071_0038976 | 3300049587 | Bacteria | 3398 |
| 501 | Ga0501072_0017501 | 3300049588 | Bacteria | 5508 |
| 502 | Ga0501072_0033860 | 3300049588 | Bacteria | 4003 |
| 503 | Ga0501072_0039701 | 3300049588 | Bacteria | 3695 |
| 504 | Ga0501072_0058662 | 3300049588 | Bacteria | 3034 |
| 505 | Ga0501072_0115737 | 3300049588 | Bacteria | 2135 |
| 506 | Ga0501073_0015044 | 3300049589 | Bacteria | 5612 |
| 507 | Ga0501074_0113482 | 3300049590 | Bacteria | 1939 |
| 508 | Ga0501074_0136211 | 3300049590 | Bacteria | 1756 |
| 509 | Ga0501075_0073623 | 3300049591 | Bacteria | 2583 |
| 510 | Ga0501075_0175770 | 3300049591 | Bacteria | 1634 |
| 511 | Ga0501076_0011216 | 3300049592 | Bacteria | 6671 |
| 512 | Ga0501076_0178823 | 3300049592 | Bacteria | 1729 |
| 513 | Ga0501076_0190694 | 3300049592 | Bacteria | 1672 |
| 514 | Ga0501076_0498352 | 3300049592 | Bacteria | 1004 |
| 515 | Ga0501076_0581978 | 3300049592 | Bacteria | 923 |
| 516 | Ga0501077_0033274 | 3300049593 | Bacteria | 3281 |
| 517 | Ga0501209_002545 | 3300049656 | Bacteria | 2833 |
| 518 | Ga0501243_012653 | 3300049675 | Bacteria | 1334 |
| 519 | Ga0501247_014704 | 3300049677 | Bacteria | 972 |
| 520 | Ga0501249_012149 | 3300049679 | Bacteria | 1817 |
| 521 | Ga0501257_006396 | 3300049686 | Bacteria | 2614 |
| 522 | Ga0501257_013681 | 3300049686 | Bacteria | 1861 |
| 523 | Ga0501079_0009697 | 3300049741 | Bacteria | 7300 |
| 524 | Ga0501079_0054981 | 3300049741 | Bacteria | 3071 |
| 525 | Ga0501079_0065143 | 3300049741 | Bacteria | 2811 |
| 526 | Ga0501079_0103136 | 3300049741 | Bacteria | 2212 |
| 527 | Ga0501079_0127696 | 3300049741 | Bacteria | 1978 |
| 528 | Ga0501080_0002229 | 3300049742 | Bacteria | 16855 |
| 529 | Ga0501080_0002645 | 3300049742 | Bacteria | 15668 |
| 530 | Ga0501080_0010834 | 3300049742 | Bacteria | 8342 |
| 531 | Ga0501080_0205454 | 3300049742 | Bacteria | 1807 |
| 532 | Ga0501080_0500691 | 3300049742 | Bacteria | 1086 |
| 533 | Ga0501081_0220150 | 3300049743 | Bacteria | 1380 |
| 534 | Ga0501083_0001221 | 3300049744 | Bacteria | 17390 |
| 535 | Ga0501083_0002285 | 3300049744 | Bacteria | 13120 |
| 536 | Ga0501262_004576 | 3300049759 | Bacteria | 1608 |
| 537 | Ga0501273_002720 | 3300049770 | Bacteria | 1821 |
| 538 | Ga0501045_0017170 | 3300049824 | Bacteria | 5138 |
| 539 | Ga0501045_0078665 | 3300049824 | Bacteria | 2431 |
| 540 | Ga0501045_0089452 | 3300049824 | Bacteria | 2274 |
| 541 | Ga0501045_0126992 | 3300049824 | Bacteria | 1895 |
| 542 | Ga0501212_017063 | 3300049851 | Bacteria | 1096 |
| 543 | nmdc:mga05p37_17760_c2 | 3300050507 | Bacteria | 3596 |
| 544 | nmdc:mga05p37_273526_c1 | 3300050507 | Bacteria | 2017 |
| 545 | nmdc:mga05p37_70267_c1 | 3300050507 | Unclassified | 4307 |
| 546 | nmdc:mga09592_102541_c1 | 3300050508 | Bacteria | 2451 |
| 547 | nmdc:mga09592_1219_c1 | 3300050508 | Bacteria | 20601 |
| 548 | nmdc:mga0qj67_129765_c1 | 3300050509 | Bacteria | 2041 |
| 549 | nmdc:mga06r32_193097_c1 | 3300050510 | Bacteria | 2023 |
| 550 | nmdc:mga06r32_63445_c1 | 3300050510 | Bacteria | 3561 |
| 551 | nmdc:mga0n895_467454_c1 | 3300050512 | Bacteria | 1272 |
| 552 | nmdc:mga0n895_470891_c1 | 3300050512 | Unclassified | 1267 |
| 553 | nmdc:mga08x19_28405_c1 | 3300050514 | Bacteria | 3503 |
| 554 | Ga0495601_0009524 | 3300053077 | Bacteria | 5750 |
| 555 | Ga0495612_0005188 | 3300053078 | Bacteria | 5384 |
| 556 | Ga0495595_0010877 | 3300053084 | Bacteria | 3795 |
| 557 | Ga0501084_0001049 | 3300054114 | Bacteria | 21463 |
| 558 | Ga0501084_0022098 | 3300054114 | Bacteria | 5306 |
| 559 | Ga0501084_0032371 | 3300054114 | Bacteria | 4374 |
| 560 | Ga0501084_0056519 | 3300054114 | Bacteria | 3283 |
| 561 | Ga0501084_0084552 | 3300054114 | Bacteria | 2663 |
| 562 | Ga0501084_0323761 | 3300054114 | Bacteria | 1302 |
| 563 | Ga0501084_0858725 | 3300054114 | Bacteria | 764 |
| 564 | Ga0590071_000553 | 3300059421 | Bacteria | 10824 |
| 565 | Ga0590071_013855 | 3300059421 | Bacteria | 1890 |
| 566 | Ga0590071_016339 | 3300059421 | Bacteria | 1741 |
| 567 | Ga0590074_018326 | 3300059423 | Unclassified | 1197 |
| 568 | Ga0590074_030196 | 3300059423 | Bacteria | 955 |
| 569 | Ga0590075_019466 | 3300059424 | Bacteria | 1685 |
| 570 | Ga0590075_052075 | 3300059424 | Bacteria | 1050 |
| 571 | Ga0501082_0019260 | 3300060353 | Bacteria | 5882 |
| 572 | Ga0501082_0108395 | 3300060353 | Bacteria | 2403 |
| 573 | Ga0501082_0132652 | 3300060353 | Bacteria | 2161 |
| 574 | Ga0501082_0147609 | 3300060353 | Bacteria | 2042 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025932 | Ga0207690_10296174 | Ga0207690_102961741 | 225 |
| 2 | 3300049686 | Ga0501257_006396 | Ga0501257_006396_1096_1836 | 230 |
| 3 | 3300035398 | Ga0316574_0015633 | Ga0316574_0015633_501_1232 | 231 |
| 4 | 3300005458 | Ga0070681_10147783 | Ga0070681_101477832 | 232 |
| 5 | 3300005530 | Ga0070679_100115444 | Ga0070679_1001154443 | 232 |
| 6 | 3300005564 | Ga0070664_100083922 | Ga0070664_1000839222 | 232 |
| 7 | 3300025912 | Ga0207707_10053560 | Ga0207707_100535602 | 232 |
| 8 | 3300025917 | Ga0207660_10108453 | Ga0207660_101084531 | 232 |
| 9 | 3300025920 | Ga0207649_10086984 | Ga0207649_100869843 | 232 |
| 10 | 3300025921 | Ga0207652_10082609 | Ga0207652_100826092 | 232 |
| 11 | 3300031548 | Ga0307408_100087641 | Ga0307408_1000876411 | 232 |
| 12 | 3300049581 | Ga0501047_0002324 | Ga0501047_0002324_16809_17510 | 232 |
| 13 | 3300031548 | Ga0307408_100304151 | Ga0307408_1003041512 | 233 |
| 14 | 3300031731 | Ga0307405_10063670 | Ga0307405_100636703 | 233 |
| 15 | 3300031824 | Ga0307413_10003010 | Ga0307413_100030102 | 233 |
| 16 | 3300031852 | Ga0307410_10001996 | Ga0307410_100019962 | 233 |
| 17 | 3300031995 | Ga0307409_100451439 | Ga0307409_1004514392 | 233 |
| 18 | 3300032002 | Ga0307416_100075129 | Ga0307416_1000751294 | 233 |
| 19 | 3300032002 | Ga0307416_100297187 | Ga0307416_1002971872 | 233 |
| 20 | 3300044658 | Ga0466972_0008333 | Ga0466972_0008333_2746_3498 | 233 |
| 21 | 3300044683 | Ga0466965_0000955 | Ga0466965_0000955_3788_4492 | 233 |
| 22 | 3300044706 | Ga0466964_0093155 | Ga0466964_0093155_392_1147 | 233 |
| 23 | 3300044735 | Ga0466968_0002692 | Ga0466968_0002692_2046_2750 | 233 |
| 24 | 3300005458 | Ga0070681_10121484 | Ga0070681_101214842 | 234 |
| 25 | 3300045051 | Ga0451576_0034935 | Ga0451576_0034935_1675_2379 | 234 |
| 26 | 3300047318 | Ga0495636_0021340 | Ga0495636_0021340_337_1041 | 234 |
| 27 | 3300005617 | Ga0068859_100246529 | Ga0068859_1002465292 | 235 |
| 28 | 3300006844 | Ga0075428_100030083 | Ga0075428_1000300836 | 235 |
| 29 | 3300006880 | Ga0075429_100012245 | Ga0075429_1000122454 | 235 |
| 30 | 3300006881 | Ga0068865_100549996 | Ga0068865_1005499962 | 235 |
| 31 | 3300006931 | Ga0097620_100246525 | Ga0097620_1002465252 | 235 |
| 32 | 3300009147 | Ga0114129_10001639 | Ga0114129_1000163913 | 235 |
| 33 | 3300025936 | Ga0207670_10230892 | Ga0207670_102308922 | 235 |
| 34 | 3300026078 | Ga0207702_10433271 | Ga0207702_104332712 | 235 |
| 35 | 3300035116 | Ga0373945_0029975 | Ga0373945_0029975_187_897 | 235 |
| 36 | 3300035691 | Ga0373931_0085384 | Ga0373931_0085384_228_935 | 235 |
| 37 | 3300042005 | Ga0439448_0057315 | Ga0439448_0057315_539_1246 | 235 |
| 38 | 3300045051 | Ga0451576_1098540 | Ga0451576_1098540_41_754 | 235 |
| 39 | 3300048904 | Ga0496101_0009147 | Ga0496101_0009147_5399_6106 | 235 |
| 40 | 3300048905 | Ga0496102_0015699 | Ga0496102_0015699_2606_3313 | 235 |
| 41 | 3300048906 | Ga0496103_0016315 | Ga0496103_0016315_1339_2046 | 235 |
| 42 | 3300048907 | Ga0496104_0041712 | Ga0496104_0041712_2490_3197 | 235 |
| 43 | 3300048908 | Ga0496105_0132732 | Ga0496105_0132732_1162_1869 | 235 |
| 44 | 3300048910 | Ga0496107_0073904 | Ga0496107_0073904_1413_2120 | 235 |
| 45 | 3300048911 | Ga0496108_0065357 | Ga0496108_0065357_1129_1836 | 235 |
| 46 | 3300048912 | Ga0496109_0106569 | Ga0496109_0106569_59_766 | 235 |
| 47 | 3300048913 | Ga0496110_0025168 | Ga0496110_0025168_632_1339 | 235 |
| 48 | 3300048914 | Ga0496111_0035368 | Ga0496111_0035368_1606_2313 | 235 |
| 49 | 3300048915 | Ga0496112_0026745 | Ga0496112_0026745_2044_2751 | 235 |
| 50 | 3300048916 | Ga0496113_0082719 | Ga0496113_0082719_477_1184 | 235 |
| 51 | 3300048917 | Ga0496114_0288412 | Ga0496114_0288412_615_1322 | 235 |
| 52 | 3300048918 | Ga0496115_0186306 | Ga0496115_0186306_820_1527 | 235 |
| 53 | 3300049584 | Ga0501068_0153822 | Ga0501068_0153822_430_1137 | 235 |
| 54 | 3300050507 | nmdc:mga05p37_70267_c1 | nmdc:mga05p37_70267_c1_3236_3943 | 235 |
| 55 | 3300050508 | nmdc:mga09592_102541_c1 | nmdc:mga09592_102541_c1_1076_1783 | 235 |
| 56 | 3300050514 | nmdc:mga08x19_28405_c1 | nmdc:mga08x19_28405_c1_1433_2140 | 235 |
| 57 | 3300005467 | Ga0070706_100598744 | Ga0070706_1005987441 | 237 |
| 58 | 3300005471 | Ga0070698_100444744 | Ga0070698_1004447441 | 237 |
| 59 | 3300014968 | Ga0157379_10244055 | Ga0157379_102440552 | 237 |
| 60 | 3300025910 | Ga0207684_10010542 | Ga0207684_100105424 | 237 |
| 61 | 3300025910 | Ga0207684_10489390 | Ga0207684_104893901 | 237 |
| 62 | 3300005347 | Ga0070668_100541495 | Ga0070668_1005414951 | 238 |
| 63 | 3300005354 | Ga0070675_100087569 | Ga0070675_1000875692 | 238 |
| 64 | 3300005468 | Ga0070707_100502881 | Ga0070707_1005028811 | 238 |
| 65 | 3300005471 | Ga0070698_100012758 | Ga0070698_1000127587 | 238 |
| 66 | 3300005544 | Ga0070686_100000372 | Ga0070686_1000003728 | 238 |
| 67 | 3300009094 | Ga0111539_10294262 | Ga0111539_102942622 | 238 |
| 68 | 3300009147 | Ga0114129_10136860 | Ga0114129_101368602 | 238 |
| 69 | 3300025910 | Ga0207684_10135852 | Ga0207684_101358522 | 238 |
| 70 | 3300025921 | Ga0207652_10637245 | Ga0207652_106372452 | 238 |
| 71 | 3300025926 | Ga0207659_10109836 | Ga0207659_101098362 | 238 |
| 72 | 3300025933 | Ga0207706_10310757 | Ga0207706_103107572 | 238 |
| 73 | 3300032002 | Ga0307416_100586677 | Ga0307416_1005866772 | 238 |
| 74 | 3300046522 | Ga0495643_0000104 | Ga0495643_0000104_77210_77971 | 238 |
| 75 | 3300046684 | Ga0495669_0039435 | Ga0495669_0039435_614_1333 | 238 |
| 76 | 3300049581 | Ga0501047_0724022 | Ga0501047_0724022_39_770 | 238 |
| 77 | 3300050512 | nmdc:mga0n895_467454_c1 | nmdc:mga0n895_467454_c1_215_931 | 238 |
| 78 | 2162886012 | MBSR1b_contig_7531960 | MBSR1b_0457.00003120 | 239 |
| 79 | 3300003322 | rootL2_10210367 | rootL2_102103672 | 239 |
| 80 | 3300005293 | Ga0065715_10173894 | Ga0065715_101738942 | 239 |
| 81 | 3300005293 | Ga0065715_10394049 | Ga0065715_103940491 | 239 |
| 82 | 3300005328 | Ga0070676_10001926 | Ga0070676_100019264 | 239 |
| 83 | 3300005330 | Ga0070690_100069907 | Ga0070690_1000699072 | 239 |
| 84 | 3300005331 | Ga0070670_100494467 | Ga0070670_1004944671 | 239 |
| 85 | 3300005334 | Ga0068869_100101962 | Ga0068869_1001019622 | 239 |
| 86 | 3300005335 | Ga0070666_10166720 | Ga0070666_101667202 | 239 |
| 87 | 3300005336 | Ga0070680_100010891 | Ga0070680_1000108914 | 239 |
| 88 | 3300005336 | Ga0070680_100244207 | Ga0070680_1002442071 | 239 |
| 89 | 3300005336 | Ga0070680_100426969 | Ga0070680_1004269691 | 239 |
| 90 | 3300005337 | Ga0070682_100116414 | Ga0070682_1001164142 | 239 |
| 91 | 3300005339 | Ga0070660_100084929 | Ga0070660_1000849292 | 239 |
| 92 | 3300005339 | Ga0070660_100118165 | Ga0070660_1001181652 | 239 |
| 93 | 3300005340 | Ga0070689_100599267 | Ga0070689_1005992671 | 239 |
| 94 | 3300005344 | Ga0070661_100006568 | Ga0070661_1000065682 | 239 |
| 95 | 3300005345 | Ga0070692_10129165 | Ga0070692_101291652 | 239 |
| 96 | 3300005347 | Ga0070668_100016539 | Ga0070668_1000165394 | 239 |
| 97 | 3300005353 | Ga0070669_100317337 | Ga0070669_1003173372 | 239 |
| 98 | 3300005354 | Ga0070675_100153607 | Ga0070675_1001536072 | 239 |
| 99 | 3300005354 | Ga0070675_100280529 | Ga0070675_1002805292 | 239 |
| 100 | 3300005356 | Ga0070674_100000378 | Ga0070674_10000037819 | 239 |
| 101 | 3300005365 | Ga0070688_100487905 | Ga0070688_1004879051 | 239 |
| 102 | 3300005366 | Ga0070659_100307617 | Ga0070659_1003076172 | 239 |
| 103 | 3300005367 | Ga0070667_100153437 | Ga0070667_1001534372 | 239 |
| 104 | 3300005406 | Ga0070703_10078876 | Ga0070703_100788762 | 239 |
| 105 | 3300005435 | Ga0070714_100016523 | Ga0070714_1000165232 | 239 |
| 106 | 3300005435 | Ga0070714_100440118 | Ga0070714_1004401182 | 239 |
| 107 | 3300005438 | Ga0070701_10148546 | Ga0070701_101485462 | 239 |
| 108 | 3300005438 | Ga0070701_10253461 | Ga0070701_102534612 | 239 |
| 109 | 3300005440 | Ga0070705_100002647 | Ga0070705_10000264711 | 239 |
| 110 | 3300005440 | Ga0070705_100273235 | Ga0070705_1002732352 | 239 |
| 111 | 3300005440 | Ga0070705_100327785 | Ga0070705_1003277852 | 239 |
| 112 | 3300005441 | Ga0070700_100021447 | Ga0070700_1000214472 | 239 |
| 113 | 3300005444 | Ga0070694_100063760 | Ga0070694_1000637602 | 239 |
| 114 | 3300005444 | Ga0070694_100078186 | Ga0070694_1000781862 | 239 |
| 115 | 3300005444 | Ga0070694_100300410 | Ga0070694_1003004102 | 239 |
| 116 | 3300005445 | Ga0070708_100120509 | Ga0070708_1001205092 | 239 |
| 117 | 3300005445 | Ga0070708_100131902 | Ga0070708_1001319022 | 239 |
| 118 | 3300005445 | Ga0070708_100555363 | Ga0070708_1005553632 | 239 |
| 119 | 3300005445 | Ga0070708_100582265 | Ga0070708_1005822651 | 239 |
| 120 | 3300005455 | Ga0070663_100014119 | Ga0070663_1000141192 | 239 |
| 121 | 3300005455 | Ga0070663_100069299 | Ga0070663_1000692992 | 239 |
| 122 | 3300005456 | Ga0070678_100350216 | Ga0070678_1003502161 | 239 |
| 123 | 3300005457 | Ga0070662_100001016 | Ga0070662_1000010162 | 239 |
| 124 | 3300005457 | Ga0070662_100486095 | Ga0070662_1004860952 | 239 |
| 125 | 3300005458 | Ga0070681_10030540 | Ga0070681_100305403 | 239 |
| 126 | 3300005458 | Ga0070681_10101990 | Ga0070681_101019902 | 239 |
| 127 | 3300005458 | Ga0070681_10327806 | Ga0070681_103278062 | 239 |
| 128 | 3300005458 | Ga0070681_10424827 | Ga0070681_104248271 | 239 |
| 129 | 3300005458 | Ga0070681_10514507 | Ga0070681_105145072 | 239 |
| 130 | 3300005459 | Ga0068867_100001302 | Ga0068867_1000013022 | 239 |
| 131 | 3300005459 | Ga0068867_100667149 | Ga0068867_1006671491 | 239 |
| 132 | 3300005467 | Ga0070706_100356695 | Ga0070706_1003566952 | 239 |
| 133 | 3300005468 | Ga0070707_100001911 | Ga0070707_1000019112 | 239 |
| 134 | 3300005468 | Ga0070707_100010581 | Ga0070707_10001058112 | 239 |
| 135 | 3300005468 | Ga0070707_100018305 | Ga0070707_1000183051 | 239 |
| 136 | 3300005468 | Ga0070707_100084370 | Ga0070707_1000843703 | 239 |
| 137 | 3300005468 | Ga0070707_100240996 | Ga0070707_1002409962 | 239 |
| 138 | 3300005468 | Ga0070707_100457576 | Ga0070707_1004575762 | 239 |
| 139 | 3300005471 | Ga0070698_100032678 | Ga0070698_1000326782 | 239 |
| 140 | 3300005518 | Ga0070699_100000719 | Ga0070699_1000007196 | 239 |
| 141 | 3300005518 | Ga0070699_100009101 | Ga0070699_1000091013 | 239 |
| 142 | 3300005518 | Ga0070699_100021678 | Ga0070699_1000216783 | 239 |
| 143 | 3300005518 | Ga0070699_100297513 | Ga0070699_1002975132 | 239 |
| 144 | 3300005518 | Ga0070699_100322234 | Ga0070699_1003222342 | 239 |
| 145 | 3300005518 | Ga0070699_100395588 | Ga0070699_1003955882 | 239 |
| 146 | 3300005530 | Ga0070679_100013124 | Ga0070679_1000131242 | 239 |
| 147 | 3300005530 | Ga0070679_100084258 | Ga0070679_1000842582 | 239 |
| 148 | 3300005530 | Ga0070679_100172663 | Ga0070679_1001726633 | 239 |
| 149 | 3300005530 | Ga0070679_100447328 | Ga0070679_1004473282 | 239 |
| 150 | 3300005535 | Ga0070684_100535366 | Ga0070684_1005353662 | 239 |
| 151 | 3300005536 | Ga0070697_100189387 | Ga0070697_1001893872 | 239 |
| 152 | 3300005539 | Ga0068853_100003056 | Ga0068853_1000030562 | 239 |
| 153 | 3300005545 | Ga0070695_100004631 | Ga0070695_1000046318 | 239 |
| 154 | 3300005545 | Ga0070695_100101427 | Ga0070695_1001014272 | 239 |
| 155 | 3300005545 | Ga0070695_100116220 | Ga0070695_1001162202 | 239 |
| 156 | 3300005546 | Ga0070696_100000510 | Ga0070696_10000051021 | 239 |
| 157 | 3300005546 | Ga0070696_100017080 | Ga0070696_1000170803 | 239 |
| 158 | 3300005546 | Ga0070696_100108888 | Ga0070696_1001088882 | 239 |
| 159 | 3300005546 | Ga0070696_100331815 | Ga0070696_1003318151 | 239 |
| 160 | 3300005546 | Ga0070696_100578439 | Ga0070696_1005784392 | 239 |
| 161 | 3300005547 | Ga0070693_100064464 | Ga0070693_1000644642 | 239 |
| 162 | 3300005547 | Ga0070693_100206139 | Ga0070693_1002061392 | 239 |
| 163 | 3300005548 | Ga0070665_100091648 | Ga0070665_1000916482 | 239 |
| 164 | 3300005548 | Ga0070665_100151284 | Ga0070665_1001512842 | 239 |
| 165 | 3300005549 | Ga0070704_100008201 | Ga0070704_1000082012 | 239 |
| 166 | 3300005549 | Ga0070704_100033367 | Ga0070704_1000333673 | 239 |
| 167 | 3300005549 | Ga0070704_100056684 | Ga0070704_1000566842 | 239 |
| 168 | 3300005549 | Ga0070704_100089528 | Ga0070704_1000895282 | 239 |
| 169 | 3300005549 | Ga0070704_100410782 | Ga0070704_1004107822 | 239 |
| 170 | 3300005563 | Ga0068855_100180020 | Ga0068855_1001800202 | 239 |
| 171 | 3300005564 | Ga0070664_100025286 | Ga0070664_1000252863 | 239 |
| 172 | 3300005577 | Ga0068857_100009128 | Ga0068857_1000091282 | 239 |
| 173 | 3300005578 | Ga0068854_100001114 | Ga0068854_10000111415 | 239 |
| 174 | 3300005578 | Ga0068854_100042943 | Ga0068854_1000429432 | 239 |
| 175 | 3300005578 | Ga0068854_100431843 | Ga0068854_1004318432 | 239 |
| 176 | 3300005614 | Ga0068856_100182582 | Ga0068856_1001825822 | 239 |
| 177 | 3300005615 | Ga0070702_100012760 | Ga0070702_1000127607 | 239 |
| 178 | 3300005616 | Ga0068852_100065540 | Ga0068852_1000655403 | 239 |
| 179 | 3300005617 | Ga0068859_100102114 | Ga0068859_1001021142 | 239 |
| 180 | 3300005618 | Ga0068864_100017240 | Ga0068864_1000172407 | 239 |
| 181 | 3300005618 | Ga0068864_100451721 | Ga0068864_1004517212 | 239 |
| 182 | 3300005718 | Ga0068866_10000401 | Ga0068866_1000040112 | 239 |
| 183 | 3300005719 | Ga0068861_100427727 | Ga0068861_1004277272 | 239 |
| 184 | 3300005841 | Ga0068863_100117734 | Ga0068863_1001177342 | 239 |
| 185 | 3300005842 | Ga0068858_100111338 | Ga0068858_1001113382 | 239 |
| 186 | 3300005843 | Ga0068860_100008736 | Ga0068860_1000087367 | 239 |
| 187 | 3300005844 | Ga0068862_100056882 | Ga0068862_1000568823 | 239 |
| 188 | 3300005844 | Ga0068862_100605133 | Ga0068862_1006051332 | 239 |
| 189 | 3300005937 | Ga0081455_10034051 | Ga0081455_100340513 | 239 |
| 190 | 3300006237 | Ga0097621_100303788 | Ga0097621_1003037882 | 239 |
| 191 | 3300006358 | Ga0068871_100048210 | Ga0068871_1000482105 | 239 |
| 192 | 3300006844 | Ga0075428_100086178 | Ga0075428_1000861782 | 239 |
| 193 | 3300006847 | Ga0075431_100026654 | Ga0075431_1000266542 | 239 |
| 194 | 3300006847 | Ga0075431_100080916 | Ga0075431_1000809162 | 239 |
| 195 | 3300006847 | Ga0075431_100398785 | Ga0075431_1003987852 | 239 |
| 196 | 3300006852 | Ga0075433_10013983 | Ga0075433_100139832 | 239 |
| 197 | 3300006852 | Ga0075433_10033996 | Ga0075433_100339963 | 239 |
| 198 | 3300006871 | Ga0075434_100426234 | Ga0075434_1004262342 | 239 |
| 199 | 3300006871 | Ga0075434_100744058 | Ga0075434_1007440582 | 239 |
| 200 | 3300006880 | Ga0075429_100001523 | Ga0075429_10000152315 | 239 |
| 201 | 3300006881 | Ga0068865_100003327 | Ga0068865_1000033278 | 239 |
| 202 | 3300006914 | Ga0075436_100023748 | Ga0075436_1000237484 | 239 |
| 203 | 3300006931 | Ga0097620_100102109 | Ga0097620_1001021092 | 239 |
| 204 | 3300007076 | Ga0075435_100201213 | Ga0075435_1002012132 | 239 |
| 205 | 3300009093 | Ga0105240_10278983 | Ga0105240_102789832 | 239 |
| 206 | 3300009093 | Ga0105240_10313889 | Ga0105240_103138892 | 239 |
| 207 | 3300009094 | Ga0111539_10619571 | Ga0111539_106195712 | 239 |
| 208 | 3300009098 | Ga0105245_10917646 | Ga0105245_109176462 | 239 |
| 209 | 3300009147 | Ga0114129_10051641 | Ga0114129_100516413 | 239 |
| 210 | 3300009147 | Ga0114129_10174961 | Ga0114129_101749612 | 239 |
| 211 | 3300009147 | Ga0114129_10584928 | Ga0114129_105849282 | 239 |
| 212 | 3300009148 | Ga0105243_10002610 | Ga0105243_1000261014 | 239 |
| 213 | 3300009174 | Ga0105241_10138880 | Ga0105241_101388802 | 239 |
| 214 | 3300009176 | Ga0105242_10001397 | Ga0105242_100013975 | 239 |
| 215 | 3300009177 | Ga0105248_10000658 | Ga0105248_1000065822 | 239 |
| 216 | 3300009177 | Ga0105248_10109728 | Ga0105248_101097282 | 239 |
| 217 | 3300009551 | Ga0105238_10124695 | Ga0105238_101246952 | 239 |
| 218 | 3300009553 | Ga0105249_10001200 | Ga0105249_100012006 | 239 |
| 219 | 3300009553 | Ga0105249_10059863 | Ga0105249_100598632 | 239 |
| 220 | 3300009553 | Ga0105249_10725676 | Ga0105249_107256762 | 239 |
| 221 | 3300010375 | Ga0105239_10004859 | Ga0105239_1000485919 | 239 |
| 222 | 3300010375 | Ga0105239_10015079 | Ga0105239_100150792 | 239 |
| 223 | 3300011119 | Ga0105246_10073971 | Ga0105246_100739713 | 239 |
| 224 | 3300013104 | Ga0157370_10040142 | Ga0157370_100401422 | 239 |
| 225 | 3300013105 | Ga0157369_10118975 | Ga0157369_101189753 | 239 |
| 226 | 3300013297 | Ga0157378_10002774 | Ga0157378_1000277420 | 239 |
| 227 | 3300013306 | Ga0163162_10019177 | Ga0163162_100191774 | 239 |
| 228 | 3300013306 | Ga0163162_10091556 | Ga0163162_100915563 | 239 |
| 229 | 3300013307 | Ga0157372_10205882 | Ga0157372_102058823 | 239 |
| 230 | 3300014325 | Ga0163163_10083756 | Ga0163163_100837562 | 239 |
| 231 | 3300014325 | Ga0163163_10369075 | Ga0163163_103690752 | 239 |
| 232 | 3300014326 | Ga0157380_10067813 | Ga0157380_100678132 | 239 |
| 233 | 3300014968 | Ga0157379_10011031 | Ga0157379_100110315 | 239 |
| 234 | 3300014968 | Ga0157379_10479461 | Ga0157379_104794612 | 239 |
| 235 | 3300014969 | Ga0157376_10034127 | Ga0157376_100341274 | 239 |
| 236 | 3300017792 | Ga0163161_10231693 | Ga0163161_102316932 | 239 |
| 237 | 3300025899 | Ga0207642_10001323 | Ga0207642_100013238 | 239 |
| 238 | 3300025903 | Ga0207680_10151671 | Ga0207680_101516712 | 239 |
| 239 | 3300025904 | Ga0207647_10232235 | Ga0207647_102322352 | 239 |
| 240 | 3300025906 | Ga0207699_10335926 | Ga0207699_103359261 | 239 |
| 241 | 3300025907 | Ga0207645_10000145 | Ga0207645_1000014529 | 239 |
| 242 | 3300025908 | Ga0207643_10014125 | Ga0207643_100141252 | 239 |
| 243 | 3300025910 | Ga0207684_10407326 | Ga0207684_104073262 | 239 |
| 244 | 3300025911 | Ga0207654_10008013 | Ga0207654_100080132 | 239 |
| 245 | 3300025912 | Ga0207707_10019193 | Ga0207707_100191934 | 239 |
| 246 | 3300025912 | Ga0207707_10040209 | Ga0207707_100402093 | 239 |
| 247 | 3300025912 | Ga0207707_10166988 | Ga0207707_101669882 | 239 |
| 248 | 3300025912 | Ga0207707_10430404 | Ga0207707_104304042 | 239 |
| 249 | 3300025912 | Ga0207707_10542950 | Ga0207707_105429501 | 239 |
| 250 | 3300025917 | Ga0207660_10279177 | Ga0207660_102791772 | 239 |
| 251 | 3300025917 | Ga0207660_10328911 | Ga0207660_103289112 | 239 |
| 252 | 3300025919 | Ga0207657_10048349 | Ga0207657_100483492 | 239 |
| 253 | 3300025920 | Ga0207649_10214558 | Ga0207649_102145582 | 239 |
| 254 | 3300025921 | Ga0207652_10014603 | Ga0207652_100146033 | 239 |
| 255 | 3300025921 | Ga0207652_10445503 | Ga0207652_104455031 | 239 |
| 256 | 3300025922 | Ga0207646_10006308 | Ga0207646_100063089 | 239 |
| 257 | 3300025922 | Ga0207646_10018162 | Ga0207646_100181622 | 239 |
| 258 | 3300025922 | Ga0207646_10027616 | Ga0207646_100276162 | 239 |
| 259 | 3300025922 | Ga0207646_10094828 | Ga0207646_100948282 | 239 |
| 260 | 3300025922 | Ga0207646_10352811 | Ga0207646_103528112 | 239 |
| 261 | 3300025922 | Ga0207646_10376581 | Ga0207646_103765812 | 239 |
| 262 | 3300025923 | Ga0207681_10070013 | Ga0207681_100700133 | 239 |
| 263 | 3300025924 | Ga0207694_10011630 | Ga0207694_100116302 | 239 |
| 264 | 3300025925 | Ga0207650_10415766 | Ga0207650_104157662 | 239 |
| 265 | 3300025926 | Ga0207659_10168134 | Ga0207659_101681341 | 239 |
| 266 | 3300025926 | Ga0207659_10664409 | Ga0207659_106644092 | 239 |
| 267 | 3300025927 | Ga0207687_10493269 | Ga0207687_104932692 | 239 |
| 268 | 3300025929 | Ga0207664_10473158 | Ga0207664_104731581 | 239 |
| 269 | 3300025931 | Ga0207644_10046746 | Ga0207644_100467462 | 239 |
| 270 | 3300025932 | Ga0207690_10117926 | Ga0207690_101179262 | 239 |
| 271 | 3300025933 | Ga0207706_10000146 | Ga0207706_1000014626 | 239 |
| 272 | 3300025933 | Ga0207706_10145791 | Ga0207706_101457912 | 239 |
| 273 | 3300025933 | Ga0207706_10250761 | Ga0207706_102507612 | 239 |
| 274 | 3300025933 | Ga0207706_10404970 | Ga0207706_104049702 | 239 |
| 275 | 3300025934 | Ga0207686_10000067 | Ga0207686_1000006786 | 239 |
| 276 | 3300025935 | Ga0207709_10001445 | Ga0207709_1000144511 | 239 |
| 277 | 3300025937 | Ga0207669_10001177 | Ga0207669_100011779 | 239 |
| 278 | 3300025938 | Ga0207704_10049442 | Ga0207704_100494422 | 239 |
| 279 | 3300025940 | Ga0207691_10133322 | Ga0207691_101333222 | 239 |
| 280 | 3300025940 | Ga0207691_10294965 | Ga0207691_102949652 | 239 |
| 281 | 3300025941 | Ga0207711_10002609 | Ga0207711_100026094 | 239 |
| 282 | 3300025945 | Ga0207679_10018948 | Ga0207679_100189485 | 239 |
| 283 | 3300025961 | Ga0207712_10000079 | Ga0207712_1000007989 | 239 |
| 284 | 3300025961 | Ga0207712_10001918 | Ga0207712_1000191811 | 239 |
| 285 | 3300025961 | Ga0207712_10017489 | Ga0207712_100174894 | 239 |
| 286 | 3300025972 | Ga0207668_10010985 | Ga0207668_100109854 | 239 |
| 287 | 3300025972 | Ga0207668_10217969 | Ga0207668_102179692 | 239 |
| 288 | 3300025981 | Ga0207640_10003844 | Ga0207640_100038444 | 239 |
| 289 | 3300025981 | Ga0207640_10297825 | Ga0207640_102978252 | 239 |
| 290 | 3300026041 | Ga0207639_10054591 | Ga0207639_100545913 | 239 |
| 291 | 3300026067 | Ga0207678_10222635 | Ga0207678_102226352 | 239 |
| 292 | 3300026075 | Ga0207708_10101362 | Ga0207708_101013622 | 239 |
| 293 | 3300026088 | Ga0207641_10189724 | Ga0207641_101897242 | 239 |
| 294 | 3300026088 | Ga0207641_10423877 | Ga0207641_104238771 | 239 |
| 295 | 3300026089 | Ga0207648_10001390 | Ga0207648_1000139019 | 239 |
| 296 | 3300026089 | Ga0207648_10173691 | Ga0207648_101736912 | 239 |
| 297 | 3300026095 | Ga0207676_10021625 | Ga0207676_100216252 | 239 |
| 298 | 3300026116 | Ga0207674_10418525 | Ga0207674_104185252 | 239 |
| 299 | 3300026118 | Ga0207675_100501359 | Ga0207675_1005013592 | 239 |
| 300 | 3300026118 | Ga0207675_100780150 | Ga0207675_1007801502 | 239 |
| 301 | 3300026121 | Ga0207683_10005089 | Ga0207683_100050893 | 239 |
| 302 | 3300026142 | Ga0207698_10082023 | Ga0207698_100820232 | 239 |
| 303 | 3300027360 | Ga0209969_1009284 | Ga0209969_10092842 | 239 |
| 304 | 3300027717 | Ga0209998_10036451 | Ga0209998_100364512 | 239 |
| 305 | 3300027876 | Ga0209974_10039404 | Ga0209974_100394042 | 239 |
| 306 | 3300028379 | Ga0268266_10108349 | Ga0268266_101083492 | 239 |
| 307 | 3300028379 | Ga0268266_10507500 | Ga0268266_105075002 | 239 |
| 308 | 3300028380 | Ga0268265_10123590 | Ga0268265_101235903 | 239 |
| 309 | 3300028381 | Ga0268264_10028037 | Ga0268264_100280374 | 239 |
| 310 | 3300028381 | Ga0268264_10125498 | Ga0268264_101254982 | 239 |
| 311 | 3300028800 | Ga0265338_10001746 | Ga0265338_1000174629 | 239 |
| 312 | 3300031548 | Ga0307408_100004762 | Ga0307408_1000047622 | 239 |
| 313 | 3300031548 | Ga0307408_100048901 | Ga0307408_1000489012 | 239 |
| 314 | 3300031548 | Ga0307408_100159922 | Ga0307408_1001599222 | 239 |
| 315 | 3300031548 | Ga0307408_100166047 | Ga0307408_1001660472 | 239 |
| 316 | 3300031548 | Ga0307408_100284006 | Ga0307408_1002840062 | 239 |
| 317 | 3300031731 | Ga0307405_10101985 | Ga0307405_101019852 | 239 |
| 318 | 3300031731 | Ga0307405_10250177 | Ga0307405_102501772 | 239 |
| 319 | 3300031824 | Ga0307413_10003985 | Ga0307413_100039851 | 239 |
| 320 | 3300031824 | Ga0307413_10052635 | Ga0307413_100526352 | 239 |
| 321 | 3300031824 | Ga0307413_10058187 | Ga0307413_100581873 | 239 |
| 322 | 3300031852 | Ga0307410_10024856 | Ga0307410_100248562 | 239 |
| 323 | 3300031852 | Ga0307410_10056168 | Ga0307410_100561682 | 239 |
| 324 | 3300031852 | Ga0307410_10063680 | Ga0307410_100636802 | 239 |
| 325 | 3300031852 | Ga0307410_10067745 | Ga0307410_100677452 | 239 |
| 326 | 3300031852 | Ga0307410_10112921 | Ga0307410_101129212 | 239 |
| 327 | 3300031852 | Ga0307410_10167042 | Ga0307410_101670422 | 239 |
| 328 | 3300031901 | Ga0307406_10047823 | Ga0307406_100478232 | 239 |
| 329 | 3300031901 | Ga0307406_10053445 | Ga0307406_100534452 | 239 |
| 330 | 3300031901 | Ga0307406_10064837 | Ga0307406_100648372 | 239 |
| 331 | 3300031901 | Ga0307406_10144876 | Ga0307406_101448762 | 239 |
| 332 | 3300031903 | Ga0307407_10017198 | Ga0307407_100171982 | 239 |
| 333 | 3300031903 | Ga0307407_10021217 | Ga0307407_100212172 | 239 |
| 334 | 3300031903 | Ga0307407_10023656 | Ga0307407_100236562 | 239 |
| 335 | 3300031903 | Ga0307407_10034610 | Ga0307407_100346102 | 239 |
| 336 | 3300031903 | Ga0307407_10193364 | Ga0307407_101933642 | 239 |
| 337 | 3300031903 | Ga0307407_10259623 | Ga0307407_102596231 | 239 |
| 338 | 3300031911 | Ga0307412_10020347 | Ga0307412_100203472 | 239 |
| 339 | 3300031911 | Ga0307412_10586077 | Ga0307412_105860772 | 239 |
| 340 | 3300031995 | Ga0307409_100000308 | Ga0307409_10000030818 | 239 |
| 341 | 3300031995 | Ga0307409_100006784 | Ga0307409_1000067844 | 239 |
| 342 | 3300031995 | Ga0307409_100061431 | Ga0307409_1000614312 | 239 |
| 343 | 3300031995 | Ga0307409_100105924 | Ga0307409_1001059242 | 239 |
| 344 | 3300031995 | Ga0307409_100112811 | Ga0307409_1001128112 | 239 |
| 345 | 3300031995 | Ga0307409_100178521 | Ga0307409_1001785212 | 239 |
| 346 | 3300031995 | Ga0307409_100222747 | Ga0307409_1002227472 | 239 |
| 347 | 3300031995 | Ga0307409_100239768 | Ga0307409_1002397682 | 239 |
| 348 | 3300031995 | Ga0307409_100673217 | Ga0307409_1006732172 | 239 |
| 349 | 3300032002 | Ga0307416_100002827 | Ga0307416_1000028276 | 239 |
| 350 | 3300032002 | Ga0307416_100005003 | Ga0307416_10000500311 | 239 |
| 351 | 3300032002 | Ga0307416_100011070 | Ga0307416_1000110702 | 239 |
| 352 | 3300032002 | Ga0307416_100030262 | Ga0307416_1000302622 | 239 |
| 353 | 3300032002 | Ga0307416_100050239 | Ga0307416_1000502392 | 239 |
| 354 | 3300032002 | Ga0307416_100159447 | Ga0307416_1001594472 | 239 |
| 355 | 3300032002 | Ga0307416_100201144 | Ga0307416_1002011442 | 239 |
| 356 | 3300032002 | Ga0307416_100278133 | Ga0307416_1002781332 | 239 |
| 357 | 3300032002 | Ga0307416_100899816 | Ga0307416_1008998162 | 239 |
| 358 | 3300032002 | Ga0307416_100960228 | Ga0307416_1009602282 | 239 |
| 359 | 3300032004 | Ga0307414_10022522 | Ga0307414_100225223 | 239 |
| 360 | 3300032004 | Ga0307414_10081152 | Ga0307414_100811522 | 239 |
| 361 | 3300032004 | Ga0307414_10088499 | Ga0307414_100884992 | 239 |
| 362 | 3300032004 | Ga0307414_10098608 | Ga0307414_100986082 | 239 |
| 363 | 3300032004 | Ga0307414_10243491 | Ga0307414_102434912 | 239 |
| 364 | 3300032005 | Ga0307411_10002519 | Ga0307411_100025192 | 239 |
| 365 | 3300032005 | Ga0307411_10033227 | Ga0307411_100332272 | 239 |
| 366 | 3300032005 | Ga0307411_10045926 | Ga0307411_100459262 | 239 |
| 367 | 3300032005 | Ga0307411_10091076 | Ga0307411_100910762 | 239 |
| 368 | 3300032005 | Ga0307411_10219910 | Ga0307411_102199101 | 239 |
| 369 | 3300032126 | Ga0307415_100000203 | Ga0307415_10000020323 | 239 |
| 370 | 3300032126 | Ga0307415_100001513 | Ga0307415_10000151312 | 239 |
| 371 | 3300032126 | Ga0307415_100292266 | Ga0307415_1002922662 | 239 |
| 372 | 3300032126 | Ga0307415_100365496 | Ga0307415_1003654962 | 239 |
| 373 | 3300035085 | Ga0373929_0021808 | Ga0373929_0021808_486_1205 | 239 |
| 374 | 3300035086 | Ga0373934_0000216 | Ga0373934_0000216_13050_13772 | 239 |
| 375 | 3300035088 | Ga0373940_0016091 | Ga0373940_0016091_264_983 | 239 |
| 376 | 3300035088 | Ga0373940_0032565 | Ga0373940_0032565_83_802 | 239 |
| 377 | 3300035090 | Ga0373949_0021123 | Ga0373949_0021123_169_888 | 239 |
| 378 | 3300035111 | Ga0373923_0008948 | Ga0373923_0008948_2295_3017 | 239 |
| 379 | 3300035119 | Ga0373956_0000127 | Ga0373956_0000127_6826_7548 | 239 |
| 380 | 3300035120 | Ga0373957_0014563 | Ga0373957_0014563_222_944 | 239 |
| 381 | 3300035172 | Ga0373955_0004911 | Ga0373955_0004911_201_923 | 239 |
| 382 | 3300035410 | Ga0373924_0121700 | Ga0373924_0121700_242_964 | 239 |
| 383 | 3300035692 | Ga0373935_0071348 | Ga0373935_0071348_918_1640 | 239 |
| 384 | 3300035724 | Ga0373933_0000353 | Ga0373933_0000353_1778_2500 | 239 |
| 385 | 3300036401 | Ga0373937_0000195 | Ga0373937_0000195_12480_13202 | 239 |
| 386 | 3300036401 | Ga0373937_0152366 | Ga0373937_0152366_331_1053 | 239 |
| 387 | 3300038443 | Ga0395901_0113783 | Ga0395901_0113783_930_1649 | 239 |
| 388 | 3300038996 | Ga0242420_000375 | Ga0242420_000375_2644_3363 | 239 |
| 389 | 3300038996 | Ga0242420_014811 | Ga0242420_014811_245_1108 | 239 |
| 390 | 3300038996 | Ga0242420_015847 | Ga0242420_015847_310_1032 | 239 |
| 391 | 3300038996 | Ga0242420_052098 | Ga0242420_052098_30_749 | 239 |
| 392 | 3300041406 | Ga0439439_0013110 | Ga0439439_0013110_708_1427 | 239 |
| 393 | 3300041408 | Ga0439453_0054999 | Ga0439453_0054999_57_782 | 239 |
| 394 | 3300041486 | Ga0451807_0948721 | Ga0451807_0948721_378_1097 | 239 |
| 395 | 3300041505 | Ga0451849_1163722 | Ga0451849_1163722_454_1173 | 239 |
| 396 | 3300042003 | Ga0439443_032612 | Ga0439443_032612_113_838 | 239 |
| 397 | 3300042184 | Ga0450908_031118 | Ga0450908_031118_119_838 | 239 |
| 398 | 3300042876 | Ga0451577_0525891 | Ga0451577_0525891_161_880 | 239 |
| 399 | 3300044673 | Ga0453683_0102758 | Ga0453683_0102758_559_1278 | 239 |
| 400 | 3300044673 | Ga0453683_0269610 | Ga0453683_0269610_257_976 | 239 |
| 401 | 3300044712 | Ga0453684_0855203 | Ga0453684_0855203_70_789 | 239 |
| 402 | 3300045051 | Ga0451576_0133286 | Ga0451576_0133286_1492_2223 | 239 |
| 403 | 3300045051 | Ga0451576_0611109 | Ga0451576_0611109_125_844 | 239 |
| 404 | 3300046454 | Ga0495592_0003659 | Ga0495592_0003659_4909_5631 | 239 |
| 405 | 3300046455 | Ga0495603_0058591 | Ga0495603_0058591_38_760 | 239 |
| 406 | 3300046455 | Ga0495603_0108964 | Ga0495603_0108964_862_1581 | 239 |
| 407 | 3300046461 | Ga0495641_0107243 | Ga0495641_0107243_12_734 | 239 |
| 408 | 3300046462 | Ga0495651_0000050 | Ga0495651_0000050_37890_38612 | 239 |
| 409 | 3300046463 | Ga0495653_0000134 | Ga0495653_0000134_46395_47117 | 239 |
| 410 | 3300046473 | Ga0495582_0021166 | Ga0495582_0021166_2058_2780 | 239 |
| 411 | 3300046475 | Ga0495639_0011198 | Ga0495639_0011198_974_1696 | 239 |
| 412 | 3300046499 | Ga0495594_0026408 | Ga0495594_0026408_1068_1790 | 239 |
| 413 | 3300046511 | Ga0495608_0000381 | Ga0495608_0000381_13647_14369 | 239 |
| 414 | 3300046514 | Ga0495618_0060276 | Ga0495618_0060276_905_1627 | 239 |
| 415 | 3300046516 | Ga0495628_0001309 | Ga0495628_0001309_2344_3066 | 239 |
| 416 | 3300046516 | Ga0495628_0233857 | Ga0495628_0233857_90_812 | 239 |
| 417 | 3300046517 | Ga0495630_0004360 | Ga0495630_0004360_1925_2647 | 239 |
| 418 | 3300046517 | Ga0495630_0023250 | Ga0495630_0023250_2783_3505 | 239 |
| 419 | 3300046526 | Ga0495666_0002485 | Ga0495666_0002485_7373_8095 | 239 |
| 420 | 3300046529 | Ga0495652_0003898 | Ga0495652_0003898_6957_7679 | 239 |
| 421 | 3300046533 | Ga0495640_0058174 | Ga0495640_0058174_1795_2517 | 239 |
| 422 | 3300046535 | Ga0495586_0007463 | Ga0495586_0007463_1224_1946 | 239 |
| 423 | 3300046536 | Ga0495587_0000114 | Ga0495587_0000114_52153_52875 | 239 |
| 424 | 3300046543 | Ga0495645_0000065 | Ga0495645_0000065_57950_58672 | 239 |
| 425 | 3300046543 | Ga0495645_0063735 | Ga0495645_0063735_516_1238 | 239 |
| 426 | 3300046557 | Ga0495622_0092018 | Ga0495622_0092018_624_1343 | 239 |
| 427 | 3300046559 | Ga0495667_0000316 | Ga0495667_0000316_24177_24899 | 239 |
| 428 | 3300046559 | Ga0495667_0156542 | Ga0495667_0156542_215_937 | 239 |
| 429 | 3300046642 | Ga0495634_0010164 | Ga0495634_0010164_1318_2040 | 239 |
| 430 | 3300046663 | Ga0495635_0000103 | Ga0495635_0000103_3704_4426 | 239 |
| 431 | 3300046675 | Ga0495657_0001662 | Ga0495657_0001662_13849_14571 | 239 |
| 432 | 3300046675 | Ga0495657_0235271 | Ga0495657_0235271_362_1081 | 239 |
| 433 | 3300046678 | Ga0495599_0005532 | Ga0495599_0005532_1349_2071 | 239 |
| 434 | 3300046679 | Ga0495623_0000086 | Ga0495623_0000086_48212_48934 | 239 |
| 435 | 3300046680 | Ga0495646_0091304 | Ga0495646_0091304_962_1684 | 239 |
| 436 | 3300046681 | Ga0495647_0031139 | Ga0495647_0031139_542_1264 | 239 |
| 437 | 3300046683 | Ga0495658_0009713 | Ga0495658_0009713_2671_3393 | 239 |
| 438 | 3300046689 | Ga0495613_0067652 | Ga0495613_0067652_1052_1774 | 239 |
| 439 | 3300046809 | Ga0495600_0003319 | Ga0495600_0003319_6313_7035 | 239 |
| 440 | 3300047317 | Ga0495604_0001195 | Ga0495604_0001195_14087_14809 | 239 |
| 441 | 3300047319 | Ga0495674_0000339 | Ga0495674_0000339_24374_25096 | 239 |
| 442 | 3300047319 | Ga0495674_0023282 | Ga0495674_0023282_1550_2272 | 239 |
| 443 | 3300047319 | Ga0495674_0149410 | Ga0495674_0149410_870_1592 | 239 |
| 444 | 3300047322 | Ga0495680_0016313 | Ga0495680_0016313_469_1191 | 239 |
| 445 | 3300047322 | Ga0495680_0021286 | Ga0495680_0021286_1126_1848 | 239 |
| 446 | 3300047471 | Ga0495684_0000141 | Ga0495684_0000141_46066_46788 | 239 |
| 447 | 3300048088 | Ga0495602_0003470 | Ga0495602_0003470_6021_6743 | 239 |
| 448 | 3300048903 | Ga0496100_0482066 | Ga0496100_0482066_68_787 | 239 |
| 449 | 3300048905 | Ga0496102_0229646 | Ga0496102_0229646_20_739 | 239 |
| 450 | 3300048905 | Ga0496102_0269122 | Ga0496102_0269122_872_1591 | 239 |
| 451 | 3300048905 | Ga0496102_0506620 | Ga0496102_0506620_137_856 | 239 |
| 452 | 3300048906 | Ga0496103_0135937 | Ga0496103_0135937_623_1342 | 239 |
| 453 | 3300048906 | Ga0496103_0258246 | Ga0496103_0258246_285_1004 | 239 |
| 454 | 3300048907 | Ga0496104_0010276 | Ga0496104_0010276_6685_7404 | 239 |
| 455 | 3300048908 | Ga0496105_0069739 | Ga0496105_0069739_2124_2843 | 239 |
| 456 | 3300048909 | Ga0496106_0022907 | Ga0496106_0022907_1461_2180 | 239 |
| 457 | 3300048909 | Ga0496106_0042473 | Ga0496106_0042473_249_968 | 239 |
| 458 | 3300048909 | Ga0496106_0125496 | Ga0496106_0125496_333_1052 | 239 |
| 459 | 3300048909 | Ga0496106_0250541 | Ga0496106_0250541_502_1221 | 239 |
| 460 | 3300048910 | Ga0496107_0204239 | Ga0496107_0204239_583_1302 | 239 |
| 461 | 3300048911 | Ga0496108_0001782 | Ga0496108_0001782_4899_5618 | 239 |
| 462 | 3300048911 | Ga0496108_0002171 | Ga0496108_0002171_6181_6900 | 239 |
| 463 | 3300048911 | Ga0496108_0003640 | Ga0496108_0003640_4442_5161 | 239 |
| 464 | 3300048911 | Ga0496108_0313513 | Ga0496108_0313513_403_1122 | 239 |
| 465 | 3300048912 | Ga0496109_0001037 | Ga0496109_0001037_480_1199 | 239 |
| 466 | 3300048912 | Ga0496109_0007936 | Ga0496109_0007936_860_1579 | 239 |
| 467 | 3300048912 | Ga0496109_0099260 | Ga0496109_0099260_682_1401 | 239 |
| 468 | 3300048912 | Ga0496109_0204457 | Ga0496109_0204457_909_1628 | 239 |
| 469 | 3300048913 | Ga0496110_0016427 | Ga0496110_0016427_3235_3954 | 239 |
| 470 | 3300048913 | Ga0496110_0089740 | Ga0496110_0089740_1743_2462 | 239 |
| 471 | 3300048914 | Ga0496111_0015616 | Ga0496111_0015616_2394_3113 | 239 |
| 472 | 3300048914 | Ga0496111_0020367 | Ga0496111_0020367_2491_3210 | 239 |
| 473 | 3300048915 | Ga0496112_0000129 | Ga0496112_0000129_39568_40287 | 239 |
| 474 | 3300048915 | Ga0496112_0047190 | Ga0496112_0047190_3018_3737 | 239 |
| 475 | 3300048915 | Ga0496112_0148982 | Ga0496112_0148982_1101_1820 | 239 |
| 476 | 3300048915 | Ga0496112_0720710 | Ga0496112_0720710_111_830 | 239 |
| 477 | 3300048916 | Ga0496113_0000062 | Ga0496113_0000062_39224_39943 | 239 |
| 478 | 3300048917 | Ga0496114_0191002 | Ga0496114_0191002_1026_1745 | 239 |
| 479 | 3300049521 | Ga0501298_019236 | Ga0501298_019236_278_997 | 239 |
| 480 | 3300049571 | Ga0501034_0008504 | Ga0501034_0008504_1016_1735 | 239 |
| 481 | 3300049571 | Ga0501034_0063733 | Ga0501034_0063733_1185_1904 | 239 |
| 482 | 3300049575 | Ga0501039_0098097 | Ga0501039_0098097_1368_2087 | 239 |
| 483 | 3300049576 | Ga0501040_0118525 | Ga0501040_0118525_299_1018 | 239 |
| 484 | 3300049577 | Ga0501041_0367092 | Ga0501041_0367092_75_794 | 239 |
| 485 | 3300049578 | Ga0501042_0069774 | Ga0501042_0069774_1081_1800 | 239 |
| 486 | 3300049578 | Ga0501042_0130499 | Ga0501042_0130499_815_1534 | 239 |
| 487 | 3300049578 | Ga0501042_0249194 | Ga0501042_0249194_95_814 | 239 |
| 488 | 3300049580 | Ga0501046_0139275 | Ga0501046_0139275_19_738 | 239 |
| 489 | 3300049581 | Ga0501047_0698113 | Ga0501047_0698113_92_811 | 239 |
| 490 | 3300049582 | Ga0501048_0071460 | Ga0501048_0071460_656_1375 | 239 |
| 491 | 3300049583 | Ga0501067_0002448 | Ga0501067_0002448_1033_1752 | 239 |
| 492 | 3300049583 | Ga0501067_0013916 | Ga0501067_0013916_2571_3290 | 239 |
| 493 | 3300049583 | Ga0501067_0036646 | Ga0501067_0036646_709_1428 | 239 |
| 494 | 3300049583 | Ga0501067_0042648 | Ga0501067_0042648_580_1365 | 239 |
| 495 | 3300049584 | Ga0501068_0000311 | Ga0501068_0000311_11787_12506 | 239 |
| 496 | 3300049584 | Ga0501068_0006064 | Ga0501068_0006064_4895_5614 | 239 |
| 497 | 3300049585 | Ga0501069_0001105 | Ga0501069_0001105_551_1270 | 239 |
| 498 | 3300049585 | Ga0501069_0001912 | Ga0501069_0001912_9121_9840 | 239 |
| 499 | 3300049586 | Ga0501070_0004182 | Ga0501070_0004182_10688_11407 | 239 |
| 500 | 3300049586 | Ga0501070_0018009 | Ga0501070_0018009_3814_4533 | 239 |
| 501 | 3300049586 | Ga0501070_0060202 | Ga0501070_0060202_1020_1742 | 239 |
| 502 | 3300049586 | Ga0501070_0424747 | Ga0501070_0424747_192_911 | 239 |
| 503 | 3300049587 | Ga0501071_0002649 | Ga0501071_0002649_92_811 | 239 |
| 504 | 3300049587 | Ga0501071_0008604 | Ga0501071_0008604_5022_5741 | 239 |
| 505 | 3300049587 | Ga0501071_0038976 | Ga0501071_0038976_976_1695 | 239 |
| 506 | 3300049588 | Ga0501072_0017501 | Ga0501072_0017501_892_1611 | 239 |
| 507 | 3300049588 | Ga0501072_0033860 | Ga0501072_0033860_2762_3481 | 239 |
| 508 | 3300049588 | Ga0501072_0039701 | Ga0501072_0039701_1999_2718 | 239 |
| 509 | 3300049588 | Ga0501072_0058662 | Ga0501072_0058662_1965_2684 | 239 |
| 510 | 3300049588 | Ga0501072_0115737 | Ga0501072_0115737_1064_1783 | 239 |
| 511 | 3300049589 | Ga0501073_0015044 | Ga0501073_0015044_1080_1799 | 239 |
| 512 | 3300049590 | Ga0501074_0113482 | Ga0501074_0113482_852_1571 | 239 |
| 513 | 3300049590 | Ga0501074_0136211 | Ga0501074_0136211_1021_1740 | 239 |
| 514 | 3300049591 | Ga0501075_0073623 | Ga0501075_0073623_1181_1900 | 239 |
| 515 | 3300049591 | Ga0501075_0175770 | Ga0501075_0175770_259_978 | 239 |
| 516 | 3300049592 | Ga0501076_0011216 | Ga0501076_0011216_5390_6109 | 239 |
| 517 | 3300049592 | Ga0501076_0178823 | Ga0501076_0178823_122_841 | 239 |
| 518 | 3300049592 | Ga0501076_0190694 | Ga0501076_0190694_135_854 | 239 |
| 519 | 3300049592 | Ga0501076_0498352 | Ga0501076_0498352_198_917 | 239 |
| 520 | 3300049592 | Ga0501076_0581978 | Ga0501076_0581978_144_863 | 239 |
| 521 | 3300049593 | Ga0501077_0033274 | Ga0501077_0033274_1716_2435 | 239 |
| 522 | 3300049656 | Ga0501209_002545 | Ga0501209_002545_1039_1788 | 239 |
| 523 | 3300049675 | Ga0501243_012653 | Ga0501243_012653_493_1242 | 239 |
| 524 | 3300049677 | Ga0501247_014704 | Ga0501247_014704_11_760 | 239 |
| 525 | 3300049679 | Ga0501249_012149 | Ga0501249_012149_433_1182 | 239 |
| 526 | 3300049686 | Ga0501257_013681 | Ga0501257_013681_211_960 | 239 |
| 527 | 3300049741 | Ga0501079_0009697 | Ga0501079_0009697_690_1409 | 239 |
| 528 | 3300049741 | Ga0501079_0054981 | Ga0501079_0054981_408_1127 | 239 |
| 529 | 3300049741 | Ga0501079_0065143 | Ga0501079_0065143_89_808 | 239 |
| 530 | 3300049741 | Ga0501079_0103136 | Ga0501079_0103136_861_1580 | 239 |
| 531 | 3300049741 | Ga0501079_0127696 | Ga0501079_0127696_22_741 | 239 |
| 532 | 3300049742 | Ga0501080_0002229 | Ga0501080_0002229_1980_2699 | 239 |
| 533 | 3300049742 | Ga0501080_0002645 | Ga0501080_0002645_2919_3638 | 239 |
| 534 | 3300049742 | Ga0501080_0010834 | Ga0501080_0010834_5457_6176 | 239 |
| 535 | 3300049742 | Ga0501080_0205454 | Ga0501080_0205454_464_1183 | 239 |
| 536 | 3300049742 | Ga0501080_0500691 | Ga0501080_0500691_331_1050 | 239 |
| 537 | 3300049743 | Ga0501081_0220150 | Ga0501081_0220150_516_1235 | 239 |
| 538 | 3300049744 | Ga0501083_0001221 | Ga0501083_0001221_15572_16291 | 239 |
| 539 | 3300049744 | Ga0501083_0002285 | Ga0501083_0002285_5509_6228 | 239 |
| 540 | 3300049759 | Ga0501262_004576 | Ga0501262_004576_159_908 | 239 |
| 541 | 3300049770 | Ga0501273_002720 | Ga0501273_002720_180_929 | 239 |
| 542 | 3300049824 | Ga0501045_0017170 | Ga0501045_0017170_3812_4531 | 239 |
| 543 | 3300049824 | Ga0501045_0078665 | Ga0501045_0078665_22_741 | 239 |
| 544 | 3300049824 | Ga0501045_0089452 | Ga0501045_0089452_818_1537 | 239 |
| 545 | 3300049824 | Ga0501045_0126992 | Ga0501045_0126992_111_830 | 239 |
| 546 | 3300049851 | Ga0501212_017063 | Ga0501212_017063_315_1064 | 239 |
| 547 | 3300050507 | nmdc:mga05p37_17760_c2 | nmdc:mga05p37_17760_c2_2158_2877 | 239 |
| 548 | 3300050507 | nmdc:mga05p37_273526_c1 | nmdc:mga05p37_273526_c1_151_870 | 239 |
| 549 | 3300050508 | nmdc:mga09592_1219_c1 | nmdc:mga09592_1219_c1_10205_10924 | 239 |
| 550 | 3300050509 | nmdc:mga0qj67_129765_c1 | nmdc:mga0qj67_129765_c1_632_1351 | 239 |
| 551 | 3300050510 | nmdc:mga06r32_193097_c1 | nmdc:mga06r32_193097_c1_924_1643 | 239 |
| 552 | 3300050510 | nmdc:mga06r32_63445_c1 | nmdc:mga06r32_63445_c1_507_1256 | 239 |
| 553 | 3300050512 | nmdc:mga0n895_470891_c1 | nmdc:mga0n895_470891_c1_524_1243 | 239 |
| 554 | 3300053077 | Ga0495601_0009524 | Ga0495601_0009524_277_999 | 239 |
| 555 | 3300053078 | Ga0495612_0005188 | Ga0495612_0005188_1087_1809 | 239 |
| 556 | 3300053084 | Ga0495595_0010877 | Ga0495595_0010877_2087_2809 | 239 |
| 557 | 3300054114 | Ga0501084_0001049 | Ga0501084_0001049_6755_7474 | 239 |
| 558 | 3300054114 | Ga0501084_0022098 | Ga0501084_0022098_4229_4948 | 239 |
| 559 | 3300054114 | Ga0501084_0032371 | Ga0501084_0032371_2550_3269 | 239 |
| 560 | 3300054114 | Ga0501084_0056519 | Ga0501084_0056519_2448_3167 | 239 |
| 561 | 3300054114 | Ga0501084_0084552 | Ga0501084_0084552_920_1639 | 239 |
| 562 | 3300054114 | Ga0501084_0323761 | Ga0501084_0323761_67_786 | 239 |
| 563 | 3300054114 | Ga0501084_0858725 | Ga0501084_0858725_11_730 | 239 |
| 564 | 3300059421 | Ga0590071_000553 | Ga0590071_000553_10031_10750 | 239 |
| 565 | 3300059421 | Ga0590071_013855 | Ga0590071_013855_294_1013 | 239 |
| 566 | 3300059421 | Ga0590071_016339 | Ga0590071_016339_204_923 | 239 |
| 567 | 3300059423 | Ga0590074_018326 | Ga0590074_018326_79_798 | 239 |
| 568 | 3300059423 | Ga0590074_030196 | Ga0590074_030196_53_772 | 239 |
| 569 | 3300059424 | Ga0590075_019466 | Ga0590075_019466_359_1078 | 239 |
| 570 | 3300059424 | Ga0590075_052075 | Ga0590075_052075_185_904 | 239 |
| 571 | 3300060353 | Ga0501082_0019260 | Ga0501082_0019260_1993_2712 | 239 |
| 572 | 3300060353 | Ga0501082_0108395 | Ga0501082_0108395_617_1336 | 239 |
| 573 | 3300060353 | Ga0501082_0132652 | Ga0501082_0132652_1250_1969 | 239 |
| 574 | 3300060353 | Ga0501082_0147609 | Ga0501082_0147609_879_1598 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.8563 | 3 | 230 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.8537 | 4 | 238 |
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.8025 | 3 | 230 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.8012 | 4 | 238 |
| 5eke-assembly1.cif.gz_D | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.7548 | 3 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9425 | 3 | 238 | 3.90.550.10 |
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9274 | 3 | 238 | 3.90.550.10 |
| af_A4ICW5_2_228_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8716 | 4 | 227 | 3.90.550.10 |
| af_A0A0R0GWU7_24_252_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8641 | 3 | 224 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8636 | 7 | 232 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4G0G2-F1-model_v4 | Dolichyl-phosphate beta-D-mannosyltransferase | 0.9918 | 2 | 208 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A7X4C4G6-F1-model_v4 | deleted | 0.9895 | 3 | 239 |
|
| AF-A0A1V0DD11-F1-model_v4 | Dolichyl-phosphate beta-D-mannosyltransferase | 0.9839 | 2 | 239 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A660SCN6-F1-model_v4 | Polyprenol monophosphomannose synthase | 0.9821 | 69 | 239 |
GO:0004582
GO:0009247 GO:0016020 |
| AF-A0A7V0IGF1-F1-model_v4 | Polyprenol monophosphomannose synthase | 0.9793 | 3 | 239 |
GO:0004582
GO:0009247 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar