F465324

General Info

Members Datasets Scaffolds Average Seq Length
574 344 538 148

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1288387|Ga0436360_1288387_244_765
Length 173
Sequence MIRYSLRCERDHSFESWFQDSGAYDSQVKRKLVSCPVCGSAKVEKAIMAPRIVSKKGRDRQTAVPETANVPVPAAPAETASPPQVQGSQAQSSTPLMMAQERELRAKLKELRDHIVKNADNVGEKFPNEARKMHYGEIEHRPIYGEASPEEARALIDEGVEVSPLPVLPEDRN

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
13 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
14 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
15 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
16 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
17 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
18 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
19 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
20 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
21 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
22 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
23 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
24 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
25 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
26 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
27 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
28 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
29 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
165 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
217 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
218 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
338 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
339 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
340 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
341 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
342 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
343 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
344 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 0.17
Isolates 6.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 4.7
Rhizoplane 6.62
Rhizosphere 77.35
Stem 0
Stem Tuber 0
Unclassified 9.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C3613 2010549000 Bacteria 1495
2 LJQas_1002886 3300000549 Bacteria 2339
3 JGI24740J21852_10010779 3300001979 Bacteria 3501
4 JGI24737J22298_10023916 3300001990 Bacteria 1935
5 JGI24735J21928_10032987 3300002067 Bacteria 1531
6 JGI24750J21931_1008207 3300002070 Bacteria 1325
7 JGI24738J21930_10035415 3300002075 Bacteria 1017
8 JGI24744J21845_10038948 3300002077 Bacteria 893
9 JGI25406J46586_10015879 3300003203 Bacteria 3159
10 JGI25165J46597_1008974 3300003214 Bacteria 1532
11 JGI25160J50197_1001574 3300003354 Bacteria 11262
12 Ga0070676_10564046 3300005328 Bacteria 817
13 Ga0070683_100053436 3300005329 Bacteria 3743
14 Ga0070680_100013669 3300005336 Bacteria 6328
15 Ga0070680_101253423 3300005336 Bacteria 641
16 Ga0070682_100723300 3300005337 Bacteria 801
17 Ga0068868_100322384 3300005338 Bacteria 1316
18 Ga0068868_100702377 3300005338 Bacteria 905
19 Ga0070660_100954265 3300005339 Bacteria 724
20 Ga0070661_100292393 3300005344 Bacteria 1266
21 Ga0070661_101461969 3300005344 Bacteria 576
22 Ga0070668_100210169 3300005347 Bacteria 1600
23 Ga0070674_100380237 3300005356 Bacteria 1149
24 Ga0070688_100348233 3300005365 Bacteria 1084
25 Ga0070659_100532917 3300005366 Bacteria 1004
26 Ga0070659_100676592 3300005366 Bacteria 891
27 Ga0070709_10001043 3300005434 Bacteria 15348
28 Ga0070709_10010369 3300005434 Bacteria 5159
29 Ga0070709_10012256 3300005434 Bacteria 4795
30 Ga0070709_10255137 3300005434 Bacteria 1265
31 Ga0070709_10380117 3300005434 Bacteria 1050
32 Ga0070714_100011580 3300005435 Bacteria 7002
33 Ga0070714_100019087 3300005435 Bacteria 5579
34 Ga0070713_100000768 3300005436 Bacteria 20535
35 Ga0070713_100030913 3300005436 Bacteria 4258
36 Ga0070713_100079890 3300005436 Bacteria 2787
37 Ga0070710_10001851 3300005437 Bacteria 9963
38 Ga0070701_10286556 3300005438 Bacteria 1007
39 Ga0070711_100008471 3300005439 Bacteria 6300
40 Ga0070711_100037156 3300005439 Bacteria 3266
41 Ga0070705_100318922 3300005440 Bacteria 1121
42 Ga0070700_100165208 3300005441 Bacteria 1528
43 Ga0070678_100361797 3300005456 Bacteria 1250
44 Ga0070681_10031521 3300005458 Bacteria 5322
45 Ga0070679_100037345 3300005530 Bacteria 4824
46 Ga0070684_100006424 3300005535 Bacteria 9098
47 Ga0070697_100106544 3300005536 Bacteria 2332
48 Ga0068853_100000394 3300005539 Bacteria 29870
49 Ga0068853_100021142 3300005539 Bacteria 5419
50 Ga0068853_100084191 3300005539 Bacteria 2786
51 Ga0068853_100858830 3300005539 Bacteria 871
52 Ga0068853_101025522 3300005539 Bacteria 795
53 Ga0070672_100012411 3300005543 Bacteria 5979
54 Ga0070686_100051206 3300005544 Bacteria 2627
55 Ga0070665_100145154 3300005548 Bacteria 2376
56 Ga0070665_100550617 3300005548 Bacteria 1166
57 Ga0070704_100303822 3300005549 Bacteria 1330
58 Ga0068855_100045215 3300005563 Bacteria 5207
59 Ga0068855_100100067 3300005563 Bacteria 3338
60 Ga0068855_100234696 3300005563 Bacteria 2052
61 Ga0068855_100346982 3300005563 Bacteria 1636
62 Ga0068855_100494617 3300005563 Bacteria 1330
63 Ga0068855_101396215 3300005563 Bacteria 722
64 Ga0070664_100276777 3300005564 Bacteria 1513
65 Ga0068857_100003365 3300005577 Bacteria 13308
66 Ga0068857_100005806 3300005577 Bacteria 10549
67 Ga0068854_100003966 3300005578 Bacteria 9276
68 Ga0068854_100009147 3300005578 Bacteria 6389
69 Ga0068854_100823096 3300005578 Bacteria 811
70 Ga0068856_100002885 3300005614 Bacteria 17586
71 Ga0068856_100059629 3300005614 Bacteria 3769
72 Ga0068856_100313226 3300005614 Bacteria 1587
73 Ga0068856_100628402 3300005614 Bacteria 1095
74 Ga0068856_100642808 3300005614 Bacteria 1081
75 Ga0068856_101258250 3300005614 Bacteria 756
76 Ga0070702_100013586 3300005615 Bacteria 4114
77 Ga0068852_100029092 3300005616 Bacteria 4533
78 Ga0068852_100070502 3300005616 Bacteria 3067
79 Ga0068852_100087753 3300005616 Bacteria 2776
80 Ga0068866_10030405 3300005718 Bacteria 2592
81 Ga0068851_10004148 3300005834 Bacteria 6523
82 Ga0068870_10352072 3300005840 Bacteria 945
83 Ga0068858_100123119 3300005842 Bacteria 2427
84 Ga0068862_100818555 3300005844 Bacteria 910
85 Ga0081455_10039738 3300005937 Bacteria 4154
86 Ga0081455_10045207 3300005937 Bacteria 3833
87 Ga0081455_10446662 3300005937 Bacteria 884
88 Ga0081455_10496526 3300005937 Bacteria 821
89 Ga0081538_10050574 3300005981 Bacteria 2507
90 Ga0081539_10001014 3300005985 Bacteria 51820
91 Ga0081539_10035919 3300005985 Bacteria 2971
92 Ga0070717_10032681 3300006028 Bacteria 4194
93 Ga0070717_10164449 3300006028 Bacteria 1927
94 Ga0070717_10564963 3300006028 Bacteria 1031
95 Ga0070717_10692533 3300006028 Bacteria 926
96 Ga0070717_10987529 3300006028 Bacteria 767
97 Ga0070715_10002760 3300006163 Bacteria 5455
98 Ga0070715_10025029 3300006163 Bacteria 2360
99 Ga0070716_100007223 3300006173 Bacteria 5464
100 Ga0070716_100026589 3300006173 Bacteria 3100
101 Ga0070716_100307239 3300006173 Bacteria 1106
102 Ga0070712_100024896 3300006175 Bacteria 3972
103 Ga0070712_100115260 3300006175 Bacteria 2013
104 Ga0070712_100429155 3300006175 Bacteria 1097
105 Ga0070712_100784712 3300006175 Bacteria 817
106 Ga0075362_10498221 3300006177 Bacteria 623
107 Ga0068865_100269667 3300006881 Bacteria 1351
108 Ga0068865_100609702 3300006881 Bacteria 923
109 Ga0099825_1051985 3300006941 Bacteria 855
110 Ga0099824_1023403 3300006942 Bacteria 3836
111 Ga0099822_1001321 3300006943 Bacteria 28451
112 Ga0099794_10041274 3300007265 Bacteria 2197
113 Ga0105240_10003827 3300009093 Bacteria 23265
114 Ga0105240_10010949 3300009093 Bacteria 12707
115 Ga0105240_10025127 3300009093 Bacteria 7835
116 Ga0105240_10361769 3300009093 Bacteria 1643
117 Ga0105240_10545811 3300009093 Bacteria 1283
118 Ga0111539_10255735 3300009094 Bacteria 2039
119 Ga0105245_10410345 3300009098 Bacteria 1355
120 Ga0105245_11094380 3300009098 Bacteria 843
121 Ga0105241_10000556 3300009174 Bacteria 28213
122 Ga0105241_10225803 3300009174 Bacteria 1576
123 Ga0105241_10399589 3300009174 Bacteria 1205
124 Ga0105241_10435018 3300009174 Bacteria 1157
125 Ga0105242_10839581 3300009176 Bacteria 913
126 Ga0105248_10918370 3300009177 Bacteria 989
127 Ga0105237_10047943 3300009545 Bacteria 4295
128 Ga0105237_10145308 3300009545 Bacteria 2366
129 Ga0105237_10807238 3300009545 Bacteria 945
130 Ga0105237_10897798 3300009545 Bacteria 893
131 Ga0105238_10001118 3300009551 Bacteria 27100
132 Ga0105238_10021839 3300009551 Bacteria 6519
133 Ga0105238_10067737 3300009551 Bacteria 3570
134 Ga0105238_10353337 3300009551 Bacteria 1459
135 Ga0105238_10411567 3300009551 Bacteria 1346
136 Ga0105249_10117532 3300009553 Bacteria 2522
137 Ga0105249_11105357 3300009553 Bacteria 863
138 Ga0105239_10006974 3300010375 Bacteria 13014
139 Ga0105239_10973640 3300010375 Bacteria 975
140 Ga0105246_10329502 3300011119 Bacteria 1244
141 Ga0105246_11582617 3300011119 Bacteria 619
142 Ga0157322_1017834 3300012490 Bacteria 655
143 Ga0157370_10268631 3300013104 Bacteria 1576
144 Ga0157370_10418348 3300013104 Bacteria 1233
145 Ga0157369_10016827 3300013105 Bacteria 8218
146 Ga0157369_10207767 3300013105 Bacteria 2053
147 Ga0157374_10129041 3300013296 Bacteria 2446
148 Ga0157378_11112730 3300013297 Bacteria 827
149 Ga0163162_10122327 3300013306 Bacteria 2707
150 Ga0157372_10182165 3300013307 Bacteria 2432
151 Ga0157372_10556853 3300013307 Bacteria 1336
152 Ga0157372_10806366 3300013307 Bacteria 1091
153 Ga0157372_11680900 3300013307 Bacteria 730
154 Ga0157375_10169545 3300013308 Bacteria 2330
155 Ga0157375_10568983 3300013308 Bacteria 1294
156 Ga0157375_10883148 3300013308 Bacteria 1039
157 Ga0163163_10038427 3300014325 Bacteria 4665
158 Ga0157380_10240698 3300014326 Bacteria 1631
159 Ga0157380_10614612 3300014326 Bacteria 1078
160 Ga0157380_11203563 3300014326 Bacteria 801
161 Ga0157376_10061223 3300014969 Bacteria 3164
162 Ga0163161_10434855 3300017792 Bacteria 1058
163 Ga0163161_11600853 3300017792 Bacteria 574
164 Ga0224712_10315549 3300022467 Bacteria 734
165 Ga0209148_1037096 3300025254 Bacteria 693
166 Ga0209233_1003722 3300025261 Bacteria 5327
167 Ga0207656_10014569 3300025321 Bacteria 3032
168 Ga0207692_10004277 3300025898 Bacteria 5646
169 Ga0207692_10008712 3300025898 Bacteria 4211
170 Ga0207647_10007113 3300025904 Bacteria 8113
171 Ga0207685_10001592 3300025905 Bacteria 4843
172 Ga0207699_10000360 3300025906 Bacteria 24053
173 Ga0207699_10017398 3300025906 Bacteria 3781
174 Ga0207699_10065148 3300025906 Bacteria 2207
175 Ga0207699_10719419 3300025906 Bacteria 731
176 Ga0207654_10000538 3300025911 Bacteria 21703
177 Ga0207707_10003721 3300025912 Bacteria 13504
178 Ga0207707_10096653 3300025912 Bacteria 2581
179 Ga0207695_10000366 3300025913 Bacteria 103345
180 Ga0207695_10099675 3300025913 Bacteria 2902
181 Ga0207695_10120304 3300025913 Bacteria 2595
182 Ga0207695_10138448 3300025913 Bacteria 2386
183 Ga0207671_10219857 3300025914 Bacteria 1488
184 Ga0207671_10374325 3300025914 Bacteria 1131
185 Ga0207671_10609231 3300025914 Bacteria 870
186 Ga0207671_10628908 3300025914 Bacteria 855
187 Ga0207693_10000073 3300025915 Bacteria 89380
188 Ga0207693_10032313 3300025915 Bacteria 4131
189 Ga0207693_10138394 3300025915 Bacteria 1914
190 Ga0207693_10317175 3300025915 Bacteria 1220
191 Ga0207693_10620638 3300025915 Bacteria 841
192 Ga0207663_10043982 3300025916 Bacteria 2738
193 Ga0207663_10045220 3300025916 Bacteria 2707
194 Ga0207660_10067891 3300025917 Bacteria 2584
195 Ga0207657_10224606 3300025919 Bacteria 1503
196 Ga0207652_10051591 3300025921 Bacteria 3527
197 Ga0207652_10478754 3300025921 Bacteria 1121
198 Ga0207681_10491863 3300025923 Bacteria 1003
199 Ga0207694_10001709 3300025924 Bacteria 18372
200 Ga0207694_10017077 3300025924 Bacteria 5482
201 Ga0207694_10088228 3300025924 Bacteria 2445
202 Ga0207694_11017146 3300025924 Bacteria 701
203 Ga0207687_10178007 3300025927 Bacteria 1645
204 Ga0207700_10034750 3300025928 Bacteria 3622
205 Ga0207700_10139086 3300025928 Bacteria 1993
206 Ga0207700_10140077 3300025928 Bacteria 1986
207 Ga0207664_10106842 3300025929 Bacteria 2321
208 Ga0207664_10374588 3300025929 Bacteria 1263
209 Ga0207690_10250433 3300025932 Bacteria 1368
210 Ga0207706_10132711 3300025933 Bacteria 2190
211 Ga0207686_10713689 3300025934 Bacteria 798
212 Ga0207669_10115146 3300025937 Bacteria 1811
213 Ga0207704_10474503 3300025938 Bacteria 1003
214 Ga0207704_10491326 3300025938 Bacteria 987
215 Ga0207704_10876449 3300025938 Bacteria 754
216 Ga0207665_10000629 3300025939 Bacteria 23661
217 Ga0207665_10061881 3300025939 Bacteria 2539
218 Ga0207665_10226346 3300025939 Bacteria 1373
219 Ga0207691_10177935 3300025940 Bacteria 1860
220 Ga0207711_10604761 3300025941 Bacteria 1023
221 Ga0207689_10379954 3300025942 Bacteria 1176
222 Ga0207661_10032589 3300025944 Bacteria 4037
223 Ga0207679_10802862 3300025945 Bacteria 858
224 Ga0207667_10002298 3300025949 Bacteria 24013
225 Ga0207667_10014888 3300025949 Bacteria 8845
226 Ga0207667_10195274 3300025949 Bacteria 2076
227 Ga0207667_10241480 3300025949 Bacteria 1848
228 Ga0207667_10604583 3300025949 Bacteria 1105
229 Ga0207667_10935962 3300025949 Bacteria 857
230 Ga0207712_10052003 3300025961 Bacteria 2868
231 Ga0207668_10101289 3300025972 Bacteria 2140
232 Ga0207640_10049724 3300025981 Bacteria 2716
233 Ga0207640_10968465 3300025981 Bacteria 747
234 Ga0207658_11016494 3300025986 Bacteria 756
235 Ga0207639_10002667 3300026041 Bacteria 11978
236 Ga0207639_10065898 3300026041 Bacteria 2813
237 Ga0207639_10289658 3300026041 Bacteria 1443
238 Ga0207639_10836249 3300026041 Bacteria 859
239 Ga0207678_10073356 3300026067 Bacteria 2933
240 Ga0207708_10038351 3300026075 Bacteria 3650
241 Ga0207702_10000453 3300026078 Bacteria 46229
242 Ga0207702_10032539 3300026078 Bacteria 4352
243 Ga0207702_11372513 3300026078 Bacteria 701
244 Ga0207702_11730374 3300026078 Bacteria 618
245 Ga0207702_11734473 3300026078 Bacteria 617
246 Ga0207641_10235160 3300026088 Bacteria 1705
247 Ga0207674_10006606 3300026116 Bacteria 13631
248 Ga0207674_10007557 3300026116 Bacteria 12663
249 Ga0207675_100805206 3300026118 Bacteria 953
250 Ga0207683_10142711 3300026121 Bacteria 2158
251 Ga0207698_10032442 3300026142 Bacteria 3783
252 Ga0207698_10096343 3300026142 Bacteria 2438
253 Ga0207698_10309443 3300026142 Bacteria 1474
254 Ga0209589_1000026 3300027357 Bacteria 158154
255 Ga0209489_100046 3300027361 Bacteria 158154
256 Ga0209700_100047 3300027363 Bacteria 158154
257 Ga0207428_10181128 3300027907 Bacteria 1592
258 Ga0268266_10404819 3300028379 Bacteria 1291
259 Ga0268264_10314635 3300028381 Bacteria 1478
260 Ga0265330_10019516 3300031235 Bacteria 3106
261 Ga0265330_10097457 3300031235 Bacteria 1260
262 Ga0265332_10205036 3300031238 Bacteria 819
263 Ga0265328_10099924 3300031239 Bacteria 1074
264 Ga0265325_10054209 3300031241 Bacteria 2053
265 Ga0265329_10145088 3300031242 Bacteria 768
266 Ga0265340_10001209 3300031247 Bacteria 14775
267 Ga0265339_10274213 3300031249 Bacteria 810
268 Ga0265331_10099940 3300031250 Bacteria 1336
269 Ga0265331_10180781 3300031250 Bacteria 953
270 Ga0265316_10151646 3300031344 Bacteria 1736
271 Ga0265316_10710490 3300031344 Bacteria 708
272 Ga0307513_10208951 3300031456 Bacteria 1785
273 Ga0307408_100519028 3300031548 Bacteria 1046
274 Ga0307408_100706468 3300031548 Bacteria 907
275 Ga0307508_10000005 3300031616 Bacteria 286511
276 Ga0307508_10119212 3300031616 Bacteria 2241
277 Ga0265314_10231400 3300031711 Bacteria 1072
278 Ga0307516_10356017 3300031730 Bacteria 1129
279 Ga0307413_10123981 3300031824 Bacteria 1755
280 Ga0307407_10254612 3300031903 Bacteria 1205
281 Ga0307416_101193611 3300032002 Bacteria 866
282 Ga0315911_1000035 3300033442 Bacteria 66589
283 Ga0373940_0056399 3300035088 Bacteria 1114
284 Ga0373940_0216134 3300035088 Bacteria 635
285 Ga0373939_0333952 3300035114 Bacteria 613
286 Ga0373945_0036458 3300035116 Bacteria 1762
287 Ga0373954_0077480 3300035118 Bacteria 1585
288 Ga0373957_0013607 3300035120 Bacteria 2764
289 Ga0373943_0015780 3300035170 Bacteria 3435
290 Ga0373943_0018606 3300035170 Bacteria 3193
291 Ga0373943_0203010 3300035170 Bacteria 1098
292 Ga0373943_0708187 3300035170 Bacteria 597
293 Ga0373946_0122726 3300035171 Bacteria 1187
294 Ga0373955_0020052 3300035172 Bacteria 3354
295 Ga0373961_0269299 3300035241 Bacteria 622
296 Ga0373931_0032222 3300035691 Bacteria 2711
297 Ga0373931_0158549 3300035691 Bacteria 1325
298 Ga0373931_0264677 3300035691 Bacteria 1050
299 Ga0373935_0292991 3300035692 Bacteria 1148
300 Ga0373927_0078421 3300035695 Bacteria 2139
301 Ga0373927_0119275 3300035695 Bacteria 1721
302 Ga0373933_0000277 3300035724 Bacteria 33337
303 Ga0373933_0115600 3300035724 Bacteria 1676
304 Ga0373933_0128594 3300035724 Bacteria 1591
305 Ga0373947_0013693 3300035725 Bacteria 4647
306 Ga0373937_0012106 3300036401 Bacteria 7572
307 Ga0373937_0280101 3300036401 Bacteria 1574
308 Ga0373925_0016508 3300037068 Bacteria 5349
309 Ga0373925_0164835 3300037068 Bacteria 1747
310 Ga0373925_0339409 3300037068 Bacteria 1218
311 Ga0395899_0095816 3300037312 Bacteria 2146
312 Ga0395899_0165601 3300037312 Bacteria 1560
313 Ga0395900_0005919 3300037418 Bacteria 12766
314 Ga0395900_0265512 3300037418 Bacteria 1712
315 Ga0395900_0329922 3300037418 Bacteria 1504
316 Ga0395898_0080592 3300037466 Bacteria 3139
317 Ga0395898_0191857 3300037466 Bacteria 1952
318 Ga0395898_0581507 3300037466 Bacteria 1062
319 Ga0395905_0065185 3300037471 Bacteria 3410
320 Ga0395905_0343598 3300037471 Bacteria 1384
321 Ga0395905_0520023 3300037471 Bacteria 1091
322 Ga0395905_0610301 3300037471 Bacteria 993
323 Ga0436364_0971828 3300037853 Bacteria 2406
324 Ga0395901_0049784 3300038443 Bacteria 4354
325 Ga0395901_0270292 3300038443 Bacteria 1768
326 Ga0436365_0114911 3300039437 Bacteria 771
327 Ga0436365_0641798 3300039437 Bacteria 1248
328 Ga0436360_0025635 3300039438 Bacteria 2006
329 Ga0436360_0126272 3300039438 Bacteria 831
330 Ga0436360_1288387 3300039438 Bacteria 785
331 Ga0436361_0208086 3300039447 Bacteria 2691
332 Ga0436363_0317332 3300039450 Bacteria 581
333 Ga0436363_0483223 3300039450 Bacteria 1334
334 Ga0436363_0891060 3300039450 Bacteria 997
335 Ga0436363_1572509 3300039450 Bacteria 4714
336 Ga0436362_0415444 3300039453 Bacteria 975
337 Ga0451791_0266516 3300041451 Bacteria 652
338 Ga0451839_0145521 3300041496 Bacteria 620
339 Ga0451841_0383047 3300041498 Bacteria 701
340 Ga0451847_0266158 3300041503 Bacteria 613
341 Ga0451851_0204890 3300041507 Bacteria 867
342 Ga0451853_3647681 3300041512 Bacteria 553
343 Ga0439431_0048116 3300041997 Bacteria 1101
344 Ga0439445_0067960 3300042004 Bacteria 983
345 Ga0466969_0042236 3300044656 Bacteria 2278
346 Ga0466969_0148299 3300044656 Bacteria 1081
347 Ga0466969_0173936 3300044656 Bacteria 987
348 Ga0466965_0252190 3300044683 Bacteria 947
349 Ga0466966_0145950 3300044684 Bacteria 1444
350 Ga0466964_0310995 3300044706 Bacteria 797
351 Ga0466964_0730319 3300044706 Bacteria 554
352 Ga0466959_0062877 3300045049 Bacteria 2697
353 Ga0466959_0444200 3300045049 Bacteria 880
354 Ga0466958_0364785 3300045836 Bacteria 931
355 Ga0466967_0034932 3300045976 Bacteria 4273
356 Ga0466967_0071213 3300045976 Bacteria 3112
357 Ga0495592_0022768 3300046454 Bacteria 4765
358 Ga0495603_0006019 3300046455 Bacteria 7251
359 Ga0495603_0066730 3300046455 Bacteria 2119
360 Ga0495603_0228227 3300046455 Bacteria 1074
361 Ga0495590_0067128 3300046457 Bacteria 1257
362 Ga0495629_0049319 3300046459 Bacteria 2951
363 Ga0495629_0122329 3300046459 Bacteria 1813
364 Ga0495638_0063919 3300046460 Bacteria 2268
365 Ga0495651_0028449 3300046462 Bacteria 4355
366 Ga0495580_0019910 3300046472 Bacteria 4976
367 Ga0495580_0085216 3300046472 Bacteria 2201
368 Ga0495582_0036829 3300046473 Bacteria 2691
369 Ga0495582_0123335 3300046473 Bacteria 1461
370 Ga0495605_0253237 3300046474 Bacteria 753
371 Ga0495639_0056089 3300046475 Bacteria 1798
372 Ga0495639_0549321 3300046475 Bacteria 592
373 Ga0495662_0044289 3300046476 Bacteria 2149
374 Ga0495664_0024378 3300046477 Bacteria 3515
375 Ga0495664_0054940 3300046477 Bacteria 2369
376 Ga0495594_0200532 3300046499 Bacteria 1137
377 Ga0495594_0213996 3300046499 Bacteria 1099
378 Ga0495594_0576445 3300046499 Bacteria 638
379 Ga0495596_0096906 3300046500 Bacteria 1145
380 Ga0495583_0257515 3300046506 Bacteria 699
381 Ga0495606_0082466 3300046507 Bacteria 1996
382 Ga0495606_0139328 3300046507 Bacteria 1434
383 Ga0495630_0015076 3300046517 Bacteria 5639
384 Ga0495631_0237023 3300046518 Bacteria 778
385 Ga0495632_0068529 3300046519 Bacteria 1709
386 Ga0495632_0278899 3300046519 Bacteria 744
387 Ga0495644_0177693 3300046523 Bacteria 818
388 Ga0495644_0191421 3300046523 Bacteria 787
389 Ga0495652_0160096 3300046529 Bacteria 1749
390 Ga0495665_0212898 3300046531 Bacteria 1000
391 Ga0495640_0051208 3300046533 Bacteria 2839
392 Ga0495598_0047934 3300046537 Bacteria 1276
393 Ga0495598_0090102 3300046537 Bacteria 999
394 Ga0495645_0004961 3300046543 Bacteria 9109
395 Ga0495667_0306162 3300046559 Bacteria 1006
396 Ga0495656_0029787 3300046615 Bacteria 2200
397 Ga0495668_0447648 3300046616 Bacteria 711
398 Ga0495625_0476151 3300046660 Bacteria 767
399 Ga0495625_0628159 3300046660 Bacteria 642
400 Ga0495635_0154668 3300046663 Bacteria 1561
401 Ga0495659_0173531 3300046664 Bacteria 875
402 Ga0495599_0168920 3300046678 Bacteria 1350
403 Ga0495599_0479128 3300046678 Bacteria 734
404 Ga0495647_0081584 3300046681 Bacteria 1312
405 Ga0495647_0329345 3300046681 Bacteria 692
406 Ga0495658_0337952 3300046683 Bacteria 956
407 Ga0495669_0033533 3300046684 Bacteria 2260
408 Ga0495669_0096629 3300046684 Bacteria 1369
409 Ga0495669_0265345 3300046684 Bacteria 825
410 Ga0495613_0451989 3300046689 Bacteria 870
411 Ga0495624_0027494 3300046690 Bacteria 3724
412 Ga0495624_0174910 3300046690 Bacteria 1309
413 Ga0495589_0064276 3300046794 Bacteria 1799
414 Ga0495589_0181239 3300046794 Bacteria 999
415 Ga0495581_0046820 3300047315 Bacteria 2499
416 Ga0495581_0163134 3300047315 Bacteria 1303
417 Ga0495674_0048964 3300047319 Bacteria 3736
418 Ga0495676_0234512 3300047321 Bacteria 1259
419 Ga0495677_0175824 3300047445 Bacteria 829
420 Ga0495685_116515 3300047447 Bacteria 878
421 Ga0495681_0109404 3300047470 Bacteria 1199
422 Ga0495686_0158941 3300047472 Bacteria 1322
423 Ga0495593_0005454 3300047673 Bacteria 7514
424 Ga0495602_0287598 3300048088 Bacteria 1208
425 Ga0495602_0350062 3300048088 Bacteria 1066
426 Ga0496100_0189456 3300048903 Bacteria 1492
427 Ga0496100_0434515 3300048903 Bacteria 1004
428 Ga0496100_1247179 3300048903 Bacteria 587
429 Ga0496101_0078600 3300048904 Bacteria 2434
430 Ga0496101_1226087 3300048904 Bacteria 587
431 Ga0496102_0171212 3300048905 Bacteria 2044
432 Ga0496102_1775448 3300048905 Bacteria 534
433 Ga0496103_0242678 3300048906 Bacteria 1159
434 Ga0496104_0020896 3300048907 Bacteria 6004
435 Ga0496104_0022858 3300048907 Bacteria 5745
436 Ga0496104_0832423 3300048907 Bacteria 829
437 Ga0496105_0253213 3300048908 Bacteria 1426
438 Ga0496105_0343995 3300048908 Bacteria 1192
439 Ga0496106_0000810 3300048909 Bacteria 22635
440 Ga0496106_0014681 3300048909 Bacteria 5790
441 Ga0496106_0707806 3300048909 Bacteria 802
442 Ga0496108_0000553 3300048911 Bacteria 29302
443 Ga0496108_0021077 3300048911 Bacteria 5355
444 Ga0496108_1262121 3300048911 Bacteria 623
445 Ga0496109_0000574 3300048912 Bacteria 30746
446 Ga0496109_0861756 3300048912 Bacteria 844
447 Ga0496110_0005711 3300048913 Bacteria 9773
448 Ga0496110_0024914 3300048913 Bacteria 5106
449 Ga0496110_0029231 3300048913 Bacteria 4741
450 Ga0496111_0206370 3300048914 Bacteria 1460
451 Ga0496112_0002964 3300048915 Bacteria 13848
452 Ga0496112_0192368 3300048915 Bacteria 2001
453 Ga0496112_0295037 3300048915 Bacteria 1567
454 Ga0496112_0504827 3300048915 Bacteria 1145
455 Ga0496113_0156113 3300048916 Bacteria 1802
456 Ga0496114_0346324 3300048917 Bacteria 1314
457 Ga0496114_0379995 3300048917 Bacteria 1250
458 Ga0496114_0701495 3300048917 Bacteria 887
459 Ga0496115_0214733 3300048918 Bacteria 1588
460 Ga0496115_0561033 3300048918 Bacteria 912
461 Ga0496115_0572777 3300048918 Bacteria 900
462 Ga0496119_0317910 3300048922 Bacteria 763
463 Ga0496121_0021056 3300048924 Bacteria 6411
464 Ga0496121_0032360 3300048924 Bacteria 4755
465 Ga0496121_0123287 3300048924 Bacteria 1953
466 Ga0496121_0324630 3300048924 Bacteria 1035
467 Ga0496121_0652168 3300048924 Bacteria 641
468 Ga0496122_0139371 3300048925 Bacteria 1520
469 Ga0496122_0539976 3300048925 Bacteria 558
470 Ga0496123_0172118 3300048926 Bacteria 1141
471 Ga0496124_0016867 3300048927 Bacteria 6921
472 Ga0496125_0004420 3300048928 Bacteria 16237
473 Ga0496125_0099370 3300048928 Bacteria 2150
474 Ga0496125_0326714 3300048928 Bacteria 927
475 Ga0496126_0006400 3300048929 Bacteria 13132
476 Ga0496126_0011673 3300048929 Bacteria 9063
477 Ga0496126_0019226 3300048929 Bacteria 6732
478 Ga0496126_0076440 3300048929 Bacteria 2970
479 Ga0496126_0099301 3300048929 Bacteria 2550
480 Ga0496126_0134202 3300048929 Bacteria 2136
481 Ga0496126_0267842 3300048929 Bacteria 1418
482 Ga0496126_0497522 3300048929 Bacteria 975
483 Ga0496126_1010303 3300048929 Bacteria 623
484 Ga0501031_0000869 3300049568 Bacteria 18186
485 Ga0501032_0000309 3300049569 Bacteria 41024
486 Ga0501032_0107750 3300049569 Bacteria 1845
487 Ga0501033_0001798 3300049570 Bacteria 18709
488 Ga0501033_0308964 3300049570 Bacteria 1112
489 Ga0501034_0000082 3300049571 Bacteria 170039
490 Ga0501036_0000121 3300049572 Bacteria 48901
491 Ga0501037_0000346 3300049573 Bacteria 39162
492 Ga0501038_0065277 3300049574 Bacteria 3102
493 Ga0501039_0009593 3300049575 Bacteria 7379
494 Ga0501043_0000109 3300049579 Bacteria 77120
495 Ga0501043_0134839 3300049579 Bacteria 1934
496 Ga0501046_0000101 3300049580 Bacteria 91179
497 Ga0501046_0154066 3300049580 Bacteria 1733
498 Ga0501047_0000331 3300049581 Bacteria 54371
499 Ga0501047_0225666 3300049581 Bacteria 1728
500 Ga0501047_1005685 3300049581 Bacteria 647
501 Ga0501048_0002703 3300049582 Bacteria 13534
502 Ga0501067_0000534 3300049583 Bacteria 20715
503 Ga0501067_0096394 3300049583 Bacteria 1642
504 Ga0501068_0000276 3300049584 Bacteria 25409
505 Ga0501069_0635641 3300049585 Bacteria 642
506 Ga0501070_0166875 3300049586 Bacteria 1814
507 Ga0501071_0052281 3300049587 Bacteria 2946
508 Ga0501072_0004822 3300049588 Bacteria 10270
509 Ga0501073_0000101 3300049589 Bacteria 54365
510 Ga0501074_0000187 3300049590 Bacteria 33711
511 Ga0501076_0811965 3300049592 Bacteria 772
512 Ga0501079_0001908 3300049741 Bacteria 14946
513 Ga0501080_0000151 3300049742 Bacteria 49588
514 Ga0501080_0490526 3300049742 Bacteria 1099
515 Ga0501083_0007235 3300049744 Bacteria 7881
516 Ga0501035_0000150 3300049822 Bacteria 85450
517 Ga0501035_0256721 3300049822 Bacteria 1483
518 Ga0501044_0000247 3300049823 Bacteria 68674
519 Ga0501044_0114264 3300049823 Bacteria 2706
520 Ga0501044_0134311 3300049823 Bacteria 2466
521 Ga0501044_0251749 3300049823 Bacteria 1707
522 Ga0501044_0370122 3300049823 Bacteria 1350
523 Ga0501045_0183883 3300049824 Bacteria 1557
524 nmdc:mga08y16_30607_c1 3300050511 Bacteria 5663
525 Ga0495601_0016798 3300053077 Bacteria 4439
526 Ga0495601_0031405 3300053077 Bacteria 3301
527 Ga0495601_0213306 3300053077 Bacteria 1261
528 Ga0495612_0011897 3300053078 Bacteria 3508
529 Ga0495612_0024578 3300053078 Bacteria 2418
530 Ga0500594_0179245 3300053118 Bacteria 691
531 Ga0500595_034078 3300053119 Bacteria 1686
532 Ga0500590_032661 3300053148 Bacteria 2700
533 Ga0500636_0049777 3300053177 Bacteria 2464
534 Ga0500611_194436 3300053727 Bacteria 573
535 Ga0500645_032291 3300053730 Bacteria 1570
536 Ga0501084_0018973 3300054114 Bacteria 5725
537 Ga0590075_100995 3300059424 Bacteria 751
538 Ga0501082_0000706 3300060353 Bacteria 29338

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005440 Ga0070705_100318922 Ga0070705_1003189222 114
2 iso_pu_bacteria 2847930680 2847930739 126
3 iso_pu_bacteria 2879083081 2879089879 126
4 iso_pu_bacteria 2906643746 2906648058 126
5 3300053177 Ga0500636_0049777 Ga0500636_0049777_948_1430 127
6 3300028379 Ga0268266_10404819 Ga0268266_104048192 130
7 3300048924 Ga0496121_0032360 Ga0496121_0032360_2848_3327 130
8 3300048929 Ga0496126_0099301 Ga0496126_0099301_337_816 130
9 3300005336 Ga0070680_101253423 Ga0070680_1012534231 131
10 3300005344 Ga0070661_100292393 Ga0070661_1002923932 131
11 3300031242 Ga0265329_10145088 Ga0265329_101450882 131
12 3300031249 Ga0265339_10274213 Ga0265339_102742131 131
13 3300031344 Ga0265316_10710490 Ga0265316_107104902 131
14 3300031711 Ga0265314_10231400 Ga0265314_102314002 131
15 3300039437 Ga0436365_0641798 Ga0436365_0641798_149_637 131
16 3300046457 Ga0495590_0067128 Ga0495590_0067128_396_863 131
17 3300046474 Ga0495605_0253237 Ga0495605_0253237_99_566 131
18 3300046518 Ga0495631_0237023 Ga0495631_0237023_249_716 131
19 3300046519 Ga0495632_0278899 Ga0495632_0278899_141_608 131
20 3300046660 Ga0495625_0628159 Ga0495625_0628159_55_522 131
21 3300046684 Ga0495669_0096629 Ga0495669_0096629_420_887 131
22 3300046794 Ga0495589_0181239 Ga0495589_0181239_393_860 131
23 3300047445 Ga0495677_0175824 Ga0495677_0175824_203_670 131
24 3300005614 Ga0068856_100642808 Ga0068856_1006428082 132
25 3300037471 Ga0395905_0343598 Ga0395905_0343598_779_1246 132
26 3300039438 Ga0436360_0126272 Ga0436360_0126272_314_799 132
27 3300045976 Ga0466967_0034932 Ga0466967_0034932_1900_2379 132
28 3300048915 Ga0496112_0295037 Ga0496112_0295037_89_556 132
29 3300006028 Ga0070717_10692533 Ga0070717_106925331 133
30 3300006173 Ga0070716_100307239 Ga0070716_1003072392 133
31 3300006175 Ga0070712_100429155 Ga0070712_1004291551 133
32 3300025915 Ga0207693_10317175 Ga0207693_103171752 133
33 3300025939 Ga0207665_10226346 Ga0207665_102263462 133
34 3300048912 Ga0496109_0861756 Ga0496109_0861756_223_705 133
35 3300048918 Ga0496115_0572777 Ga0496115_0572777_355_837 133
36 3300005434 Ga0070709_10012256 Ga0070709_100122563 134
37 3300005436 Ga0070713_100079890 Ga0070713_1000798903 134
38 3300005439 Ga0070711_100037156 Ga0070711_1000371562 134
39 3300005937 Ga0081455_10045207 Ga0081455_100452074 134
40 3300025916 Ga0207663_10045220 Ga0207663_100452204 134
41 3300046507 Ga0495606_0139328 Ga0495606_0139328_218_694 134
42 3300046616 Ga0495668_0447648 Ga0495668_0447648_154_630 134
43 3300048918 Ga0496115_0214733 Ga0496115_0214733_956_1444 134
44 3300048924 Ga0496121_0324630 Ga0496121_0324630_346_825 134
45 3300031344 Ga0265316_10151646 Ga0265316_101516463 135
46 3300039450 Ga0436363_0317332 Ga0436363_0317332_55_549 135
47 3300005536 Ga0070697_100106544 Ga0070697_1001065442 136
48 3300007265 Ga0099794_10041274 Ga0099794_100412744 136
49 3300031238 Ga0265332_10205036 Ga0265332_102050362 137
50 3300031250 Ga0265331_10099940 Ga0265331_100999402 137
51 3300035691 Ga0373931_0032222 Ga0373931_0032222_1992_2477 137
52 3300046460 Ga0495638_0063919 Ga0495638_0063919_796_1269 137
53 3300005344 Ga0070661_101461969 Ga0070661_1014619691 138
54 3300006941 Ga0099825_1051985 Ga0099825_10519851 138
55 3300006942 Ga0099824_1023403 Ga0099824_10234032 138
56 3300006943 Ga0099822_1001321 Ga0099822_10013216 138
57 3300013307 Ga0157372_10806366 Ga0157372_108063662 138
58 3300025906 Ga0207699_10017398 Ga0207699_100173985 138
59 3300025913 Ga0207695_10099675 Ga0207695_100996751 138
60 3300027357 Ga0209589_1000026 Ga0209589_1000026102 138
61 3300027361 Ga0209489_100046 Ga0209489_100046102 138
62 3300027363 Ga0209700_100047 Ga0209700_100047102 138
63 3300031241 Ga0265325_10054209 Ga0265325_100542093 138
64 3300041451 Ga0451791_0266516 Ga0451791_0266516_97_573 138
65 3300046678 Ga0495599_0168920 Ga0495599_0168920_397_882 138
66 3300048929 Ga0496126_0497522 Ga0496126_0497522_178_648 138
67 3300006028 Ga0070717_10564963 Ga0070717_105649632 139
68 3300006028 Ga0070717_10987529 Ga0070717_109875292 139
69 3300006175 Ga0070712_100784712 Ga0070712_1007847122 139
70 3300012490 Ga0157322_1017834 Ga0157322_10178342 139
71 3300025915 Ga0207693_10138394 Ga0207693_101383944 139
72 3300035114 Ga0373939_0333952 Ga0373939_0333952_43_516 139
73 3300042004 Ga0439445_0067960 Ga0439445_0067960_440_913 139
74 3300045049 Ga0466959_0444200 Ga0466959_0444200_350_835 139
75 3300048913 Ga0496110_0024914 Ga0496110_0024914_3965_4447 139
76 3300048914 Ga0496111_0206370 Ga0496111_0206370_236_718 139
77 3300048915 Ga0496112_0192368 Ga0496112_0192368_233_715 139
78 3300037466 Ga0395898_0581507 Ga0395898_0581507_211_696 140
79 3300038443 Ga0395901_0270292 Ga0395901_0270292_945_1430 140
80 3300041512 Ga0451853_3647681 Ga0451853_3647681_25_489 140
81 3300046459 Ga0495629_0122329 Ga0495629_0122329_514_996 140
82 3300046531 Ga0495665_0212898 Ga0495665_0212898_266_748 140
83 3300046690 Ga0495624_0174910 Ga0495624_0174910_132_614 140
84 3300049583 Ga0501067_0096394 Ga0501067_0096394_892_1365 140
85 3300000549 LJQas_1002886 LJQas_10028863 141
86 3300005329 Ga0070683_100053436 Ga0070683_1000534361 141
87 3300005336 Ga0070680_100013669 Ga0070680_1000136695 141
88 3300005458 Ga0070681_10031521 Ga0070681_100315216 141
89 3300005530 Ga0070679_100037345 Ga0070679_1000373456 141
90 3300005535 Ga0070684_100006424 Ga0070684_10000642410 141
91 3300005563 Ga0068855_100234696 Ga0068855_1002346963 141
92 3300005937 Ga0081455_10446662 Ga0081455_104466622 141
93 3300006177 Ga0075362_10498221 Ga0075362_104982211 141
94 3300009093 Ga0105240_10025127 Ga0105240_100251275 141
95 3300009093 Ga0105240_10361769 Ga0105240_103617691 141
96 3300009174 Ga0105241_10399589 Ga0105241_103995892 141
97 3300013105 Ga0157369_10016827 Ga0157369_100168275 141
98 3300013105 Ga0157369_10207767 Ga0157369_102077672 141
99 3300013307 Ga0157372_10182165 Ga0157372_101821652 141
100 3300013307 Ga0157372_10556853 Ga0157372_105568532 141
101 3300022467 Ga0224712_10315549 Ga0224712_103155491 141
102 3300025254 Ga0209148_1037096 Ga0209148_10370962 141
103 3300025906 Ga0207699_10065148 Ga0207699_100651484 141
104 3300025912 Ga0207707_10003721 Ga0207707_100037217 141
105 3300025913 Ga0207695_10138448 Ga0207695_101384483 141
106 3300025914 Ga0207671_10374325 Ga0207671_103743252 141
107 3300025917 Ga0207660_10067891 Ga0207660_100678912 141
108 3300025921 Ga0207652_10051591 Ga0207652_100515914 141
109 3300025928 Ga0207700_10139086 Ga0207700_101390861 141
110 3300025944 Ga0207661_10032589 Ga0207661_100325892 141
111 3300025949 Ga0207667_10195274 Ga0207667_101952743 141
112 3300026041 Ga0207639_10065898 Ga0207639_100658982 141
113 3300026142 Ga0207698_10309443 Ga0207698_103094431 141
114 3300031250 Ga0265331_10180781 Ga0265331_101807812 141
115 3300035116 Ga0373945_0036458 Ga0373945_0036458_1046_1528 141
116 3300035170 Ga0373943_0015780 Ga0373943_0015780_1910_2392 141
117 3300035171 Ga0373946_0122726 Ga0373946_0122726_674_1156 141
118 3300035725 Ga0373947_0013693 Ga0373947_0013693_2612_3094 141
119 3300037068 Ga0373925_0164835 Ga0373925_0164835_104_586 141
120 3300037312 Ga0395899_0165601 Ga0395899_0165601_494_976 141
121 3300037418 Ga0395900_0005919 Ga0395900_0005919_10410_10892 141
122 3300037466 Ga0395898_0080592 Ga0395898_0080592_349_831 141
123 3300038443 Ga0395901_0049784 Ga0395901_0049784_935_1417 141
124 3300044656 Ga0466969_0173936 Ga0466969_0173936_108_596 141
125 3300044683 Ga0466965_0252190 Ga0466965_0252190_77_565 141
126 3300046455 Ga0495603_0006019 Ga0495603_0006019_1651_2133 141
127 3300046472 Ga0495580_0085216 Ga0495580_0085216_556_1038 141
128 3300046475 Ga0495639_0056089 Ga0495639_0056089_63_545 141
129 3300046477 Ga0495664_0024378 Ga0495664_0024378_2724_3221 141
130 3300046543 Ga0495645_0004961 Ga0495645_0004961_5943_6440 141
131 3300046683 Ga0495658_0337952 Ga0495658_0337952_379_861 141
132 3300047315 Ga0495581_0163134 Ga0495581_0163134_311_793 141
133 3300047321 Ga0495676_0234512 Ga0495676_0234512_732_1214 141
134 3300047470 Ga0495681_0109404 Ga0495681_0109404_346_813 141
135 3300048908 Ga0496105_0343995 Ga0496105_0343995_299_781 141
136 3300048915 Ga0496112_0504827 Ga0496112_0504827_443_913 141
137 3300048929 Ga0496126_0267842 Ga0496126_0267842_549_1040 141
138 3300053077 Ga0495601_0031405 Ga0495601_0031405_2498_2995 141
139 3300053078 Ga0495612_0024578 Ga0495612_0024578_360_857 141
140 3300005338 Ga0068868_100702377 Ga0068868_1007023771 142
141 3300005434 Ga0070709_10010369 Ga0070709_100103696 142
142 3300005435 Ga0070714_100011580 Ga0070714_1000115803 142
143 3300005436 Ga0070713_100000768 Ga0070713_1000007682 142
144 3300005437 Ga0070710_10001851 Ga0070710_100018519 142
145 3300005439 Ga0070711_100008471 Ga0070711_1000084714 142
146 3300005539 Ga0068853_100084191 Ga0068853_1000841912 142
147 3300005840 Ga0068870_10352072 Ga0068870_103520721 142
148 3300006028 Ga0070717_10032681 Ga0070717_100326813 142
149 3300006163 Ga0070715_10002760 Ga0070715_100027601 142
150 3300006163 Ga0070715_10025029 Ga0070715_100250293 142
151 3300006173 Ga0070716_100026589 Ga0070716_1000265891 142
152 3300006175 Ga0070712_100115260 Ga0070712_1001152603 142
153 3300025898 Ga0207692_10004277 Ga0207692_100042777 142
154 3300025898 Ga0207692_10008712 Ga0207692_100087125 142
155 3300025905 Ga0207685_10001592 Ga0207685_100015926 142
156 3300025915 Ga0207693_10000073 Ga0207693_1000007337 142
157 3300025915 Ga0207693_10032313 Ga0207693_100323136 142
158 3300025916 Ga0207663_10043982 Ga0207663_100439823 142
159 3300025928 Ga0207700_10140077 Ga0207700_101400773 142
160 3300025938 Ga0207704_10876449 Ga0207704_108764492 142
161 3300025939 Ga0207665_10000629 Ga0207665_100006296 142
162 3300031730 Ga0307516_10356017 Ga0307516_103560172 142
163 3300037418 Ga0395900_0329922 Ga0395900_0329922_466_939 142
164 3300039438 Ga0436360_0025635 Ga0436360_0025635_1421_1906 142
165 3300039447 Ga0436361_0208086 Ga0436361_0208086_1223_1708 142
166 3300039450 Ga0436363_0483223 Ga0436363_0483223_530_1015 142
167 3300039453 Ga0436362_0415444 Ga0436362_0415444_339_824 142
168 3300041498 Ga0451841_0383047 Ga0451841_0383047_180_653 142
169 3300046499 Ga0495594_0200532 Ga0495594_0200532_645_1118 142
170 3300046523 Ga0495644_0191421 Ga0495644_0191421_217_690 142
171 3300046537 Ga0495598_0047934 Ga0495598_0047934_315_788 142
172 3300046615 Ga0495656_0029787 Ga0495656_0029787_495_968 142
173 3300046664 Ga0495659_0173531 Ga0495659_0173531_26_499 142
174 3300047447 Ga0495685_116515 Ga0495685_116515_339_812 142
175 3300049585 Ga0501069_0635641 Ga0501069_0635641_151_621 142
176 3300005434 Ga0070709_10001043 Ga0070709_100010439 143
177 3300005435 Ga0070714_100019087 Ga0070714_1000190874 143
178 3300005436 Ga0070713_100030913 Ga0070713_1000309135 143
179 3300005539 Ga0068853_101025522 Ga0068853_1010255222 143
180 3300005563 Ga0068855_100346982 Ga0068855_1003469822 143
181 3300006173 Ga0070716_100007223 Ga0070716_1000072235 143
182 3300006175 Ga0070712_100024896 Ga0070712_1000248964 143
183 3300009098 Ga0105245_10410345 Ga0105245_104103453 143
184 3300009551 Ga0105238_10067737 Ga0105238_100677374 143
185 3300013296 Ga0157374_10129041 Ga0157374_101290412 143
186 3300025906 Ga0207699_10000360 Ga0207699_1000036013 143
187 3300025914 Ga0207671_10609231 Ga0207671_106092312 143
188 3300025924 Ga0207694_10017077 Ga0207694_100170774 143
189 3300025928 Ga0207700_10034750 Ga0207700_100347505 143
190 3300025929 Ga0207664_10106842 Ga0207664_101068421 143
191 3300025939 Ga0207665_10061881 Ga0207665_100618812 143
192 3300025949 Ga0207667_10604583 Ga0207667_106045832 143
193 3300026041 Ga0207639_10836249 Ga0207639_108362492 143
194 3300032002 Ga0307416_101193611 Ga0307416_1011936111 143
195 3300035170 Ga0373943_0708187 Ga0373943_0708187_73_546 143
196 3300035724 Ga0373933_0000277 Ga0373933_0000277_2169_2645 143
197 3300048905 Ga0496102_1775448 Ga0496102_1775448_39_509 143
198 3300048924 Ga0496121_0652168 Ga0496121_0652168_88_564 143
199 3300003203 JGI25406J46586_10015879 JGI25406J46586_100158794 144
200 3300005548 Ga0070665_100550617 Ga0070665_1005506172 144
201 3300005985 Ga0081539_10001014 Ga0081539_1000101439 144
202 3300009553 Ga0105249_11105357 Ga0105249_111053572 144
203 3300031235 Ga0265330_10019516 Ga0265330_100195162 144
204 3300031239 Ga0265328_10099924 Ga0265328_100999241 144
205 3300031247 Ga0265340_10001209 Ga0265340_1000120912 144
206 3300031616 Ga0307508_10000005 Ga0307508_1000000531 144
207 3300048907 Ga0496104_0832423 Ga0496104_0832423_15_488 144
208 3300048918 Ga0496115_0561033 Ga0496115_0561033_129_599 144
209 3300003214 JGI25165J46597_1008974 JGI25165J46597_10089742 145
210 3300005366 Ga0070659_100676592 Ga0070659_1006765922 145
211 3300005548 Ga0070665_100145154 Ga0070665_1001451542 145
212 3300025261 Ga0209233_1003722 Ga0209233_10037227 145
213 3300026067 Ga0207678_10073356 Ga0207678_100733564 145
214 3300041496 Ga0451839_0145521 Ga0451839_0145521_59_535 145
215 3300045976 Ga0466967_0071213 Ga0466967_0071213_84_563 145
216 3300046455 Ga0495603_0228227 Ga0495603_0228227_457_936 145
217 3300046473 Ga0495582_0123335 Ga0495582_0123335_426_902 145
218 3300046681 Ga0495647_0329345 Ga0495647_0329345_112_588 145
219 3300048903 Ga0496100_0189456 Ga0496100_0189456_32_502 145
220 3300048903 Ga0496100_1247179 Ga0496100_1247179_34_477 145
221 3300048904 Ga0496101_0078600 Ga0496101_0078600_1645_2115 145
222 3300048907 Ga0496104_0022858 Ga0496104_0022858_4573_5043 145
223 3300048908 Ga0496105_0253213 Ga0496105_0253213_945_1415 145
224 3300048909 Ga0496106_0000810 Ga0496106_0000810_10879_11349 145
225 3300048911 Ga0496108_0000553 Ga0496108_0000553_13872_14342 145
226 3300048912 Ga0496109_0000574 Ga0496109_0000574_16302_16772 145
227 3300048913 Ga0496110_0029231 Ga0496110_0029231_1614_2084 145
228 3300048916 Ga0496113_0156113 Ga0496113_0156113_243_713 145
229 3300048917 Ga0496114_0346324 Ga0496114_0346324_746_1216 145
230 3300048929 Ga0496126_0134202 Ga0496126_0134202_74_565 145
231 3300049574 Ga0501038_0065277 Ga0501038_0065277_2138_2581 145
232 3300049823 Ga0501044_0251749 Ga0501044_0251749_706_1149 145
233 3300005434 Ga0070709_10380117 Ga0070709_103801172 146
234 3300009545 Ga0105237_10897798 Ga0105237_108977982 146
235 3300031616 Ga0307508_10119212 Ga0307508_101192123 146
236 3300035170 Ga0373943_0203010 Ga0373943_0203010_446_919 146
237 3300035695 Ga0373927_0119275 Ga0373927_0119275_390_863 146
238 3300037471 Ga0395905_0610301 Ga0395905_0610301_53_523 146
239 3300005337 Ga0070682_100723300 Ga0070682_1007233001 147
240 3300005563 Ga0068855_100494617 Ga0068855_1004946172 147
241 3300005578 Ga0068854_100823096 Ga0068854_1008230962 147
242 3300005614 Ga0068856_100002885 Ga0068856_1000028852 147
243 3300009093 Ga0105240_10003827 Ga0105240_1000382723 147
244 3300009094 Ga0111539_10255735 Ga0111539_102557354 147
245 3300009174 Ga0105241_10000556 Ga0105241_100005564 147
246 3300009545 Ga0105237_10145308 Ga0105237_101453083 147
247 3300009551 Ga0105238_10001118 Ga0105238_100011183 147
248 3300013104 Ga0157370_10268631 Ga0157370_102686312 147
249 3300025911 Ga0207654_10000538 Ga0207654_1000053810 147
250 3300025913 Ga0207695_10000366 Ga0207695_1000036616 147
251 3300025924 Ga0207694_10001709 Ga0207694_1000170915 147
252 3300025949 Ga0207667_10935962 Ga0207667_109359622 147
253 3300025981 Ga0207640_10968465 Ga0207640_109684651 147
254 3300026078 Ga0207702_10000453 Ga0207702_1000045342 147
255 3300027907 Ga0207428_10181128 Ga0207428_101811282 147
256 3300031235 Ga0265330_10097457 Ga0265330_100974572 147
257 3300035118 Ga0373954_0077480 Ga0373954_0077480_726_1211 147
258 3300035120 Ga0373957_0013607 Ga0373957_0013607_607_1092 147
259 3300035170 Ga0373943_0018606 Ga0373943_0018606_964_1449 147
260 3300035172 Ga0373955_0020052 Ga0373955_0020052_1736_2221 147
261 3300035691 Ga0373931_0158549 Ga0373931_0158549_100_573 147
262 3300035692 Ga0373935_0292991 Ga0373935_0292991_152_637 147
263 3300035695 Ga0373927_0078421 Ga0373927_0078421_1154_1639 147
264 3300035724 Ga0373933_0115600 Ga0373933_0115600_817_1302 147
265 3300035724 Ga0373933_0128594 Ga0373933_0128594_126_611 147
266 3300036401 Ga0373937_0012106 Ga0373937_0012106_3752_4237 147
267 3300037068 Ga0373925_0016508 Ga0373925_0016508_1736_2221 147
268 3300037068 Ga0373925_0339409 Ga0373925_0339409_124_609 147
269 3300037853 Ga0436364_0971828 Ga0436364_0971828_730_1251 147
270 3300041503 Ga0451847_0266158 Ga0451847_0266158_30_503 147
271 3300044656 Ga0466969_0148299 Ga0466969_0148299_105_578 147
272 3300046454 Ga0495592_0022768 Ga0495592_0022768_3305_3790 147
273 3300046455 Ga0495603_0066730 Ga0495603_0066730_1589_2074 147
274 3300046459 Ga0495629_0049319 Ga0495629_0049319_1722_2207 147
275 3300046472 Ga0495580_0019910 Ga0495580_0019910_4429_4914 147
276 3300046473 Ga0495582_0036829 Ga0495582_0036829_841_1326 147
277 3300046475 Ga0495639_0549321 Ga0495639_0549321_10_495 147
278 3300046476 Ga0495662_0044289 Ga0495662_0044289_399_884 147
279 3300046477 Ga0495664_0054940 Ga0495664_0054940_520_1005 147
280 3300046499 Ga0495594_0576445 Ga0495594_0576445_110_595 147
281 3300046517 Ga0495630_0015076 Ga0495630_0015076_4443_4928 147
282 3300046529 Ga0495652_0160096 Ga0495652_0160096_806_1291 147
283 3300046533 Ga0495640_0051208 Ga0495640_0051208_2267_2752 147
284 3300046559 Ga0495667_0306162 Ga0495667_0306162_470_955 147
285 3300046663 Ga0495635_0154668 Ga0495635_0154668_38_523 147
286 3300046678 Ga0495599_0479128 Ga0495599_0479128_225_710 147
287 3300046681 Ga0495647_0081584 Ga0495647_0081584_433_918 147
288 3300046689 Ga0495613_0451989 Ga0495613_0451989_220_705 147
289 3300046690 Ga0495624_0027494 Ga0495624_0027494_2994_3479 147
290 3300047315 Ga0495581_0046820 Ga0495581_0046820_105_590 147
291 3300047319 Ga0495674_0048964 Ga0495674_0048964_1350_1835 147
292 3300047673 Ga0495593_0005454 Ga0495593_0005454_3027_3512 147
293 3300049568 Ga0501031_0000869 Ga0501031_0000869_16735_17187 147
294 3300049569 Ga0501032_0000309 Ga0501032_0000309_8216_8668 147
295 3300049570 Ga0501033_0001798 Ga0501033_0001798_12596_13048 147
296 3300049571 Ga0501034_0000082 Ga0501034_0000082_124429_124881 147
297 3300049572 Ga0501036_0000121 Ga0501036_0000121_10093_10545 147
298 3300049573 Ga0501037_0000346 Ga0501037_0000346_31366_31818 147
299 3300049575 Ga0501039_0009593 Ga0501039_0009593_3381_3833 147
300 3300049579 Ga0501043_0000109 Ga0501043_0000109_14801_15253 147
301 3300049580 Ga0501046_0000101 Ga0501046_0000101_8144_8596 147
302 3300049581 Ga0501047_0000331 Ga0501047_0000331_10056_10508 147
303 3300049582 Ga0501048_0002703 Ga0501048_0002703_7865_8317 147
304 3300049583 Ga0501067_0000534 Ga0501067_0000534_16145_16597 147
305 3300049584 Ga0501068_0000276 Ga0501068_0000276_6554_7006 147
306 3300049587 Ga0501071_0052281 Ga0501071_0052281_653_1105 147
307 3300049588 Ga0501072_0004822 Ga0501072_0004822_5839_6291 147
308 3300049589 Ga0501073_0000101 Ga0501073_0000101_33524_33976 147
309 3300049590 Ga0501074_0000187 Ga0501074_0000187_25496_25948 147
310 3300049592 Ga0501076_0811965 Ga0501076_0811965_296_748 147
311 3300049741 Ga0501079_0001908 Ga0501079_0001908_13341_13793 147
312 3300049742 Ga0501080_0000151 Ga0501080_0000151_17709_18161 147
313 3300049742 Ga0501080_0490526 Ga0501080_0490526_405_875 147
314 3300049744 Ga0501083_0007235 Ga0501083_0007235_5528_5980 147
315 3300049822 Ga0501035_0000150 Ga0501035_0000150_2768_3220 147
316 3300049823 Ga0501044_0000247 Ga0501044_0000247_51015_51467 147
317 3300049824 Ga0501045_0183883 Ga0501045_0183883_419_871 147
318 3300050511 nmdc:mga08y16_30607_c1 nmdc:mga08y16_30607_c1_4504_4977 147
319 3300053077 Ga0495601_0016798 Ga0495601_0016798_1613_2098 147
320 3300053078 Ga0495612_0011897 Ga0495612_0011897_2166_2651 147
321 3300054114 Ga0501084_0018973 Ga0501084_0018973_5209_5661 147
322 3300059424 Ga0590075_100995 Ga0590075_100995_73_597 147
323 3300060353 Ga0501082_0000706 Ga0501082_0000706_5619_6071 147
324 3300005356 Ga0070674_100380237 Ga0070674_1003802371 148
325 3300005614 Ga0068856_101258250 Ga0068856_1012582502 148
326 3300006881 Ga0068865_100269667 Ga0068865_1002696672 148
327 3300009545 Ga0105237_10807238 Ga0105237_108072382 148
328 3300009551 Ga0105238_10353337 Ga0105238_103533373 148
329 3300011119 Ga0105246_11582617 Ga0105246_115826172 148
330 3300013297 Ga0157378_11112730 Ga0157378_111127301 148
331 3300013308 Ga0157375_10169545 Ga0157375_101695452 148
332 3300014326 Ga0157380_11203563 Ga0157380_112035632 148
333 3300017792 Ga0163161_11600853 Ga0163161_116008531 148
334 3300025914 Ga0207671_10628908 Ga0207671_106289082 148
335 3300025938 Ga0207704_10491326 Ga0207704_104913262 148
336 3300026121 Ga0207683_10142711 Ga0207683_101427112 148
337 3300031548 Ga0307408_100519028 Ga0307408_1005190282 148
338 3300041507 Ga0451851_0204890 Ga0451851_0204890_24_503 148
339 3300046506 Ga0495583_0257515 Ga0495583_0257515_90_563 148
340 3300046523 Ga0495644_0177693 Ga0495644_0177693_223_702 148
341 iso_pu_bacteria 2667528175 2671123604 148
342 iso_pu_bacteria 8056673599 8056676303 148
343 3300003354 JGI25160J50197_1001574 JGI25160J50197_10015748 149
344 3300005365 Ga0070688_100348233 Ga0070688_1003482331 149
345 3300005434 Ga0070709_10255137 Ga0070709_102551372 149
346 3300005563 Ga0068855_101396215 Ga0068855_1013962152 149
347 3300005842 Ga0068858_100123119 Ga0068858_1001231193 149
348 3300005985 Ga0081539_10035919 Ga0081539_100359192 149
349 3300009174 Ga0105241_10435018 Ga0105241_104350182 149
350 3300011119 Ga0105246_10329502 Ga0105246_103295022 149
351 3300013306 Ga0163162_10122327 Ga0163162_101223274 149
352 3300013308 Ga0157375_10883148 Ga0157375_108831482 149
353 3300014325 Ga0163163_10038427 Ga0163163_100384272 149
354 3300014969 Ga0157376_10061223 Ga0157376_100612232 149
355 3300025906 Ga0207699_10719419 Ga0207699_107194191 149
356 3300025929 Ga0207664_10374588 Ga0207664_103745882 149
357 3300025945 Ga0207679_10802862 Ga0207679_108028622 149
358 3300026078 Ga0207702_11730374 Ga0207702_117303741 149
359 3300037471 Ga0395905_0520023 Ga0395905_0520023_62_535 149
360 3300039450 Ga0436363_1572509 Ga0436363_1572509_952_1404 149
361 3300048903 Ga0496100_0434515 Ga0496100_0434515_478_954 149
362 3300048906 Ga0496103_0242678 Ga0496103_0242678_634_1110 149
363 3300048907 Ga0496104_0020896 Ga0496104_0020896_3650_4126 149
364 3300048909 Ga0496106_0014681 Ga0496106_0014681_376_852 149
365 3300048911 Ga0496108_0021077 Ga0496108_0021077_1946_2422 149
366 3300048913 Ga0496110_0005711 Ga0496110_0005711_1594_2070 149
367 3300048915 Ga0496112_0002964 Ga0496112_0002964_11654_12130 149
368 3300048917 Ga0496114_0379995 Ga0496114_0379995_438_914 149
369 3300048922 Ga0496119_0317910 Ga0496119_0317910_88_558 149
370 3300048924 Ga0496121_0021056 Ga0496121_0021056_4266_4739 149
371 3300048925 Ga0496122_0139371 Ga0496122_0139371_253_723 149
372 3300048928 Ga0496125_0099370 Ga0496125_0099370_636_1109 149
373 3300048929 Ga0496126_0011673 Ga0496126_0011673_1148_1618 149
374 3300048929 Ga0496126_0019226 Ga0496126_0019226_4023_4496 149
375 3300048929 Ga0496126_0076440 Ga0496126_0076440_1839_2312 149
376 3300041997 Ga0439431_0048116 Ga0439431_0048116_48_521 150
377 3300053118 Ga0500594_0179245 Ga0500594_0179245_124_606 150
378 iso_pu_bacteria 2513237101 2513694045 150
379 iso_pu_bacteria 2721755755 2723849345 150
380 iso_pu_bacteria 2874604998 2874608423 150
381 iso_pu_bacteria 2889033259 2889035867 150
382 iso_pu_bacteria 2922361189 2922364345 150
383 iso_pu_bacteria 8006964411 8006970219 150
384 iso_pu_bacteria 8006994254 8006999093 150
385 3300005614 Ga0068856_100313226 Ga0068856_1003132262 151
386 3300005981 Ga0081538_10050574 Ga0081538_100505741 151
387 3300026078 Ga0207702_11372513 Ga0207702_113725132 151
388 3300037312 Ga0395899_0095816 Ga0395899_0095816_229_693 151
389 3300037418 Ga0395900_0265512 Ga0395900_0265512_188_652 151
390 3300048909 Ga0496106_0707806 Ga0496106_0707806_56_541 151
391 3300049569 Ga0501032_0107750 Ga0501032_0107750_445_909 151
392 3300049570 Ga0501033_0308964 Ga0501033_0308964_493_957 151
393 3300049579 Ga0501043_0134839 Ga0501043_0134839_248_712 151
394 3300049580 Ga0501046_0154066 Ga0501046_0154066_423_887 151
395 3300049581 Ga0501047_0225666 Ga0501047_0225666_59_523 151
396 3300049581 Ga0501047_1005685 Ga0501047_1005685_70_531 151
397 3300049586 Ga0501070_0166875 Ga0501070_0166875_73_537 151
398 3300049822 Ga0501035_0256721 Ga0501035_0256721_70_534 151
399 3300049823 Ga0501044_0114264 Ga0501044_0114264_459_923 151
400 3300049823 Ga0501044_0134311 Ga0501044_0134311_60_524 151
401 3300049823 Ga0501044_0370122 Ga0501044_0370122_414_878 151
402 iso_pu_bacteria 2876808645 2876815947 151
403 iso_pu_bacteria 2879110137 2879112809 151
404 iso_pu_bacteria 8006984368 8006992443 151
405 iso_pu_bacteria 8056681323 8056683029 151
406 3300031456 Ga0307513_10208951 Ga0307513_102089511 152
407 3300046519 Ga0495632_0068529 Ga0495632_0068529_839_1303 152
408 3300046660 Ga0495625_0476151 Ga0495625_0476151_260_739 152
409 3300048088 Ga0495602_0287598 Ga0495602_0287598_114_584 152
410 3300053077 Ga0495601_0213306 Ga0495601_0213306_643_1122 152
411 3300053727 Ga0500611_194436 Ga0500611_194436_53_532 152
412 3300053730 Ga0500645_032291 Ga0500645_032291_708_1172 152
413 iso_pu_bacteria 2513237098 2513673919 152
414 iso_pu_bacteria 2513237141 2513890399 152
415 iso_pu_bacteria 2524023210 2524468369 152
416 iso_pu_bacteria 2524023228 2524535241 152
417 iso_pu_bacteria 2728368998 2728752039 152
418 iso_pu_bacteria 2885383462 2885389452 152
419 iso_pu_bacteria 2903768456 2903775704 152
420 iso_pu_bacteria 2904690495 2904699254 152
421 iso_pu_bacteria 2904699407 2904707971 152
422 iso_pu_bacteria 2908756301 2908758853 152
423 iso_pu_bacteria 8006933436 8006936708 152
424 iso_pu_bacteria 8006973647 8006976678 152
425 iso_pu_bacteria 8056689827 8056693968 152
426 3300001990 JGI24737J22298_10023916 JGI24737J22298_100239164 153
427 3300002067 JGI24735J21928_10032987 JGI24735J21928_100329872 153
428 3300002075 JGI24738J21930_10035415 JGI24738J21930_100354152 153
429 3300005339 Ga0070660_100954265 Ga0070660_1009542651 153
430 3300005539 Ga0068853_100021142 Ga0068853_1000211424 153
431 3300005563 Ga0068855_100100067 Ga0068855_1001000672 153
432 3300005577 Ga0068857_100005806 Ga0068857_10000580610 153
433 3300005578 Ga0068854_100003966 Ga0068854_1000039662 153
434 3300005614 Ga0068856_100059629 Ga0068856_1000596292 153
435 3300005616 Ga0068852_100070502 Ga0068852_1000705024 153
436 3300009093 Ga0105240_10010949 Ga0105240_100109496 153
437 3300009174 Ga0105241_10225803 Ga0105241_102258031 153
438 3300009545 Ga0105237_10047943 Ga0105237_100479433 153
439 3300009551 Ga0105238_10021839 Ga0105238_100218395 153
440 3300010375 Ga0105239_10006974 Ga0105239_1000697411 153
441 3300013307 Ga0157372_11680900 Ga0157372_116809001 153
442 3300025904 Ga0207647_10007113 Ga0207647_100071135 153
443 3300025913 Ga0207695_10120304 Ga0207695_101203041 153
444 3300025919 Ga0207657_10224606 Ga0207657_102246062 153
445 3300025924 Ga0207694_10088228 Ga0207694_100882282 153
446 3300025949 Ga0207667_10002298 Ga0207667_1000229820 153
447 3300025981 Ga0207640_10049724 Ga0207640_100497242 153
448 3300026041 Ga0207639_10002667 Ga0207639_100026679 153
449 3300026078 Ga0207702_10032539 Ga0207702_100325394 153
450 3300026116 Ga0207674_10007557 Ga0207674_100075576 153
451 3300031548 Ga0307408_100706468 Ga0307408_1007064682 153
452 iso_pu_bacteria 2513237102 2513700406 153
453 iso_pu_bacteria 2513237104 2513718811 153
454 iso_pu_bacteria 2824617872 2824625623 153
455 iso_pu_bacteria 2824626560 2824631758 153
456 iso_pu_bacteria 2824635225 2824643000 153
457 iso_pu_bacteria 2824644064 2824651014 153
458 iso_pu_bacteria 2824723954 2824731174 153
459 3300002070 JGI24750J21931_1008207 JGI24750J21931_10082071 154
460 3300002077 JGI24744J21845_10038948 JGI24744J21845_100389481 154
461 3300005347 Ga0070668_100210169 Ga0070668_1002101691 154
462 3300005366 Ga0070659_100532917 Ga0070659_1005329172 154
463 3300005438 Ga0070701_10286556 Ga0070701_102865561 154
464 3300005441 Ga0070700_100165208 Ga0070700_1001652082 154
465 3300005456 Ga0070678_100361797 Ga0070678_1003617972 154
466 3300005539 Ga0068853_100858830 Ga0068853_1008588301 154
467 3300005543 Ga0070672_100012411 Ga0070672_1000124114 154
468 3300005544 Ga0070686_100051206 Ga0070686_1000512063 154
469 3300005549 Ga0070704_100303822 Ga0070704_1003038222 154
470 3300005564 Ga0070664_100276777 Ga0070664_1002767772 154
471 3300005614 Ga0068856_100628402 Ga0068856_1006284022 154
472 3300005615 Ga0070702_100013586 Ga0070702_1000135864 154
473 3300005616 Ga0068852_100029092 Ga0068852_1000290927 154
474 3300005844 Ga0068862_100818555 Ga0068862_1008185552 154
475 3300005937 Ga0081455_10039738 Ga0081455_100397385 154
476 3300005937 Ga0081455_10496526 Ga0081455_104965261 154
477 3300009093 Ga0105240_10545811 Ga0105240_105458111 154
478 3300009176 Ga0105242_10839581 Ga0105242_108395812 154
479 3300009177 Ga0105248_10918370 Ga0105248_109183701 154
480 3300009553 Ga0105249_10117532 Ga0105249_101175322 154
481 3300010375 Ga0105239_10973640 Ga0105239_109736401 154
482 3300013308 Ga0157375_10568983 Ga0157375_105689832 154
483 3300014326 Ga0157380_10240698 Ga0157380_102406983 154
484 3300014326 Ga0157380_10614612 Ga0157380_106146121 154
485 3300017792 Ga0163161_10434855 Ga0163161_104348552 154
486 3300025932 Ga0207690_10250433 Ga0207690_102504332 154
487 3300025933 Ga0207706_10132711 Ga0207706_101327111 154
488 3300025934 Ga0207686_10713689 Ga0207686_107136891 154
489 3300025940 Ga0207691_10177935 Ga0207691_101779353 154
490 3300025941 Ga0207711_10604761 Ga0207711_106047612 154
491 3300025949 Ga0207667_10241480 Ga0207667_102414802 154
492 3300025961 Ga0207712_10052003 Ga0207712_100520034 154
493 3300025986 Ga0207658_11016494 Ga0207658_110164942 154
494 3300026041 Ga0207639_10289658 Ga0207639_102896582 154
495 3300026075 Ga0207708_10038351 Ga0207708_100383515 154
496 3300026078 Ga0207702_11734473 Ga0207702_117344731 154
497 3300026088 Ga0207641_10235160 Ga0207641_102351603 154
498 3300026142 Ga0207698_10032442 Ga0207698_100324426 154
499 3300028381 Ga0268264_10314635 Ga0268264_103146352 154
500 3300031824 Ga0307413_10123981 Ga0307413_101239812 154
501 3300031903 Ga0307407_10254612 Ga0307407_102546122 154
502 3300037466 Ga0395898_0191857 Ga0395898_0191857_731_1195 154
503 3300037471 Ga0395905_0065185 Ga0395905_0065185_256_720 154
504 3300039437 Ga0436365_0114911 Ga0436365_0114911_54_527 154
505 3300044706 Ga0466964_0730319 Ga0466964_0730319_11_490 154
506 3300045836 Ga0466958_0364785 Ga0466958_0364785_63_542 154
507 3300046537 Ga0495598_0090102 Ga0495598_0090102_292_762 154
508 3300046684 Ga0495669_0033533 Ga0495669_0033533_346_816 154
509 3300046684 Ga0495669_0265345 Ga0495669_0265345_67_537 154
510 3300046794 Ga0495589_0064276 Ga0495589_0064276_873_1343 154
511 3300047472 Ga0495686_0158941 Ga0495686_0158941_86_556 154
512 3300048904 Ga0496101_1226087 Ga0496101_1226087_18_488 154
513 3300048905 Ga0496102_0171212 Ga0496102_0171212_694_1164 154
514 3300048917 Ga0496114_0701495 Ga0496114_0701495_251_721 154
515 3300048928 Ga0496125_0004420 Ga0496125_0004420_8575_9042 154
516 3300048929 Ga0496126_1010303 Ga0496126_1010303_44_511 154
517 3300001979 JGI24740J21852_10010779 JGI24740J21852_100107794 155
518 3300005328 Ga0070676_10564046 Ga0070676_105640461 155
519 3300005338 Ga0068868_100322384 Ga0068868_1003223842 155
520 3300005539 Ga0068853_100000394 Ga0068853_10000039423 155
521 3300005563 Ga0068855_100045215 Ga0068855_1000452151 155
522 3300005577 Ga0068857_100003365 Ga0068857_10000336512 155
523 3300005578 Ga0068854_100009147 Ga0068854_1000091476 155
524 3300005616 Ga0068852_100087753 Ga0068852_1000877534 155
525 3300005718 Ga0068866_10030405 Ga0068866_100304054 155
526 3300005834 Ga0068851_10004148 Ga0068851_100041488 155
527 3300006881 Ga0068865_100609702 Ga0068865_1006097021 155
528 3300009098 Ga0105245_11094380 Ga0105245_110943802 155
529 3300013104 Ga0157370_10418348 Ga0157370_104183482 155
530 3300025321 Ga0207656_10014569 Ga0207656_100145691 155
531 3300025912 Ga0207707_10096653 Ga0207707_100966532 155
532 3300025914 Ga0207671_10219857 Ga0207671_102198572 155
533 3300025921 Ga0207652_10478754 Ga0207652_104787542 155
534 3300025923 Ga0207681_10491863 Ga0207681_104918632 155
535 3300025927 Ga0207687_10178007 Ga0207687_101780072 155
536 3300025937 Ga0207669_10115146 Ga0207669_101151462 155
537 3300025938 Ga0207704_10474503 Ga0207704_104745031 155
538 3300025942 Ga0207689_10379954 Ga0207689_103799542 155
539 3300025949 Ga0207667_10014888 Ga0207667_100148887 155
540 3300025972 Ga0207668_10101289 Ga0207668_101012892 155
541 3300026116 Ga0207674_10006606 Ga0207674_1000660610 155
542 3300026118 Ga0207675_100805206 Ga0207675_1008052061 155
543 3300026142 Ga0207698_10096343 Ga0207698_100963433 155
544 3300033442 Ga0315911_1000035 Ga0315911_10000353 155
545 3300035088 Ga0373940_0056399 Ga0373940_0056399_585_1064 155
546 3300035241 Ga0373961_0269299 Ga0373961_0269299_133_606 155
547 3300044706 Ga0466964_0310995 Ga0466964_0310995_109_591 155
548 3300046500 Ga0495596_0096906 Ga0495596_0096906_181_654 155
549 3300046507 Ga0495606_0082466 Ga0495606_0082466_375_848 155
550 3300048924 Ga0496121_0123287 Ga0496121_0123287_1125_1607 155
551 3300048928 Ga0496125_0326714 Ga0496125_0326714_34_516 155
552 3300053119 Ga0500595_034078 Ga0500595_034078_183_656 155
553 3300053148 Ga0500590_032661 Ga0500590_032661_182_655 155
554 3300035088 Ga0373940_0216134 Ga0373940_0216134_43_525 156
555 3300035691 Ga0373931_0264677 Ga0373931_0264677_169_651 156
556 3300039450 Ga0436363_0891060 Ga0436363_0891060_437_916 156
557 3300044656 Ga0466969_0042236 Ga0466969_0042236_1553_2038 156
558 3300044684 Ga0466966_0145950 Ga0466966_0145950_724_1209 156
559 3300045049 Ga0466959_0062877 Ga0466959_0062877_603_1088 156
560 3300046499 Ga0495594_0213996 Ga0495594_0213996_583_1059 156
561 3300048929 Ga0496126_0006400 Ga0496126_0006400_12439_12912 156
562 3300006028 Ga0070717_10164449 Ga0070717_101644492 157
563 3300009551 Ga0105238_10411567 Ga0105238_104115671 157
564 3300025915 Ga0207693_10620638 Ga0207693_106206382 157
565 3300025924 Ga0207694_11017146 Ga0207694_110171461 157
566 3300036401 Ga0373937_0280101 Ga0373937_0280101_313_804 157
567 3300046462 Ga0495651_0028449 Ga0495651_0028449_1743_2234 157
568 3300048088 Ga0495602_0350062 Ga0495602_0350062_441_932 157
569 3300048911 Ga0496108_1262121 Ga0496108_1262121_91_573 157
570 3300048925 Ga0496122_0539976 Ga0496122_0539976_53_535 157
571 3300048926 Ga0496123_0172118 Ga0496123_0172118_360_842 157
572 3300048927 Ga0496124_0016867 Ga0496124_0016867_5625_6107 157
573 3300039438 Ga0436360_1288387 Ga0436360_1288387_244_765 159
574 2010549000 RicEn_C3613 RicEn_65090 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06676

DUF1178

Protein of unknown function (DUF1178)

1

170

0.96

Feature Viewer

pLDDT pTM Quality
68.91 0.29 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map