F465324
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 344 | 538 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_1288387|Ga0436360_1288387_244_765 |
| Length | 173 |
| Sequence | MIRYSLRCERDHSFESWFQDSGAYDSQVKRKLVSCPVCGSAKVEKAIMAPRIVSKKGRDRQTAVPETANVPVPAAPAETASPPQVQGSQAQSSTPLMMAQERELRAKLKELRDHIVKNADNVGEKFPNEARKMHYGEIEHRPIYGEASPEEARALIDEGVEVSPLPVLPEDRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 13 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 14 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 15 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 16 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 17 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 18 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 19 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 20 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 21 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 22 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 23 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 24 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 25 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 26 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 27 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 28 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 29 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 30 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 33 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 34 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 35 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 36 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 90 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 91 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 211 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 216 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 217 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 218 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 221 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 329 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 333 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 334 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 338 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 339 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 340 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 341 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 342 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 343 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 344 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.72 |
| Metatranscriptomes | 0.17 |
| Isolates | 6.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.09 |
| Nodule | 4.7 |
| Rhizoplane | 6.62 |
| Rhizosphere | 77.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C3613 | 2010549000 | Bacteria | 1495 |
| 2 | LJQas_1002886 | 3300000549 | Bacteria | 2339 |
| 3 | JGI24740J21852_10010779 | 3300001979 | Bacteria | 3501 |
| 4 | JGI24737J22298_10023916 | 3300001990 | Bacteria | 1935 |
| 5 | JGI24735J21928_10032987 | 3300002067 | Bacteria | 1531 |
| 6 | JGI24750J21931_1008207 | 3300002070 | Bacteria | 1325 |
| 7 | JGI24738J21930_10035415 | 3300002075 | Bacteria | 1017 |
| 8 | JGI24744J21845_10038948 | 3300002077 | Bacteria | 893 |
| 9 | JGI25406J46586_10015879 | 3300003203 | Bacteria | 3159 |
| 10 | JGI25165J46597_1008974 | 3300003214 | Bacteria | 1532 |
| 11 | JGI25160J50197_1001574 | 3300003354 | Bacteria | 11262 |
| 12 | Ga0070676_10564046 | 3300005328 | Bacteria | 817 |
| 13 | Ga0070683_100053436 | 3300005329 | Bacteria | 3743 |
| 14 | Ga0070680_100013669 | 3300005336 | Bacteria | 6328 |
| 15 | Ga0070680_101253423 | 3300005336 | Bacteria | 641 |
| 16 | Ga0070682_100723300 | 3300005337 | Bacteria | 801 |
| 17 | Ga0068868_100322384 | 3300005338 | Bacteria | 1316 |
| 18 | Ga0068868_100702377 | 3300005338 | Bacteria | 905 |
| 19 | Ga0070660_100954265 | 3300005339 | Bacteria | 724 |
| 20 | Ga0070661_100292393 | 3300005344 | Bacteria | 1266 |
| 21 | Ga0070661_101461969 | 3300005344 | Bacteria | 576 |
| 22 | Ga0070668_100210169 | 3300005347 | Bacteria | 1600 |
| 23 | Ga0070674_100380237 | 3300005356 | Bacteria | 1149 |
| 24 | Ga0070688_100348233 | 3300005365 | Bacteria | 1084 |
| 25 | Ga0070659_100532917 | 3300005366 | Bacteria | 1004 |
| 26 | Ga0070659_100676592 | 3300005366 | Bacteria | 891 |
| 27 | Ga0070709_10001043 | 3300005434 | Bacteria | 15348 |
| 28 | Ga0070709_10010369 | 3300005434 | Bacteria | 5159 |
| 29 | Ga0070709_10012256 | 3300005434 | Bacteria | 4795 |
| 30 | Ga0070709_10255137 | 3300005434 | Bacteria | 1265 |
| 31 | Ga0070709_10380117 | 3300005434 | Bacteria | 1050 |
| 32 | Ga0070714_100011580 | 3300005435 | Bacteria | 7002 |
| 33 | Ga0070714_100019087 | 3300005435 | Bacteria | 5579 |
| 34 | Ga0070713_100000768 | 3300005436 | Bacteria | 20535 |
| 35 | Ga0070713_100030913 | 3300005436 | Bacteria | 4258 |
| 36 | Ga0070713_100079890 | 3300005436 | Bacteria | 2787 |
| 37 | Ga0070710_10001851 | 3300005437 | Bacteria | 9963 |
| 38 | Ga0070701_10286556 | 3300005438 | Bacteria | 1007 |
| 39 | Ga0070711_100008471 | 3300005439 | Bacteria | 6300 |
| 40 | Ga0070711_100037156 | 3300005439 | Bacteria | 3266 |
| 41 | Ga0070705_100318922 | 3300005440 | Bacteria | 1121 |
| 42 | Ga0070700_100165208 | 3300005441 | Bacteria | 1528 |
| 43 | Ga0070678_100361797 | 3300005456 | Bacteria | 1250 |
| 44 | Ga0070681_10031521 | 3300005458 | Bacteria | 5322 |
| 45 | Ga0070679_100037345 | 3300005530 | Bacteria | 4824 |
| 46 | Ga0070684_100006424 | 3300005535 | Bacteria | 9098 |
| 47 | Ga0070697_100106544 | 3300005536 | Bacteria | 2332 |
| 48 | Ga0068853_100000394 | 3300005539 | Bacteria | 29870 |
| 49 | Ga0068853_100021142 | 3300005539 | Bacteria | 5419 |
| 50 | Ga0068853_100084191 | 3300005539 | Bacteria | 2786 |
| 51 | Ga0068853_100858830 | 3300005539 | Bacteria | 871 |
| 52 | Ga0068853_101025522 | 3300005539 | Bacteria | 795 |
| 53 | Ga0070672_100012411 | 3300005543 | Bacteria | 5979 |
| 54 | Ga0070686_100051206 | 3300005544 | Bacteria | 2627 |
| 55 | Ga0070665_100145154 | 3300005548 | Bacteria | 2376 |
| 56 | Ga0070665_100550617 | 3300005548 | Bacteria | 1166 |
| 57 | Ga0070704_100303822 | 3300005549 | Bacteria | 1330 |
| 58 | Ga0068855_100045215 | 3300005563 | Bacteria | 5207 |
| 59 | Ga0068855_100100067 | 3300005563 | Bacteria | 3338 |
| 60 | Ga0068855_100234696 | 3300005563 | Bacteria | 2052 |
| 61 | Ga0068855_100346982 | 3300005563 | Bacteria | 1636 |
| 62 | Ga0068855_100494617 | 3300005563 | Bacteria | 1330 |
| 63 | Ga0068855_101396215 | 3300005563 | Bacteria | 722 |
| 64 | Ga0070664_100276777 | 3300005564 | Bacteria | 1513 |
| 65 | Ga0068857_100003365 | 3300005577 | Bacteria | 13308 |
| 66 | Ga0068857_100005806 | 3300005577 | Bacteria | 10549 |
| 67 | Ga0068854_100003966 | 3300005578 | Bacteria | 9276 |
| 68 | Ga0068854_100009147 | 3300005578 | Bacteria | 6389 |
| 69 | Ga0068854_100823096 | 3300005578 | Bacteria | 811 |
| 70 | Ga0068856_100002885 | 3300005614 | Bacteria | 17586 |
| 71 | Ga0068856_100059629 | 3300005614 | Bacteria | 3769 |
| 72 | Ga0068856_100313226 | 3300005614 | Bacteria | 1587 |
| 73 | Ga0068856_100628402 | 3300005614 | Bacteria | 1095 |
| 74 | Ga0068856_100642808 | 3300005614 | Bacteria | 1081 |
| 75 | Ga0068856_101258250 | 3300005614 | Bacteria | 756 |
| 76 | Ga0070702_100013586 | 3300005615 | Bacteria | 4114 |
| 77 | Ga0068852_100029092 | 3300005616 | Bacteria | 4533 |
| 78 | Ga0068852_100070502 | 3300005616 | Bacteria | 3067 |
| 79 | Ga0068852_100087753 | 3300005616 | Bacteria | 2776 |
| 80 | Ga0068866_10030405 | 3300005718 | Bacteria | 2592 |
| 81 | Ga0068851_10004148 | 3300005834 | Bacteria | 6523 |
| 82 | Ga0068870_10352072 | 3300005840 | Bacteria | 945 |
| 83 | Ga0068858_100123119 | 3300005842 | Bacteria | 2427 |
| 84 | Ga0068862_100818555 | 3300005844 | Bacteria | 910 |
| 85 | Ga0081455_10039738 | 3300005937 | Bacteria | 4154 |
| 86 | Ga0081455_10045207 | 3300005937 | Bacteria | 3833 |
| 87 | Ga0081455_10446662 | 3300005937 | Bacteria | 884 |
| 88 | Ga0081455_10496526 | 3300005937 | Bacteria | 821 |
| 89 | Ga0081538_10050574 | 3300005981 | Bacteria | 2507 |
| 90 | Ga0081539_10001014 | 3300005985 | Bacteria | 51820 |
| 91 | Ga0081539_10035919 | 3300005985 | Bacteria | 2971 |
| 92 | Ga0070717_10032681 | 3300006028 | Bacteria | 4194 |
| 93 | Ga0070717_10164449 | 3300006028 | Bacteria | 1927 |
| 94 | Ga0070717_10564963 | 3300006028 | Bacteria | 1031 |
| 95 | Ga0070717_10692533 | 3300006028 | Bacteria | 926 |
| 96 | Ga0070717_10987529 | 3300006028 | Bacteria | 767 |
| 97 | Ga0070715_10002760 | 3300006163 | Bacteria | 5455 |
| 98 | Ga0070715_10025029 | 3300006163 | Bacteria | 2360 |
| 99 | Ga0070716_100007223 | 3300006173 | Bacteria | 5464 |
| 100 | Ga0070716_100026589 | 3300006173 | Bacteria | 3100 |
| 101 | Ga0070716_100307239 | 3300006173 | Bacteria | 1106 |
| 102 | Ga0070712_100024896 | 3300006175 | Bacteria | 3972 |
| 103 | Ga0070712_100115260 | 3300006175 | Bacteria | 2013 |
| 104 | Ga0070712_100429155 | 3300006175 | Bacteria | 1097 |
| 105 | Ga0070712_100784712 | 3300006175 | Bacteria | 817 |
| 106 | Ga0075362_10498221 | 3300006177 | Bacteria | 623 |
| 107 | Ga0068865_100269667 | 3300006881 | Bacteria | 1351 |
| 108 | Ga0068865_100609702 | 3300006881 | Bacteria | 923 |
| 109 | Ga0099825_1051985 | 3300006941 | Bacteria | 855 |
| 110 | Ga0099824_1023403 | 3300006942 | Bacteria | 3836 |
| 111 | Ga0099822_1001321 | 3300006943 | Bacteria | 28451 |
| 112 | Ga0099794_10041274 | 3300007265 | Bacteria | 2197 |
| 113 | Ga0105240_10003827 | 3300009093 | Bacteria | 23265 |
| 114 | Ga0105240_10010949 | 3300009093 | Bacteria | 12707 |
| 115 | Ga0105240_10025127 | 3300009093 | Bacteria | 7835 |
| 116 | Ga0105240_10361769 | 3300009093 | Bacteria | 1643 |
| 117 | Ga0105240_10545811 | 3300009093 | Bacteria | 1283 |
| 118 | Ga0111539_10255735 | 3300009094 | Bacteria | 2039 |
| 119 | Ga0105245_10410345 | 3300009098 | Bacteria | 1355 |
| 120 | Ga0105245_11094380 | 3300009098 | Bacteria | 843 |
| 121 | Ga0105241_10000556 | 3300009174 | Bacteria | 28213 |
| 122 | Ga0105241_10225803 | 3300009174 | Bacteria | 1576 |
| 123 | Ga0105241_10399589 | 3300009174 | Bacteria | 1205 |
| 124 | Ga0105241_10435018 | 3300009174 | Bacteria | 1157 |
| 125 | Ga0105242_10839581 | 3300009176 | Bacteria | 913 |
| 126 | Ga0105248_10918370 | 3300009177 | Bacteria | 989 |
| 127 | Ga0105237_10047943 | 3300009545 | Bacteria | 4295 |
| 128 | Ga0105237_10145308 | 3300009545 | Bacteria | 2366 |
| 129 | Ga0105237_10807238 | 3300009545 | Bacteria | 945 |
| 130 | Ga0105237_10897798 | 3300009545 | Bacteria | 893 |
| 131 | Ga0105238_10001118 | 3300009551 | Bacteria | 27100 |
| 132 | Ga0105238_10021839 | 3300009551 | Bacteria | 6519 |
| 133 | Ga0105238_10067737 | 3300009551 | Bacteria | 3570 |
| 134 | Ga0105238_10353337 | 3300009551 | Bacteria | 1459 |
| 135 | Ga0105238_10411567 | 3300009551 | Bacteria | 1346 |
| 136 | Ga0105249_10117532 | 3300009553 | Bacteria | 2522 |
| 137 | Ga0105249_11105357 | 3300009553 | Bacteria | 863 |
| 138 | Ga0105239_10006974 | 3300010375 | Bacteria | 13014 |
| 139 | Ga0105239_10973640 | 3300010375 | Bacteria | 975 |
| 140 | Ga0105246_10329502 | 3300011119 | Bacteria | 1244 |
| 141 | Ga0105246_11582617 | 3300011119 | Bacteria | 619 |
| 142 | Ga0157322_1017834 | 3300012490 | Bacteria | 655 |
| 143 | Ga0157370_10268631 | 3300013104 | Bacteria | 1576 |
| 144 | Ga0157370_10418348 | 3300013104 | Bacteria | 1233 |
| 145 | Ga0157369_10016827 | 3300013105 | Bacteria | 8218 |
| 146 | Ga0157369_10207767 | 3300013105 | Bacteria | 2053 |
| 147 | Ga0157374_10129041 | 3300013296 | Bacteria | 2446 |
| 148 | Ga0157378_11112730 | 3300013297 | Bacteria | 827 |
| 149 | Ga0163162_10122327 | 3300013306 | Bacteria | 2707 |
| 150 | Ga0157372_10182165 | 3300013307 | Bacteria | 2432 |
| 151 | Ga0157372_10556853 | 3300013307 | Bacteria | 1336 |
| 152 | Ga0157372_10806366 | 3300013307 | Bacteria | 1091 |
| 153 | Ga0157372_11680900 | 3300013307 | Bacteria | 730 |
| 154 | Ga0157375_10169545 | 3300013308 | Bacteria | 2330 |
| 155 | Ga0157375_10568983 | 3300013308 | Bacteria | 1294 |
| 156 | Ga0157375_10883148 | 3300013308 | Bacteria | 1039 |
| 157 | Ga0163163_10038427 | 3300014325 | Bacteria | 4665 |
| 158 | Ga0157380_10240698 | 3300014326 | Bacteria | 1631 |
| 159 | Ga0157380_10614612 | 3300014326 | Bacteria | 1078 |
| 160 | Ga0157380_11203563 | 3300014326 | Bacteria | 801 |
| 161 | Ga0157376_10061223 | 3300014969 | Bacteria | 3164 |
| 162 | Ga0163161_10434855 | 3300017792 | Bacteria | 1058 |
| 163 | Ga0163161_11600853 | 3300017792 | Bacteria | 574 |
| 164 | Ga0224712_10315549 | 3300022467 | Bacteria | 734 |
| 165 | Ga0209148_1037096 | 3300025254 | Bacteria | 693 |
| 166 | Ga0209233_1003722 | 3300025261 | Bacteria | 5327 |
| 167 | Ga0207656_10014569 | 3300025321 | Bacteria | 3032 |
| 168 | Ga0207692_10004277 | 3300025898 | Bacteria | 5646 |
| 169 | Ga0207692_10008712 | 3300025898 | Bacteria | 4211 |
| 170 | Ga0207647_10007113 | 3300025904 | Bacteria | 8113 |
| 171 | Ga0207685_10001592 | 3300025905 | Bacteria | 4843 |
| 172 | Ga0207699_10000360 | 3300025906 | Bacteria | 24053 |
| 173 | Ga0207699_10017398 | 3300025906 | Bacteria | 3781 |
| 174 | Ga0207699_10065148 | 3300025906 | Bacteria | 2207 |
| 175 | Ga0207699_10719419 | 3300025906 | Bacteria | 731 |
| 176 | Ga0207654_10000538 | 3300025911 | Bacteria | 21703 |
| 177 | Ga0207707_10003721 | 3300025912 | Bacteria | 13504 |
| 178 | Ga0207707_10096653 | 3300025912 | Bacteria | 2581 |
| 179 | Ga0207695_10000366 | 3300025913 | Bacteria | 103345 |
| 180 | Ga0207695_10099675 | 3300025913 | Bacteria | 2902 |
| 181 | Ga0207695_10120304 | 3300025913 | Bacteria | 2595 |
| 182 | Ga0207695_10138448 | 3300025913 | Bacteria | 2386 |
| 183 | Ga0207671_10219857 | 3300025914 | Bacteria | 1488 |
| 184 | Ga0207671_10374325 | 3300025914 | Bacteria | 1131 |
| 185 | Ga0207671_10609231 | 3300025914 | Bacteria | 870 |
| 186 | Ga0207671_10628908 | 3300025914 | Bacteria | 855 |
| 187 | Ga0207693_10000073 | 3300025915 | Bacteria | 89380 |
| 188 | Ga0207693_10032313 | 3300025915 | Bacteria | 4131 |
| 189 | Ga0207693_10138394 | 3300025915 | Bacteria | 1914 |
| 190 | Ga0207693_10317175 | 3300025915 | Bacteria | 1220 |
| 191 | Ga0207693_10620638 | 3300025915 | Bacteria | 841 |
| 192 | Ga0207663_10043982 | 3300025916 | Bacteria | 2738 |
| 193 | Ga0207663_10045220 | 3300025916 | Bacteria | 2707 |
| 194 | Ga0207660_10067891 | 3300025917 | Bacteria | 2584 |
| 195 | Ga0207657_10224606 | 3300025919 | Bacteria | 1503 |
| 196 | Ga0207652_10051591 | 3300025921 | Bacteria | 3527 |
| 197 | Ga0207652_10478754 | 3300025921 | Bacteria | 1121 |
| 198 | Ga0207681_10491863 | 3300025923 | Bacteria | 1003 |
| 199 | Ga0207694_10001709 | 3300025924 | Bacteria | 18372 |
| 200 | Ga0207694_10017077 | 3300025924 | Bacteria | 5482 |
| 201 | Ga0207694_10088228 | 3300025924 | Bacteria | 2445 |
| 202 | Ga0207694_11017146 | 3300025924 | Bacteria | 701 |
| 203 | Ga0207687_10178007 | 3300025927 | Bacteria | 1645 |
| 204 | Ga0207700_10034750 | 3300025928 | Bacteria | 3622 |
| 205 | Ga0207700_10139086 | 3300025928 | Bacteria | 1993 |
| 206 | Ga0207700_10140077 | 3300025928 | Bacteria | 1986 |
| 207 | Ga0207664_10106842 | 3300025929 | Bacteria | 2321 |
| 208 | Ga0207664_10374588 | 3300025929 | Bacteria | 1263 |
| 209 | Ga0207690_10250433 | 3300025932 | Bacteria | 1368 |
| 210 | Ga0207706_10132711 | 3300025933 | Bacteria | 2190 |
| 211 | Ga0207686_10713689 | 3300025934 | Bacteria | 798 |
| 212 | Ga0207669_10115146 | 3300025937 | Bacteria | 1811 |
| 213 | Ga0207704_10474503 | 3300025938 | Bacteria | 1003 |
| 214 | Ga0207704_10491326 | 3300025938 | Bacteria | 987 |
| 215 | Ga0207704_10876449 | 3300025938 | Bacteria | 754 |
| 216 | Ga0207665_10000629 | 3300025939 | Bacteria | 23661 |
| 217 | Ga0207665_10061881 | 3300025939 | Bacteria | 2539 |
| 218 | Ga0207665_10226346 | 3300025939 | Bacteria | 1373 |
| 219 | Ga0207691_10177935 | 3300025940 | Bacteria | 1860 |
| 220 | Ga0207711_10604761 | 3300025941 | Bacteria | 1023 |
| 221 | Ga0207689_10379954 | 3300025942 | Bacteria | 1176 |
| 222 | Ga0207661_10032589 | 3300025944 | Bacteria | 4037 |
| 223 | Ga0207679_10802862 | 3300025945 | Bacteria | 858 |
| 224 | Ga0207667_10002298 | 3300025949 | Bacteria | 24013 |
| 225 | Ga0207667_10014888 | 3300025949 | Bacteria | 8845 |
| 226 | Ga0207667_10195274 | 3300025949 | Bacteria | 2076 |
| 227 | Ga0207667_10241480 | 3300025949 | Bacteria | 1848 |
| 228 | Ga0207667_10604583 | 3300025949 | Bacteria | 1105 |
| 229 | Ga0207667_10935962 | 3300025949 | Bacteria | 857 |
| 230 | Ga0207712_10052003 | 3300025961 | Bacteria | 2868 |
| 231 | Ga0207668_10101289 | 3300025972 | Bacteria | 2140 |
| 232 | Ga0207640_10049724 | 3300025981 | Bacteria | 2716 |
| 233 | Ga0207640_10968465 | 3300025981 | Bacteria | 747 |
| 234 | Ga0207658_11016494 | 3300025986 | Bacteria | 756 |
| 235 | Ga0207639_10002667 | 3300026041 | Bacteria | 11978 |
| 236 | Ga0207639_10065898 | 3300026041 | Bacteria | 2813 |
| 237 | Ga0207639_10289658 | 3300026041 | Bacteria | 1443 |
| 238 | Ga0207639_10836249 | 3300026041 | Bacteria | 859 |
| 239 | Ga0207678_10073356 | 3300026067 | Bacteria | 2933 |
| 240 | Ga0207708_10038351 | 3300026075 | Bacteria | 3650 |
| 241 | Ga0207702_10000453 | 3300026078 | Bacteria | 46229 |
| 242 | Ga0207702_10032539 | 3300026078 | Bacteria | 4352 |
| 243 | Ga0207702_11372513 | 3300026078 | Bacteria | 701 |
| 244 | Ga0207702_11730374 | 3300026078 | Bacteria | 618 |
| 245 | Ga0207702_11734473 | 3300026078 | Bacteria | 617 |
| 246 | Ga0207641_10235160 | 3300026088 | Bacteria | 1705 |
| 247 | Ga0207674_10006606 | 3300026116 | Bacteria | 13631 |
| 248 | Ga0207674_10007557 | 3300026116 | Bacteria | 12663 |
| 249 | Ga0207675_100805206 | 3300026118 | Bacteria | 953 |
| 250 | Ga0207683_10142711 | 3300026121 | Bacteria | 2158 |
| 251 | Ga0207698_10032442 | 3300026142 | Bacteria | 3783 |
| 252 | Ga0207698_10096343 | 3300026142 | Bacteria | 2438 |
| 253 | Ga0207698_10309443 | 3300026142 | Bacteria | 1474 |
| 254 | Ga0209589_1000026 | 3300027357 | Bacteria | 158154 |
| 255 | Ga0209489_100046 | 3300027361 | Bacteria | 158154 |
| 256 | Ga0209700_100047 | 3300027363 | Bacteria | 158154 |
| 257 | Ga0207428_10181128 | 3300027907 | Bacteria | 1592 |
| 258 | Ga0268266_10404819 | 3300028379 | Bacteria | 1291 |
| 259 | Ga0268264_10314635 | 3300028381 | Bacteria | 1478 |
| 260 | Ga0265330_10019516 | 3300031235 | Bacteria | 3106 |
| 261 | Ga0265330_10097457 | 3300031235 | Bacteria | 1260 |
| 262 | Ga0265332_10205036 | 3300031238 | Bacteria | 819 |
| 263 | Ga0265328_10099924 | 3300031239 | Bacteria | 1074 |
| 264 | Ga0265325_10054209 | 3300031241 | Bacteria | 2053 |
| 265 | Ga0265329_10145088 | 3300031242 | Bacteria | 768 |
| 266 | Ga0265340_10001209 | 3300031247 | Bacteria | 14775 |
| 267 | Ga0265339_10274213 | 3300031249 | Bacteria | 810 |
| 268 | Ga0265331_10099940 | 3300031250 | Bacteria | 1336 |
| 269 | Ga0265331_10180781 | 3300031250 | Bacteria | 953 |
| 270 | Ga0265316_10151646 | 3300031344 | Bacteria | 1736 |
| 271 | Ga0265316_10710490 | 3300031344 | Bacteria | 708 |
| 272 | Ga0307513_10208951 | 3300031456 | Bacteria | 1785 |
| 273 | Ga0307408_100519028 | 3300031548 | Bacteria | 1046 |
| 274 | Ga0307408_100706468 | 3300031548 | Bacteria | 907 |
| 275 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 276 | Ga0307508_10119212 | 3300031616 | Bacteria | 2241 |
| 277 | Ga0265314_10231400 | 3300031711 | Bacteria | 1072 |
| 278 | Ga0307516_10356017 | 3300031730 | Bacteria | 1129 |
| 279 | Ga0307413_10123981 | 3300031824 | Bacteria | 1755 |
| 280 | Ga0307407_10254612 | 3300031903 | Bacteria | 1205 |
| 281 | Ga0307416_101193611 | 3300032002 | Bacteria | 866 |
| 282 | Ga0315911_1000035 | 3300033442 | Bacteria | 66589 |
| 283 | Ga0373940_0056399 | 3300035088 | Bacteria | 1114 |
| 284 | Ga0373940_0216134 | 3300035088 | Bacteria | 635 |
| 285 | Ga0373939_0333952 | 3300035114 | Bacteria | 613 |
| 286 | Ga0373945_0036458 | 3300035116 | Bacteria | 1762 |
| 287 | Ga0373954_0077480 | 3300035118 | Bacteria | 1585 |
| 288 | Ga0373957_0013607 | 3300035120 | Bacteria | 2764 |
| 289 | Ga0373943_0015780 | 3300035170 | Bacteria | 3435 |
| 290 | Ga0373943_0018606 | 3300035170 | Bacteria | 3193 |
| 291 | Ga0373943_0203010 | 3300035170 | Bacteria | 1098 |
| 292 | Ga0373943_0708187 | 3300035170 | Bacteria | 597 |
| 293 | Ga0373946_0122726 | 3300035171 | Bacteria | 1187 |
| 294 | Ga0373955_0020052 | 3300035172 | Bacteria | 3354 |
| 295 | Ga0373961_0269299 | 3300035241 | Bacteria | 622 |
| 296 | Ga0373931_0032222 | 3300035691 | Bacteria | 2711 |
| 297 | Ga0373931_0158549 | 3300035691 | Bacteria | 1325 |
| 298 | Ga0373931_0264677 | 3300035691 | Bacteria | 1050 |
| 299 | Ga0373935_0292991 | 3300035692 | Bacteria | 1148 |
| 300 | Ga0373927_0078421 | 3300035695 | Bacteria | 2139 |
| 301 | Ga0373927_0119275 | 3300035695 | Bacteria | 1721 |
| 302 | Ga0373933_0000277 | 3300035724 | Bacteria | 33337 |
| 303 | Ga0373933_0115600 | 3300035724 | Bacteria | 1676 |
| 304 | Ga0373933_0128594 | 3300035724 | Bacteria | 1591 |
| 305 | Ga0373947_0013693 | 3300035725 | Bacteria | 4647 |
| 306 | Ga0373937_0012106 | 3300036401 | Bacteria | 7572 |
| 307 | Ga0373937_0280101 | 3300036401 | Bacteria | 1574 |
| 308 | Ga0373925_0016508 | 3300037068 | Bacteria | 5349 |
| 309 | Ga0373925_0164835 | 3300037068 | Bacteria | 1747 |
| 310 | Ga0373925_0339409 | 3300037068 | Bacteria | 1218 |
| 311 | Ga0395899_0095816 | 3300037312 | Bacteria | 2146 |
| 312 | Ga0395899_0165601 | 3300037312 | Bacteria | 1560 |
| 313 | Ga0395900_0005919 | 3300037418 | Bacteria | 12766 |
| 314 | Ga0395900_0265512 | 3300037418 | Bacteria | 1712 |
| 315 | Ga0395900_0329922 | 3300037418 | Bacteria | 1504 |
| 316 | Ga0395898_0080592 | 3300037466 | Bacteria | 3139 |
| 317 | Ga0395898_0191857 | 3300037466 | Bacteria | 1952 |
| 318 | Ga0395898_0581507 | 3300037466 | Bacteria | 1062 |
| 319 | Ga0395905_0065185 | 3300037471 | Bacteria | 3410 |
| 320 | Ga0395905_0343598 | 3300037471 | Bacteria | 1384 |
| 321 | Ga0395905_0520023 | 3300037471 | Bacteria | 1091 |
| 322 | Ga0395905_0610301 | 3300037471 | Bacteria | 993 |
| 323 | Ga0436364_0971828 | 3300037853 | Bacteria | 2406 |
| 324 | Ga0395901_0049784 | 3300038443 | Bacteria | 4354 |
| 325 | Ga0395901_0270292 | 3300038443 | Bacteria | 1768 |
| 326 | Ga0436365_0114911 | 3300039437 | Bacteria | 771 |
| 327 | Ga0436365_0641798 | 3300039437 | Bacteria | 1248 |
| 328 | Ga0436360_0025635 | 3300039438 | Bacteria | 2006 |
| 329 | Ga0436360_0126272 | 3300039438 | Bacteria | 831 |
| 330 | Ga0436360_1288387 | 3300039438 | Bacteria | 785 |
| 331 | Ga0436361_0208086 | 3300039447 | Bacteria | 2691 |
| 332 | Ga0436363_0317332 | 3300039450 | Bacteria | 581 |
| 333 | Ga0436363_0483223 | 3300039450 | Bacteria | 1334 |
| 334 | Ga0436363_0891060 | 3300039450 | Bacteria | 997 |
| 335 | Ga0436363_1572509 | 3300039450 | Bacteria | 4714 |
| 336 | Ga0436362_0415444 | 3300039453 | Bacteria | 975 |
| 337 | Ga0451791_0266516 | 3300041451 | Bacteria | 652 |
| 338 | Ga0451839_0145521 | 3300041496 | Bacteria | 620 |
| 339 | Ga0451841_0383047 | 3300041498 | Bacteria | 701 |
| 340 | Ga0451847_0266158 | 3300041503 | Bacteria | 613 |
| 341 | Ga0451851_0204890 | 3300041507 | Bacteria | 867 |
| 342 | Ga0451853_3647681 | 3300041512 | Bacteria | 553 |
| 343 | Ga0439431_0048116 | 3300041997 | Bacteria | 1101 |
| 344 | Ga0439445_0067960 | 3300042004 | Bacteria | 983 |
| 345 | Ga0466969_0042236 | 3300044656 | Bacteria | 2278 |
| 346 | Ga0466969_0148299 | 3300044656 | Bacteria | 1081 |
| 347 | Ga0466969_0173936 | 3300044656 | Bacteria | 987 |
| 348 | Ga0466965_0252190 | 3300044683 | Bacteria | 947 |
| 349 | Ga0466966_0145950 | 3300044684 | Bacteria | 1444 |
| 350 | Ga0466964_0310995 | 3300044706 | Bacteria | 797 |
| 351 | Ga0466964_0730319 | 3300044706 | Bacteria | 554 |
| 352 | Ga0466959_0062877 | 3300045049 | Bacteria | 2697 |
| 353 | Ga0466959_0444200 | 3300045049 | Bacteria | 880 |
| 354 | Ga0466958_0364785 | 3300045836 | Bacteria | 931 |
| 355 | Ga0466967_0034932 | 3300045976 | Bacteria | 4273 |
| 356 | Ga0466967_0071213 | 3300045976 | Bacteria | 3112 |
| 357 | Ga0495592_0022768 | 3300046454 | Bacteria | 4765 |
| 358 | Ga0495603_0006019 | 3300046455 | Bacteria | 7251 |
| 359 | Ga0495603_0066730 | 3300046455 | Bacteria | 2119 |
| 360 | Ga0495603_0228227 | 3300046455 | Bacteria | 1074 |
| 361 | Ga0495590_0067128 | 3300046457 | Bacteria | 1257 |
| 362 | Ga0495629_0049319 | 3300046459 | Bacteria | 2951 |
| 363 | Ga0495629_0122329 | 3300046459 | Bacteria | 1813 |
| 364 | Ga0495638_0063919 | 3300046460 | Bacteria | 2268 |
| 365 | Ga0495651_0028449 | 3300046462 | Bacteria | 4355 |
| 366 | Ga0495580_0019910 | 3300046472 | Bacteria | 4976 |
| 367 | Ga0495580_0085216 | 3300046472 | Bacteria | 2201 |
| 368 | Ga0495582_0036829 | 3300046473 | Bacteria | 2691 |
| 369 | Ga0495582_0123335 | 3300046473 | Bacteria | 1461 |
| 370 | Ga0495605_0253237 | 3300046474 | Bacteria | 753 |
| 371 | Ga0495639_0056089 | 3300046475 | Bacteria | 1798 |
| 372 | Ga0495639_0549321 | 3300046475 | Bacteria | 592 |
| 373 | Ga0495662_0044289 | 3300046476 | Bacteria | 2149 |
| 374 | Ga0495664_0024378 | 3300046477 | Bacteria | 3515 |
| 375 | Ga0495664_0054940 | 3300046477 | Bacteria | 2369 |
| 376 | Ga0495594_0200532 | 3300046499 | Bacteria | 1137 |
| 377 | Ga0495594_0213996 | 3300046499 | Bacteria | 1099 |
| 378 | Ga0495594_0576445 | 3300046499 | Bacteria | 638 |
| 379 | Ga0495596_0096906 | 3300046500 | Bacteria | 1145 |
| 380 | Ga0495583_0257515 | 3300046506 | Bacteria | 699 |
| 381 | Ga0495606_0082466 | 3300046507 | Bacteria | 1996 |
| 382 | Ga0495606_0139328 | 3300046507 | Bacteria | 1434 |
| 383 | Ga0495630_0015076 | 3300046517 | Bacteria | 5639 |
| 384 | Ga0495631_0237023 | 3300046518 | Bacteria | 778 |
| 385 | Ga0495632_0068529 | 3300046519 | Bacteria | 1709 |
| 386 | Ga0495632_0278899 | 3300046519 | Bacteria | 744 |
| 387 | Ga0495644_0177693 | 3300046523 | Bacteria | 818 |
| 388 | Ga0495644_0191421 | 3300046523 | Bacteria | 787 |
| 389 | Ga0495652_0160096 | 3300046529 | Bacteria | 1749 |
| 390 | Ga0495665_0212898 | 3300046531 | Bacteria | 1000 |
| 391 | Ga0495640_0051208 | 3300046533 | Bacteria | 2839 |
| 392 | Ga0495598_0047934 | 3300046537 | Bacteria | 1276 |
| 393 | Ga0495598_0090102 | 3300046537 | Bacteria | 999 |
| 394 | Ga0495645_0004961 | 3300046543 | Bacteria | 9109 |
| 395 | Ga0495667_0306162 | 3300046559 | Bacteria | 1006 |
| 396 | Ga0495656_0029787 | 3300046615 | Bacteria | 2200 |
| 397 | Ga0495668_0447648 | 3300046616 | Bacteria | 711 |
| 398 | Ga0495625_0476151 | 3300046660 | Bacteria | 767 |
| 399 | Ga0495625_0628159 | 3300046660 | Bacteria | 642 |
| 400 | Ga0495635_0154668 | 3300046663 | Bacteria | 1561 |
| 401 | Ga0495659_0173531 | 3300046664 | Bacteria | 875 |
| 402 | Ga0495599_0168920 | 3300046678 | Bacteria | 1350 |
| 403 | Ga0495599_0479128 | 3300046678 | Bacteria | 734 |
| 404 | Ga0495647_0081584 | 3300046681 | Bacteria | 1312 |
| 405 | Ga0495647_0329345 | 3300046681 | Bacteria | 692 |
| 406 | Ga0495658_0337952 | 3300046683 | Bacteria | 956 |
| 407 | Ga0495669_0033533 | 3300046684 | Bacteria | 2260 |
| 408 | Ga0495669_0096629 | 3300046684 | Bacteria | 1369 |
| 409 | Ga0495669_0265345 | 3300046684 | Bacteria | 825 |
| 410 | Ga0495613_0451989 | 3300046689 | Bacteria | 870 |
| 411 | Ga0495624_0027494 | 3300046690 | Bacteria | 3724 |
| 412 | Ga0495624_0174910 | 3300046690 | Bacteria | 1309 |
| 413 | Ga0495589_0064276 | 3300046794 | Bacteria | 1799 |
| 414 | Ga0495589_0181239 | 3300046794 | Bacteria | 999 |
| 415 | Ga0495581_0046820 | 3300047315 | Bacteria | 2499 |
| 416 | Ga0495581_0163134 | 3300047315 | Bacteria | 1303 |
| 417 | Ga0495674_0048964 | 3300047319 | Bacteria | 3736 |
| 418 | Ga0495676_0234512 | 3300047321 | Bacteria | 1259 |
| 419 | Ga0495677_0175824 | 3300047445 | Bacteria | 829 |
| 420 | Ga0495685_116515 | 3300047447 | Bacteria | 878 |
| 421 | Ga0495681_0109404 | 3300047470 | Bacteria | 1199 |
| 422 | Ga0495686_0158941 | 3300047472 | Bacteria | 1322 |
| 423 | Ga0495593_0005454 | 3300047673 | Bacteria | 7514 |
| 424 | Ga0495602_0287598 | 3300048088 | Bacteria | 1208 |
| 425 | Ga0495602_0350062 | 3300048088 | Bacteria | 1066 |
| 426 | Ga0496100_0189456 | 3300048903 | Bacteria | 1492 |
| 427 | Ga0496100_0434515 | 3300048903 | Bacteria | 1004 |
| 428 | Ga0496100_1247179 | 3300048903 | Bacteria | 587 |
| 429 | Ga0496101_0078600 | 3300048904 | Bacteria | 2434 |
| 430 | Ga0496101_1226087 | 3300048904 | Bacteria | 587 |
| 431 | Ga0496102_0171212 | 3300048905 | Bacteria | 2044 |
| 432 | Ga0496102_1775448 | 3300048905 | Bacteria | 534 |
| 433 | Ga0496103_0242678 | 3300048906 | Bacteria | 1159 |
| 434 | Ga0496104_0020896 | 3300048907 | Bacteria | 6004 |
| 435 | Ga0496104_0022858 | 3300048907 | Bacteria | 5745 |
| 436 | Ga0496104_0832423 | 3300048907 | Bacteria | 829 |
| 437 | Ga0496105_0253213 | 3300048908 | Bacteria | 1426 |
| 438 | Ga0496105_0343995 | 3300048908 | Bacteria | 1192 |
| 439 | Ga0496106_0000810 | 3300048909 | Bacteria | 22635 |
| 440 | Ga0496106_0014681 | 3300048909 | Bacteria | 5790 |
| 441 | Ga0496106_0707806 | 3300048909 | Bacteria | 802 |
| 442 | Ga0496108_0000553 | 3300048911 | Bacteria | 29302 |
| 443 | Ga0496108_0021077 | 3300048911 | Bacteria | 5355 |
| 444 | Ga0496108_1262121 | 3300048911 | Bacteria | 623 |
| 445 | Ga0496109_0000574 | 3300048912 | Bacteria | 30746 |
| 446 | Ga0496109_0861756 | 3300048912 | Bacteria | 844 |
| 447 | Ga0496110_0005711 | 3300048913 | Bacteria | 9773 |
| 448 | Ga0496110_0024914 | 3300048913 | Bacteria | 5106 |
| 449 | Ga0496110_0029231 | 3300048913 | Bacteria | 4741 |
| 450 | Ga0496111_0206370 | 3300048914 | Bacteria | 1460 |
| 451 | Ga0496112_0002964 | 3300048915 | Bacteria | 13848 |
| 452 | Ga0496112_0192368 | 3300048915 | Bacteria | 2001 |
| 453 | Ga0496112_0295037 | 3300048915 | Bacteria | 1567 |
| 454 | Ga0496112_0504827 | 3300048915 | Bacteria | 1145 |
| 455 | Ga0496113_0156113 | 3300048916 | Bacteria | 1802 |
| 456 | Ga0496114_0346324 | 3300048917 | Bacteria | 1314 |
| 457 | Ga0496114_0379995 | 3300048917 | Bacteria | 1250 |
| 458 | Ga0496114_0701495 | 3300048917 | Bacteria | 887 |
| 459 | Ga0496115_0214733 | 3300048918 | Bacteria | 1588 |
| 460 | Ga0496115_0561033 | 3300048918 | Bacteria | 912 |
| 461 | Ga0496115_0572777 | 3300048918 | Bacteria | 900 |
| 462 | Ga0496119_0317910 | 3300048922 | Bacteria | 763 |
| 463 | Ga0496121_0021056 | 3300048924 | Bacteria | 6411 |
| 464 | Ga0496121_0032360 | 3300048924 | Bacteria | 4755 |
| 465 | Ga0496121_0123287 | 3300048924 | Bacteria | 1953 |
| 466 | Ga0496121_0324630 | 3300048924 | Bacteria | 1035 |
| 467 | Ga0496121_0652168 | 3300048924 | Bacteria | 641 |
| 468 | Ga0496122_0139371 | 3300048925 | Bacteria | 1520 |
| 469 | Ga0496122_0539976 | 3300048925 | Bacteria | 558 |
| 470 | Ga0496123_0172118 | 3300048926 | Bacteria | 1141 |
| 471 | Ga0496124_0016867 | 3300048927 | Bacteria | 6921 |
| 472 | Ga0496125_0004420 | 3300048928 | Bacteria | 16237 |
| 473 | Ga0496125_0099370 | 3300048928 | Bacteria | 2150 |
| 474 | Ga0496125_0326714 | 3300048928 | Bacteria | 927 |
| 475 | Ga0496126_0006400 | 3300048929 | Bacteria | 13132 |
| 476 | Ga0496126_0011673 | 3300048929 | Bacteria | 9063 |
| 477 | Ga0496126_0019226 | 3300048929 | Bacteria | 6732 |
| 478 | Ga0496126_0076440 | 3300048929 | Bacteria | 2970 |
| 479 | Ga0496126_0099301 | 3300048929 | Bacteria | 2550 |
| 480 | Ga0496126_0134202 | 3300048929 | Bacteria | 2136 |
| 481 | Ga0496126_0267842 | 3300048929 | Bacteria | 1418 |
| 482 | Ga0496126_0497522 | 3300048929 | Bacteria | 975 |
| 483 | Ga0496126_1010303 | 3300048929 | Bacteria | 623 |
| 484 | Ga0501031_0000869 | 3300049568 | Bacteria | 18186 |
| 485 | Ga0501032_0000309 | 3300049569 | Bacteria | 41024 |
| 486 | Ga0501032_0107750 | 3300049569 | Bacteria | 1845 |
| 487 | Ga0501033_0001798 | 3300049570 | Bacteria | 18709 |
| 488 | Ga0501033_0308964 | 3300049570 | Bacteria | 1112 |
| 489 | Ga0501034_0000082 | 3300049571 | Bacteria | 170039 |
| 490 | Ga0501036_0000121 | 3300049572 | Bacteria | 48901 |
| 491 | Ga0501037_0000346 | 3300049573 | Bacteria | 39162 |
| 492 | Ga0501038_0065277 | 3300049574 | Bacteria | 3102 |
| 493 | Ga0501039_0009593 | 3300049575 | Bacteria | 7379 |
| 494 | Ga0501043_0000109 | 3300049579 | Bacteria | 77120 |
| 495 | Ga0501043_0134839 | 3300049579 | Bacteria | 1934 |
| 496 | Ga0501046_0000101 | 3300049580 | Bacteria | 91179 |
| 497 | Ga0501046_0154066 | 3300049580 | Bacteria | 1733 |
| 498 | Ga0501047_0000331 | 3300049581 | Bacteria | 54371 |
| 499 | Ga0501047_0225666 | 3300049581 | Bacteria | 1728 |
| 500 | Ga0501047_1005685 | 3300049581 | Bacteria | 647 |
| 501 | Ga0501048_0002703 | 3300049582 | Bacteria | 13534 |
| 502 | Ga0501067_0000534 | 3300049583 | Bacteria | 20715 |
| 503 | Ga0501067_0096394 | 3300049583 | Bacteria | 1642 |
| 504 | Ga0501068_0000276 | 3300049584 | Bacteria | 25409 |
| 505 | Ga0501069_0635641 | 3300049585 | Bacteria | 642 |
| 506 | Ga0501070_0166875 | 3300049586 | Bacteria | 1814 |
| 507 | Ga0501071_0052281 | 3300049587 | Bacteria | 2946 |
| 508 | Ga0501072_0004822 | 3300049588 | Bacteria | 10270 |
| 509 | Ga0501073_0000101 | 3300049589 | Bacteria | 54365 |
| 510 | Ga0501074_0000187 | 3300049590 | Bacteria | 33711 |
| 511 | Ga0501076_0811965 | 3300049592 | Bacteria | 772 |
| 512 | Ga0501079_0001908 | 3300049741 | Bacteria | 14946 |
| 513 | Ga0501080_0000151 | 3300049742 | Bacteria | 49588 |
| 514 | Ga0501080_0490526 | 3300049742 | Bacteria | 1099 |
| 515 | Ga0501083_0007235 | 3300049744 | Bacteria | 7881 |
| 516 | Ga0501035_0000150 | 3300049822 | Bacteria | 85450 |
| 517 | Ga0501035_0256721 | 3300049822 | Bacteria | 1483 |
| 518 | Ga0501044_0000247 | 3300049823 | Bacteria | 68674 |
| 519 | Ga0501044_0114264 | 3300049823 | Bacteria | 2706 |
| 520 | Ga0501044_0134311 | 3300049823 | Bacteria | 2466 |
| 521 | Ga0501044_0251749 | 3300049823 | Bacteria | 1707 |
| 522 | Ga0501044_0370122 | 3300049823 | Bacteria | 1350 |
| 523 | Ga0501045_0183883 | 3300049824 | Bacteria | 1557 |
| 524 | nmdc:mga08y16_30607_c1 | 3300050511 | Bacteria | 5663 |
| 525 | Ga0495601_0016798 | 3300053077 | Bacteria | 4439 |
| 526 | Ga0495601_0031405 | 3300053077 | Bacteria | 3301 |
| 527 | Ga0495601_0213306 | 3300053077 | Bacteria | 1261 |
| 528 | Ga0495612_0011897 | 3300053078 | Bacteria | 3508 |
| 529 | Ga0495612_0024578 | 3300053078 | Bacteria | 2418 |
| 530 | Ga0500594_0179245 | 3300053118 | Bacteria | 691 |
| 531 | Ga0500595_034078 | 3300053119 | Bacteria | 1686 |
| 532 | Ga0500590_032661 | 3300053148 | Bacteria | 2700 |
| 533 | Ga0500636_0049777 | 3300053177 | Bacteria | 2464 |
| 534 | Ga0500611_194436 | 3300053727 | Bacteria | 573 |
| 535 | Ga0500645_032291 | 3300053730 | Bacteria | 1570 |
| 536 | Ga0501084_0018973 | 3300054114 | Bacteria | 5725 |
| 537 | Ga0590075_100995 | 3300059424 | Bacteria | 751 |
| 538 | Ga0501082_0000706 | 3300060353 | Bacteria | 29338 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005440 | Ga0070705_100318922 | Ga0070705_1003189222 | 114 |
| 2 | iso_pu_bacteria | 2847930680 | 2847930739 | 126 |
| 3 | iso_pu_bacteria | 2879083081 | 2879089879 | 126 |
| 4 | iso_pu_bacteria | 2906643746 | 2906648058 | 126 |
| 5 | 3300053177 | Ga0500636_0049777 | Ga0500636_0049777_948_1430 | 127 |
| 6 | 3300028379 | Ga0268266_10404819 | Ga0268266_104048192 | 130 |
| 7 | 3300048924 | Ga0496121_0032360 | Ga0496121_0032360_2848_3327 | 130 |
| 8 | 3300048929 | Ga0496126_0099301 | Ga0496126_0099301_337_816 | 130 |
| 9 | 3300005336 | Ga0070680_101253423 | Ga0070680_1012534231 | 131 |
| 10 | 3300005344 | Ga0070661_100292393 | Ga0070661_1002923932 | 131 |
| 11 | 3300031242 | Ga0265329_10145088 | Ga0265329_101450882 | 131 |
| 12 | 3300031249 | Ga0265339_10274213 | Ga0265339_102742131 | 131 |
| 13 | 3300031344 | Ga0265316_10710490 | Ga0265316_107104902 | 131 |
| 14 | 3300031711 | Ga0265314_10231400 | Ga0265314_102314002 | 131 |
| 15 | 3300039437 | Ga0436365_0641798 | Ga0436365_0641798_149_637 | 131 |
| 16 | 3300046457 | Ga0495590_0067128 | Ga0495590_0067128_396_863 | 131 |
| 17 | 3300046474 | Ga0495605_0253237 | Ga0495605_0253237_99_566 | 131 |
| 18 | 3300046518 | Ga0495631_0237023 | Ga0495631_0237023_249_716 | 131 |
| 19 | 3300046519 | Ga0495632_0278899 | Ga0495632_0278899_141_608 | 131 |
| 20 | 3300046660 | Ga0495625_0628159 | Ga0495625_0628159_55_522 | 131 |
| 21 | 3300046684 | Ga0495669_0096629 | Ga0495669_0096629_420_887 | 131 |
| 22 | 3300046794 | Ga0495589_0181239 | Ga0495589_0181239_393_860 | 131 |
| 23 | 3300047445 | Ga0495677_0175824 | Ga0495677_0175824_203_670 | 131 |
| 24 | 3300005614 | Ga0068856_100642808 | Ga0068856_1006428082 | 132 |
| 25 | 3300037471 | Ga0395905_0343598 | Ga0395905_0343598_779_1246 | 132 |
| 26 | 3300039438 | Ga0436360_0126272 | Ga0436360_0126272_314_799 | 132 |
| 27 | 3300045976 | Ga0466967_0034932 | Ga0466967_0034932_1900_2379 | 132 |
| 28 | 3300048915 | Ga0496112_0295037 | Ga0496112_0295037_89_556 | 132 |
| 29 | 3300006028 | Ga0070717_10692533 | Ga0070717_106925331 | 133 |
| 30 | 3300006173 | Ga0070716_100307239 | Ga0070716_1003072392 | 133 |
| 31 | 3300006175 | Ga0070712_100429155 | Ga0070712_1004291551 | 133 |
| 32 | 3300025915 | Ga0207693_10317175 | Ga0207693_103171752 | 133 |
| 33 | 3300025939 | Ga0207665_10226346 | Ga0207665_102263462 | 133 |
| 34 | 3300048912 | Ga0496109_0861756 | Ga0496109_0861756_223_705 | 133 |
| 35 | 3300048918 | Ga0496115_0572777 | Ga0496115_0572777_355_837 | 133 |
| 36 | 3300005434 | Ga0070709_10012256 | Ga0070709_100122563 | 134 |
| 37 | 3300005436 | Ga0070713_100079890 | Ga0070713_1000798903 | 134 |
| 38 | 3300005439 | Ga0070711_100037156 | Ga0070711_1000371562 | 134 |
| 39 | 3300005937 | Ga0081455_10045207 | Ga0081455_100452074 | 134 |
| 40 | 3300025916 | Ga0207663_10045220 | Ga0207663_100452204 | 134 |
| 41 | 3300046507 | Ga0495606_0139328 | Ga0495606_0139328_218_694 | 134 |
| 42 | 3300046616 | Ga0495668_0447648 | Ga0495668_0447648_154_630 | 134 |
| 43 | 3300048918 | Ga0496115_0214733 | Ga0496115_0214733_956_1444 | 134 |
| 44 | 3300048924 | Ga0496121_0324630 | Ga0496121_0324630_346_825 | 134 |
| 45 | 3300031344 | Ga0265316_10151646 | Ga0265316_101516463 | 135 |
| 46 | 3300039450 | Ga0436363_0317332 | Ga0436363_0317332_55_549 | 135 |
| 47 | 3300005536 | Ga0070697_100106544 | Ga0070697_1001065442 | 136 |
| 48 | 3300007265 | Ga0099794_10041274 | Ga0099794_100412744 | 136 |
| 49 | 3300031238 | Ga0265332_10205036 | Ga0265332_102050362 | 137 |
| 50 | 3300031250 | Ga0265331_10099940 | Ga0265331_100999402 | 137 |
| 51 | 3300035691 | Ga0373931_0032222 | Ga0373931_0032222_1992_2477 | 137 |
| 52 | 3300046460 | Ga0495638_0063919 | Ga0495638_0063919_796_1269 | 137 |
| 53 | 3300005344 | Ga0070661_101461969 | Ga0070661_1014619691 | 138 |
| 54 | 3300006941 | Ga0099825_1051985 | Ga0099825_10519851 | 138 |
| 55 | 3300006942 | Ga0099824_1023403 | Ga0099824_10234032 | 138 |
| 56 | 3300006943 | Ga0099822_1001321 | Ga0099822_10013216 | 138 |
| 57 | 3300013307 | Ga0157372_10806366 | Ga0157372_108063662 | 138 |
| 58 | 3300025906 | Ga0207699_10017398 | Ga0207699_100173985 | 138 |
| 59 | 3300025913 | Ga0207695_10099675 | Ga0207695_100996751 | 138 |
| 60 | 3300027357 | Ga0209589_1000026 | Ga0209589_1000026102 | 138 |
| 61 | 3300027361 | Ga0209489_100046 | Ga0209489_100046102 | 138 |
| 62 | 3300027363 | Ga0209700_100047 | Ga0209700_100047102 | 138 |
| 63 | 3300031241 | Ga0265325_10054209 | Ga0265325_100542093 | 138 |
| 64 | 3300041451 | Ga0451791_0266516 | Ga0451791_0266516_97_573 | 138 |
| 65 | 3300046678 | Ga0495599_0168920 | Ga0495599_0168920_397_882 | 138 |
| 66 | 3300048929 | Ga0496126_0497522 | Ga0496126_0497522_178_648 | 138 |
| 67 | 3300006028 | Ga0070717_10564963 | Ga0070717_105649632 | 139 |
| 68 | 3300006028 | Ga0070717_10987529 | Ga0070717_109875292 | 139 |
| 69 | 3300006175 | Ga0070712_100784712 | Ga0070712_1007847122 | 139 |
| 70 | 3300012490 | Ga0157322_1017834 | Ga0157322_10178342 | 139 |
| 71 | 3300025915 | Ga0207693_10138394 | Ga0207693_101383944 | 139 |
| 72 | 3300035114 | Ga0373939_0333952 | Ga0373939_0333952_43_516 | 139 |
| 73 | 3300042004 | Ga0439445_0067960 | Ga0439445_0067960_440_913 | 139 |
| 74 | 3300045049 | Ga0466959_0444200 | Ga0466959_0444200_350_835 | 139 |
| 75 | 3300048913 | Ga0496110_0024914 | Ga0496110_0024914_3965_4447 | 139 |
| 76 | 3300048914 | Ga0496111_0206370 | Ga0496111_0206370_236_718 | 139 |
| 77 | 3300048915 | Ga0496112_0192368 | Ga0496112_0192368_233_715 | 139 |
| 78 | 3300037466 | Ga0395898_0581507 | Ga0395898_0581507_211_696 | 140 |
| 79 | 3300038443 | Ga0395901_0270292 | Ga0395901_0270292_945_1430 | 140 |
| 80 | 3300041512 | Ga0451853_3647681 | Ga0451853_3647681_25_489 | 140 |
| 81 | 3300046459 | Ga0495629_0122329 | Ga0495629_0122329_514_996 | 140 |
| 82 | 3300046531 | Ga0495665_0212898 | Ga0495665_0212898_266_748 | 140 |
| 83 | 3300046690 | Ga0495624_0174910 | Ga0495624_0174910_132_614 | 140 |
| 84 | 3300049583 | Ga0501067_0096394 | Ga0501067_0096394_892_1365 | 140 |
| 85 | 3300000549 | LJQas_1002886 | LJQas_10028863 | 141 |
| 86 | 3300005329 | Ga0070683_100053436 | Ga0070683_1000534361 | 141 |
| 87 | 3300005336 | Ga0070680_100013669 | Ga0070680_1000136695 | 141 |
| 88 | 3300005458 | Ga0070681_10031521 | Ga0070681_100315216 | 141 |
| 89 | 3300005530 | Ga0070679_100037345 | Ga0070679_1000373456 | 141 |
| 90 | 3300005535 | Ga0070684_100006424 | Ga0070684_10000642410 | 141 |
| 91 | 3300005563 | Ga0068855_100234696 | Ga0068855_1002346963 | 141 |
| 92 | 3300005937 | Ga0081455_10446662 | Ga0081455_104466622 | 141 |
| 93 | 3300006177 | Ga0075362_10498221 | Ga0075362_104982211 | 141 |
| 94 | 3300009093 | Ga0105240_10025127 | Ga0105240_100251275 | 141 |
| 95 | 3300009093 | Ga0105240_10361769 | Ga0105240_103617691 | 141 |
| 96 | 3300009174 | Ga0105241_10399589 | Ga0105241_103995892 | 141 |
| 97 | 3300013105 | Ga0157369_10016827 | Ga0157369_100168275 | 141 |
| 98 | 3300013105 | Ga0157369_10207767 | Ga0157369_102077672 | 141 |
| 99 | 3300013307 | Ga0157372_10182165 | Ga0157372_101821652 | 141 |
| 100 | 3300013307 | Ga0157372_10556853 | Ga0157372_105568532 | 141 |
| 101 | 3300022467 | Ga0224712_10315549 | Ga0224712_103155491 | 141 |
| 102 | 3300025254 | Ga0209148_1037096 | Ga0209148_10370962 | 141 |
| 103 | 3300025906 | Ga0207699_10065148 | Ga0207699_100651484 | 141 |
| 104 | 3300025912 | Ga0207707_10003721 | Ga0207707_100037217 | 141 |
| 105 | 3300025913 | Ga0207695_10138448 | Ga0207695_101384483 | 141 |
| 106 | 3300025914 | Ga0207671_10374325 | Ga0207671_103743252 | 141 |
| 107 | 3300025917 | Ga0207660_10067891 | Ga0207660_100678912 | 141 |
| 108 | 3300025921 | Ga0207652_10051591 | Ga0207652_100515914 | 141 |
| 109 | 3300025928 | Ga0207700_10139086 | Ga0207700_101390861 | 141 |
| 110 | 3300025944 | Ga0207661_10032589 | Ga0207661_100325892 | 141 |
| 111 | 3300025949 | Ga0207667_10195274 | Ga0207667_101952743 | 141 |
| 112 | 3300026041 | Ga0207639_10065898 | Ga0207639_100658982 | 141 |
| 113 | 3300026142 | Ga0207698_10309443 | Ga0207698_103094431 | 141 |
| 114 | 3300031250 | Ga0265331_10180781 | Ga0265331_101807812 | 141 |
| 115 | 3300035116 | Ga0373945_0036458 | Ga0373945_0036458_1046_1528 | 141 |
| 116 | 3300035170 | Ga0373943_0015780 | Ga0373943_0015780_1910_2392 | 141 |
| 117 | 3300035171 | Ga0373946_0122726 | Ga0373946_0122726_674_1156 | 141 |
| 118 | 3300035725 | Ga0373947_0013693 | Ga0373947_0013693_2612_3094 | 141 |
| 119 | 3300037068 | Ga0373925_0164835 | Ga0373925_0164835_104_586 | 141 |
| 120 | 3300037312 | Ga0395899_0165601 | Ga0395899_0165601_494_976 | 141 |
| 121 | 3300037418 | Ga0395900_0005919 | Ga0395900_0005919_10410_10892 | 141 |
| 122 | 3300037466 | Ga0395898_0080592 | Ga0395898_0080592_349_831 | 141 |
| 123 | 3300038443 | Ga0395901_0049784 | Ga0395901_0049784_935_1417 | 141 |
| 124 | 3300044656 | Ga0466969_0173936 | Ga0466969_0173936_108_596 | 141 |
| 125 | 3300044683 | Ga0466965_0252190 | Ga0466965_0252190_77_565 | 141 |
| 126 | 3300046455 | Ga0495603_0006019 | Ga0495603_0006019_1651_2133 | 141 |
| 127 | 3300046472 | Ga0495580_0085216 | Ga0495580_0085216_556_1038 | 141 |
| 128 | 3300046475 | Ga0495639_0056089 | Ga0495639_0056089_63_545 | 141 |
| 129 | 3300046477 | Ga0495664_0024378 | Ga0495664_0024378_2724_3221 | 141 |
| 130 | 3300046543 | Ga0495645_0004961 | Ga0495645_0004961_5943_6440 | 141 |
| 131 | 3300046683 | Ga0495658_0337952 | Ga0495658_0337952_379_861 | 141 |
| 132 | 3300047315 | Ga0495581_0163134 | Ga0495581_0163134_311_793 | 141 |
| 133 | 3300047321 | Ga0495676_0234512 | Ga0495676_0234512_732_1214 | 141 |
| 134 | 3300047470 | Ga0495681_0109404 | Ga0495681_0109404_346_813 | 141 |
| 135 | 3300048908 | Ga0496105_0343995 | Ga0496105_0343995_299_781 | 141 |
| 136 | 3300048915 | Ga0496112_0504827 | Ga0496112_0504827_443_913 | 141 |
| 137 | 3300048929 | Ga0496126_0267842 | Ga0496126_0267842_549_1040 | 141 |
| 138 | 3300053077 | Ga0495601_0031405 | Ga0495601_0031405_2498_2995 | 141 |
| 139 | 3300053078 | Ga0495612_0024578 | Ga0495612_0024578_360_857 | 141 |
| 140 | 3300005338 | Ga0068868_100702377 | Ga0068868_1007023771 | 142 |
| 141 | 3300005434 | Ga0070709_10010369 | Ga0070709_100103696 | 142 |
| 142 | 3300005435 | Ga0070714_100011580 | Ga0070714_1000115803 | 142 |
| 143 | 3300005436 | Ga0070713_100000768 | Ga0070713_1000007682 | 142 |
| 144 | 3300005437 | Ga0070710_10001851 | Ga0070710_100018519 | 142 |
| 145 | 3300005439 | Ga0070711_100008471 | Ga0070711_1000084714 | 142 |
| 146 | 3300005539 | Ga0068853_100084191 | Ga0068853_1000841912 | 142 |
| 147 | 3300005840 | Ga0068870_10352072 | Ga0068870_103520721 | 142 |
| 148 | 3300006028 | Ga0070717_10032681 | Ga0070717_100326813 | 142 |
| 149 | 3300006163 | Ga0070715_10002760 | Ga0070715_100027601 | 142 |
| 150 | 3300006163 | Ga0070715_10025029 | Ga0070715_100250293 | 142 |
| 151 | 3300006173 | Ga0070716_100026589 | Ga0070716_1000265891 | 142 |
| 152 | 3300006175 | Ga0070712_100115260 | Ga0070712_1001152603 | 142 |
| 153 | 3300025898 | Ga0207692_10004277 | Ga0207692_100042777 | 142 |
| 154 | 3300025898 | Ga0207692_10008712 | Ga0207692_100087125 | 142 |
| 155 | 3300025905 | Ga0207685_10001592 | Ga0207685_100015926 | 142 |
| 156 | 3300025915 | Ga0207693_10000073 | Ga0207693_1000007337 | 142 |
| 157 | 3300025915 | Ga0207693_10032313 | Ga0207693_100323136 | 142 |
| 158 | 3300025916 | Ga0207663_10043982 | Ga0207663_100439823 | 142 |
| 159 | 3300025928 | Ga0207700_10140077 | Ga0207700_101400773 | 142 |
| 160 | 3300025938 | Ga0207704_10876449 | Ga0207704_108764492 | 142 |
| 161 | 3300025939 | Ga0207665_10000629 | Ga0207665_100006296 | 142 |
| 162 | 3300031730 | Ga0307516_10356017 | Ga0307516_103560172 | 142 |
| 163 | 3300037418 | Ga0395900_0329922 | Ga0395900_0329922_466_939 | 142 |
| 164 | 3300039438 | Ga0436360_0025635 | Ga0436360_0025635_1421_1906 | 142 |
| 165 | 3300039447 | Ga0436361_0208086 | Ga0436361_0208086_1223_1708 | 142 |
| 166 | 3300039450 | Ga0436363_0483223 | Ga0436363_0483223_530_1015 | 142 |
| 167 | 3300039453 | Ga0436362_0415444 | Ga0436362_0415444_339_824 | 142 |
| 168 | 3300041498 | Ga0451841_0383047 | Ga0451841_0383047_180_653 | 142 |
| 169 | 3300046499 | Ga0495594_0200532 | Ga0495594_0200532_645_1118 | 142 |
| 170 | 3300046523 | Ga0495644_0191421 | Ga0495644_0191421_217_690 | 142 |
| 171 | 3300046537 | Ga0495598_0047934 | Ga0495598_0047934_315_788 | 142 |
| 172 | 3300046615 | Ga0495656_0029787 | Ga0495656_0029787_495_968 | 142 |
| 173 | 3300046664 | Ga0495659_0173531 | Ga0495659_0173531_26_499 | 142 |
| 174 | 3300047447 | Ga0495685_116515 | Ga0495685_116515_339_812 | 142 |
| 175 | 3300049585 | Ga0501069_0635641 | Ga0501069_0635641_151_621 | 142 |
| 176 | 3300005434 | Ga0070709_10001043 | Ga0070709_100010439 | 143 |
| 177 | 3300005435 | Ga0070714_100019087 | Ga0070714_1000190874 | 143 |
| 178 | 3300005436 | Ga0070713_100030913 | Ga0070713_1000309135 | 143 |
| 179 | 3300005539 | Ga0068853_101025522 | Ga0068853_1010255222 | 143 |
| 180 | 3300005563 | Ga0068855_100346982 | Ga0068855_1003469822 | 143 |
| 181 | 3300006173 | Ga0070716_100007223 | Ga0070716_1000072235 | 143 |
| 182 | 3300006175 | Ga0070712_100024896 | Ga0070712_1000248964 | 143 |
| 183 | 3300009098 | Ga0105245_10410345 | Ga0105245_104103453 | 143 |
| 184 | 3300009551 | Ga0105238_10067737 | Ga0105238_100677374 | 143 |
| 185 | 3300013296 | Ga0157374_10129041 | Ga0157374_101290412 | 143 |
| 186 | 3300025906 | Ga0207699_10000360 | Ga0207699_1000036013 | 143 |
| 187 | 3300025914 | Ga0207671_10609231 | Ga0207671_106092312 | 143 |
| 188 | 3300025924 | Ga0207694_10017077 | Ga0207694_100170774 | 143 |
| 189 | 3300025928 | Ga0207700_10034750 | Ga0207700_100347505 | 143 |
| 190 | 3300025929 | Ga0207664_10106842 | Ga0207664_101068421 | 143 |
| 191 | 3300025939 | Ga0207665_10061881 | Ga0207665_100618812 | 143 |
| 192 | 3300025949 | Ga0207667_10604583 | Ga0207667_106045832 | 143 |
| 193 | 3300026041 | Ga0207639_10836249 | Ga0207639_108362492 | 143 |
| 194 | 3300032002 | Ga0307416_101193611 | Ga0307416_1011936111 | 143 |
| 195 | 3300035170 | Ga0373943_0708187 | Ga0373943_0708187_73_546 | 143 |
| 196 | 3300035724 | Ga0373933_0000277 | Ga0373933_0000277_2169_2645 | 143 |
| 197 | 3300048905 | Ga0496102_1775448 | Ga0496102_1775448_39_509 | 143 |
| 198 | 3300048924 | Ga0496121_0652168 | Ga0496121_0652168_88_564 | 143 |
| 199 | 3300003203 | JGI25406J46586_10015879 | JGI25406J46586_100158794 | 144 |
| 200 | 3300005548 | Ga0070665_100550617 | Ga0070665_1005506172 | 144 |
| 201 | 3300005985 | Ga0081539_10001014 | Ga0081539_1000101439 | 144 |
| 202 | 3300009553 | Ga0105249_11105357 | Ga0105249_111053572 | 144 |
| 203 | 3300031235 | Ga0265330_10019516 | Ga0265330_100195162 | 144 |
| 204 | 3300031239 | Ga0265328_10099924 | Ga0265328_100999241 | 144 |
| 205 | 3300031247 | Ga0265340_10001209 | Ga0265340_1000120912 | 144 |
| 206 | 3300031616 | Ga0307508_10000005 | Ga0307508_1000000531 | 144 |
| 207 | 3300048907 | Ga0496104_0832423 | Ga0496104_0832423_15_488 | 144 |
| 208 | 3300048918 | Ga0496115_0561033 | Ga0496115_0561033_129_599 | 144 |
| 209 | 3300003214 | JGI25165J46597_1008974 | JGI25165J46597_10089742 | 145 |
| 210 | 3300005366 | Ga0070659_100676592 | Ga0070659_1006765922 | 145 |
| 211 | 3300005548 | Ga0070665_100145154 | Ga0070665_1001451542 | 145 |
| 212 | 3300025261 | Ga0209233_1003722 | Ga0209233_10037227 | 145 |
| 213 | 3300026067 | Ga0207678_10073356 | Ga0207678_100733564 | 145 |
| 214 | 3300041496 | Ga0451839_0145521 | Ga0451839_0145521_59_535 | 145 |
| 215 | 3300045976 | Ga0466967_0071213 | Ga0466967_0071213_84_563 | 145 |
| 216 | 3300046455 | Ga0495603_0228227 | Ga0495603_0228227_457_936 | 145 |
| 217 | 3300046473 | Ga0495582_0123335 | Ga0495582_0123335_426_902 | 145 |
| 218 | 3300046681 | Ga0495647_0329345 | Ga0495647_0329345_112_588 | 145 |
| 219 | 3300048903 | Ga0496100_0189456 | Ga0496100_0189456_32_502 | 145 |
| 220 | 3300048903 | Ga0496100_1247179 | Ga0496100_1247179_34_477 | 145 |
| 221 | 3300048904 | Ga0496101_0078600 | Ga0496101_0078600_1645_2115 | 145 |
| 222 | 3300048907 | Ga0496104_0022858 | Ga0496104_0022858_4573_5043 | 145 |
| 223 | 3300048908 | Ga0496105_0253213 | Ga0496105_0253213_945_1415 | 145 |
| 224 | 3300048909 | Ga0496106_0000810 | Ga0496106_0000810_10879_11349 | 145 |
| 225 | 3300048911 | Ga0496108_0000553 | Ga0496108_0000553_13872_14342 | 145 |
| 226 | 3300048912 | Ga0496109_0000574 | Ga0496109_0000574_16302_16772 | 145 |
| 227 | 3300048913 | Ga0496110_0029231 | Ga0496110_0029231_1614_2084 | 145 |
| 228 | 3300048916 | Ga0496113_0156113 | Ga0496113_0156113_243_713 | 145 |
| 229 | 3300048917 | Ga0496114_0346324 | Ga0496114_0346324_746_1216 | 145 |
| 230 | 3300048929 | Ga0496126_0134202 | Ga0496126_0134202_74_565 | 145 |
| 231 | 3300049574 | Ga0501038_0065277 | Ga0501038_0065277_2138_2581 | 145 |
| 232 | 3300049823 | Ga0501044_0251749 | Ga0501044_0251749_706_1149 | 145 |
| 233 | 3300005434 | Ga0070709_10380117 | Ga0070709_103801172 | 146 |
| 234 | 3300009545 | Ga0105237_10897798 | Ga0105237_108977982 | 146 |
| 235 | 3300031616 | Ga0307508_10119212 | Ga0307508_101192123 | 146 |
| 236 | 3300035170 | Ga0373943_0203010 | Ga0373943_0203010_446_919 | 146 |
| 237 | 3300035695 | Ga0373927_0119275 | Ga0373927_0119275_390_863 | 146 |
| 238 | 3300037471 | Ga0395905_0610301 | Ga0395905_0610301_53_523 | 146 |
| 239 | 3300005337 | Ga0070682_100723300 | Ga0070682_1007233001 | 147 |
| 240 | 3300005563 | Ga0068855_100494617 | Ga0068855_1004946172 | 147 |
| 241 | 3300005578 | Ga0068854_100823096 | Ga0068854_1008230962 | 147 |
| 242 | 3300005614 | Ga0068856_100002885 | Ga0068856_1000028852 | 147 |
| 243 | 3300009093 | Ga0105240_10003827 | Ga0105240_1000382723 | 147 |
| 244 | 3300009094 | Ga0111539_10255735 | Ga0111539_102557354 | 147 |
| 245 | 3300009174 | Ga0105241_10000556 | Ga0105241_100005564 | 147 |
| 246 | 3300009545 | Ga0105237_10145308 | Ga0105237_101453083 | 147 |
| 247 | 3300009551 | Ga0105238_10001118 | Ga0105238_100011183 | 147 |
| 248 | 3300013104 | Ga0157370_10268631 | Ga0157370_102686312 | 147 |
| 249 | 3300025911 | Ga0207654_10000538 | Ga0207654_1000053810 | 147 |
| 250 | 3300025913 | Ga0207695_10000366 | Ga0207695_1000036616 | 147 |
| 251 | 3300025924 | Ga0207694_10001709 | Ga0207694_1000170915 | 147 |
| 252 | 3300025949 | Ga0207667_10935962 | Ga0207667_109359622 | 147 |
| 253 | 3300025981 | Ga0207640_10968465 | Ga0207640_109684651 | 147 |
| 254 | 3300026078 | Ga0207702_10000453 | Ga0207702_1000045342 | 147 |
| 255 | 3300027907 | Ga0207428_10181128 | Ga0207428_101811282 | 147 |
| 256 | 3300031235 | Ga0265330_10097457 | Ga0265330_100974572 | 147 |
| 257 | 3300035118 | Ga0373954_0077480 | Ga0373954_0077480_726_1211 | 147 |
| 258 | 3300035120 | Ga0373957_0013607 | Ga0373957_0013607_607_1092 | 147 |
| 259 | 3300035170 | Ga0373943_0018606 | Ga0373943_0018606_964_1449 | 147 |
| 260 | 3300035172 | Ga0373955_0020052 | Ga0373955_0020052_1736_2221 | 147 |
| 261 | 3300035691 | Ga0373931_0158549 | Ga0373931_0158549_100_573 | 147 |
| 262 | 3300035692 | Ga0373935_0292991 | Ga0373935_0292991_152_637 | 147 |
| 263 | 3300035695 | Ga0373927_0078421 | Ga0373927_0078421_1154_1639 | 147 |
| 264 | 3300035724 | Ga0373933_0115600 | Ga0373933_0115600_817_1302 | 147 |
| 265 | 3300035724 | Ga0373933_0128594 | Ga0373933_0128594_126_611 | 147 |
| 266 | 3300036401 | Ga0373937_0012106 | Ga0373937_0012106_3752_4237 | 147 |
| 267 | 3300037068 | Ga0373925_0016508 | Ga0373925_0016508_1736_2221 | 147 |
| 268 | 3300037068 | Ga0373925_0339409 | Ga0373925_0339409_124_609 | 147 |
| 269 | 3300037853 | Ga0436364_0971828 | Ga0436364_0971828_730_1251 | 147 |
| 270 | 3300041503 | Ga0451847_0266158 | Ga0451847_0266158_30_503 | 147 |
| 271 | 3300044656 | Ga0466969_0148299 | Ga0466969_0148299_105_578 | 147 |
| 272 | 3300046454 | Ga0495592_0022768 | Ga0495592_0022768_3305_3790 | 147 |
| 273 | 3300046455 | Ga0495603_0066730 | Ga0495603_0066730_1589_2074 | 147 |
| 274 | 3300046459 | Ga0495629_0049319 | Ga0495629_0049319_1722_2207 | 147 |
| 275 | 3300046472 | Ga0495580_0019910 | Ga0495580_0019910_4429_4914 | 147 |
| 276 | 3300046473 | Ga0495582_0036829 | Ga0495582_0036829_841_1326 | 147 |
| 277 | 3300046475 | Ga0495639_0549321 | Ga0495639_0549321_10_495 | 147 |
| 278 | 3300046476 | Ga0495662_0044289 | Ga0495662_0044289_399_884 | 147 |
| 279 | 3300046477 | Ga0495664_0054940 | Ga0495664_0054940_520_1005 | 147 |
| 280 | 3300046499 | Ga0495594_0576445 | Ga0495594_0576445_110_595 | 147 |
| 281 | 3300046517 | Ga0495630_0015076 | Ga0495630_0015076_4443_4928 | 147 |
| 282 | 3300046529 | Ga0495652_0160096 | Ga0495652_0160096_806_1291 | 147 |
| 283 | 3300046533 | Ga0495640_0051208 | Ga0495640_0051208_2267_2752 | 147 |
| 284 | 3300046559 | Ga0495667_0306162 | Ga0495667_0306162_470_955 | 147 |
| 285 | 3300046663 | Ga0495635_0154668 | Ga0495635_0154668_38_523 | 147 |
| 286 | 3300046678 | Ga0495599_0479128 | Ga0495599_0479128_225_710 | 147 |
| 287 | 3300046681 | Ga0495647_0081584 | Ga0495647_0081584_433_918 | 147 |
| 288 | 3300046689 | Ga0495613_0451989 | Ga0495613_0451989_220_705 | 147 |
| 289 | 3300046690 | Ga0495624_0027494 | Ga0495624_0027494_2994_3479 | 147 |
| 290 | 3300047315 | Ga0495581_0046820 | Ga0495581_0046820_105_590 | 147 |
| 291 | 3300047319 | Ga0495674_0048964 | Ga0495674_0048964_1350_1835 | 147 |
| 292 | 3300047673 | Ga0495593_0005454 | Ga0495593_0005454_3027_3512 | 147 |
| 293 | 3300049568 | Ga0501031_0000869 | Ga0501031_0000869_16735_17187 | 147 |
| 294 | 3300049569 | Ga0501032_0000309 | Ga0501032_0000309_8216_8668 | 147 |
| 295 | 3300049570 | Ga0501033_0001798 | Ga0501033_0001798_12596_13048 | 147 |
| 296 | 3300049571 | Ga0501034_0000082 | Ga0501034_0000082_124429_124881 | 147 |
| 297 | 3300049572 | Ga0501036_0000121 | Ga0501036_0000121_10093_10545 | 147 |
| 298 | 3300049573 | Ga0501037_0000346 | Ga0501037_0000346_31366_31818 | 147 |
| 299 | 3300049575 | Ga0501039_0009593 | Ga0501039_0009593_3381_3833 | 147 |
| 300 | 3300049579 | Ga0501043_0000109 | Ga0501043_0000109_14801_15253 | 147 |
| 301 | 3300049580 | Ga0501046_0000101 | Ga0501046_0000101_8144_8596 | 147 |
| 302 | 3300049581 | Ga0501047_0000331 | Ga0501047_0000331_10056_10508 | 147 |
| 303 | 3300049582 | Ga0501048_0002703 | Ga0501048_0002703_7865_8317 | 147 |
| 304 | 3300049583 | Ga0501067_0000534 | Ga0501067_0000534_16145_16597 | 147 |
| 305 | 3300049584 | Ga0501068_0000276 | Ga0501068_0000276_6554_7006 | 147 |
| 306 | 3300049587 | Ga0501071_0052281 | Ga0501071_0052281_653_1105 | 147 |
| 307 | 3300049588 | Ga0501072_0004822 | Ga0501072_0004822_5839_6291 | 147 |
| 308 | 3300049589 | Ga0501073_0000101 | Ga0501073_0000101_33524_33976 | 147 |
| 309 | 3300049590 | Ga0501074_0000187 | Ga0501074_0000187_25496_25948 | 147 |
| 310 | 3300049592 | Ga0501076_0811965 | Ga0501076_0811965_296_748 | 147 |
| 311 | 3300049741 | Ga0501079_0001908 | Ga0501079_0001908_13341_13793 | 147 |
| 312 | 3300049742 | Ga0501080_0000151 | Ga0501080_0000151_17709_18161 | 147 |
| 313 | 3300049742 | Ga0501080_0490526 | Ga0501080_0490526_405_875 | 147 |
| 314 | 3300049744 | Ga0501083_0007235 | Ga0501083_0007235_5528_5980 | 147 |
| 315 | 3300049822 | Ga0501035_0000150 | Ga0501035_0000150_2768_3220 | 147 |
| 316 | 3300049823 | Ga0501044_0000247 | Ga0501044_0000247_51015_51467 | 147 |
| 317 | 3300049824 | Ga0501045_0183883 | Ga0501045_0183883_419_871 | 147 |
| 318 | 3300050511 | nmdc:mga08y16_30607_c1 | nmdc:mga08y16_30607_c1_4504_4977 | 147 |
| 319 | 3300053077 | Ga0495601_0016798 | Ga0495601_0016798_1613_2098 | 147 |
| 320 | 3300053078 | Ga0495612_0011897 | Ga0495612_0011897_2166_2651 | 147 |
| 321 | 3300054114 | Ga0501084_0018973 | Ga0501084_0018973_5209_5661 | 147 |
| 322 | 3300059424 | Ga0590075_100995 | Ga0590075_100995_73_597 | 147 |
| 323 | 3300060353 | Ga0501082_0000706 | Ga0501082_0000706_5619_6071 | 147 |
| 324 | 3300005356 | Ga0070674_100380237 | Ga0070674_1003802371 | 148 |
| 325 | 3300005614 | Ga0068856_101258250 | Ga0068856_1012582502 | 148 |
| 326 | 3300006881 | Ga0068865_100269667 | Ga0068865_1002696672 | 148 |
| 327 | 3300009545 | Ga0105237_10807238 | Ga0105237_108072382 | 148 |
| 328 | 3300009551 | Ga0105238_10353337 | Ga0105238_103533373 | 148 |
| 329 | 3300011119 | Ga0105246_11582617 | Ga0105246_115826172 | 148 |
| 330 | 3300013297 | Ga0157378_11112730 | Ga0157378_111127301 | 148 |
| 331 | 3300013308 | Ga0157375_10169545 | Ga0157375_101695452 | 148 |
| 332 | 3300014326 | Ga0157380_11203563 | Ga0157380_112035632 | 148 |
| 333 | 3300017792 | Ga0163161_11600853 | Ga0163161_116008531 | 148 |
| 334 | 3300025914 | Ga0207671_10628908 | Ga0207671_106289082 | 148 |
| 335 | 3300025938 | Ga0207704_10491326 | Ga0207704_104913262 | 148 |
| 336 | 3300026121 | Ga0207683_10142711 | Ga0207683_101427112 | 148 |
| 337 | 3300031548 | Ga0307408_100519028 | Ga0307408_1005190282 | 148 |
| 338 | 3300041507 | Ga0451851_0204890 | Ga0451851_0204890_24_503 | 148 |
| 339 | 3300046506 | Ga0495583_0257515 | Ga0495583_0257515_90_563 | 148 |
| 340 | 3300046523 | Ga0495644_0177693 | Ga0495644_0177693_223_702 | 148 |
| 341 | iso_pu_bacteria | 2667528175 | 2671123604 | 148 |
| 342 | iso_pu_bacteria | 8056673599 | 8056676303 | 148 |
| 343 | 3300003354 | JGI25160J50197_1001574 | JGI25160J50197_10015748 | 149 |
| 344 | 3300005365 | Ga0070688_100348233 | Ga0070688_1003482331 | 149 |
| 345 | 3300005434 | Ga0070709_10255137 | Ga0070709_102551372 | 149 |
| 346 | 3300005563 | Ga0068855_101396215 | Ga0068855_1013962152 | 149 |
| 347 | 3300005842 | Ga0068858_100123119 | Ga0068858_1001231193 | 149 |
| 348 | 3300005985 | Ga0081539_10035919 | Ga0081539_100359192 | 149 |
| 349 | 3300009174 | Ga0105241_10435018 | Ga0105241_104350182 | 149 |
| 350 | 3300011119 | Ga0105246_10329502 | Ga0105246_103295022 | 149 |
| 351 | 3300013306 | Ga0163162_10122327 | Ga0163162_101223274 | 149 |
| 352 | 3300013308 | Ga0157375_10883148 | Ga0157375_108831482 | 149 |
| 353 | 3300014325 | Ga0163163_10038427 | Ga0163163_100384272 | 149 |
| 354 | 3300014969 | Ga0157376_10061223 | Ga0157376_100612232 | 149 |
| 355 | 3300025906 | Ga0207699_10719419 | Ga0207699_107194191 | 149 |
| 356 | 3300025929 | Ga0207664_10374588 | Ga0207664_103745882 | 149 |
| 357 | 3300025945 | Ga0207679_10802862 | Ga0207679_108028622 | 149 |
| 358 | 3300026078 | Ga0207702_11730374 | Ga0207702_117303741 | 149 |
| 359 | 3300037471 | Ga0395905_0520023 | Ga0395905_0520023_62_535 | 149 |
| 360 | 3300039450 | Ga0436363_1572509 | Ga0436363_1572509_952_1404 | 149 |
| 361 | 3300048903 | Ga0496100_0434515 | Ga0496100_0434515_478_954 | 149 |
| 362 | 3300048906 | Ga0496103_0242678 | Ga0496103_0242678_634_1110 | 149 |
| 363 | 3300048907 | Ga0496104_0020896 | Ga0496104_0020896_3650_4126 | 149 |
| 364 | 3300048909 | Ga0496106_0014681 | Ga0496106_0014681_376_852 | 149 |
| 365 | 3300048911 | Ga0496108_0021077 | Ga0496108_0021077_1946_2422 | 149 |
| 366 | 3300048913 | Ga0496110_0005711 | Ga0496110_0005711_1594_2070 | 149 |
| 367 | 3300048915 | Ga0496112_0002964 | Ga0496112_0002964_11654_12130 | 149 |
| 368 | 3300048917 | Ga0496114_0379995 | Ga0496114_0379995_438_914 | 149 |
| 369 | 3300048922 | Ga0496119_0317910 | Ga0496119_0317910_88_558 | 149 |
| 370 | 3300048924 | Ga0496121_0021056 | Ga0496121_0021056_4266_4739 | 149 |
| 371 | 3300048925 | Ga0496122_0139371 | Ga0496122_0139371_253_723 | 149 |
| 372 | 3300048928 | Ga0496125_0099370 | Ga0496125_0099370_636_1109 | 149 |
| 373 | 3300048929 | Ga0496126_0011673 | Ga0496126_0011673_1148_1618 | 149 |
| 374 | 3300048929 | Ga0496126_0019226 | Ga0496126_0019226_4023_4496 | 149 |
| 375 | 3300048929 | Ga0496126_0076440 | Ga0496126_0076440_1839_2312 | 149 |
| 376 | 3300041997 | Ga0439431_0048116 | Ga0439431_0048116_48_521 | 150 |
| 377 | 3300053118 | Ga0500594_0179245 | Ga0500594_0179245_124_606 | 150 |
| 378 | iso_pu_bacteria | 2513237101 | 2513694045 | 150 |
| 379 | iso_pu_bacteria | 2721755755 | 2723849345 | 150 |
| 380 | iso_pu_bacteria | 2874604998 | 2874608423 | 150 |
| 381 | iso_pu_bacteria | 2889033259 | 2889035867 | 150 |
| 382 | iso_pu_bacteria | 2922361189 | 2922364345 | 150 |
| 383 | iso_pu_bacteria | 8006964411 | 8006970219 | 150 |
| 384 | iso_pu_bacteria | 8006994254 | 8006999093 | 150 |
| 385 | 3300005614 | Ga0068856_100313226 | Ga0068856_1003132262 | 151 |
| 386 | 3300005981 | Ga0081538_10050574 | Ga0081538_100505741 | 151 |
| 387 | 3300026078 | Ga0207702_11372513 | Ga0207702_113725132 | 151 |
| 388 | 3300037312 | Ga0395899_0095816 | Ga0395899_0095816_229_693 | 151 |
| 389 | 3300037418 | Ga0395900_0265512 | Ga0395900_0265512_188_652 | 151 |
| 390 | 3300048909 | Ga0496106_0707806 | Ga0496106_0707806_56_541 | 151 |
| 391 | 3300049569 | Ga0501032_0107750 | Ga0501032_0107750_445_909 | 151 |
| 392 | 3300049570 | Ga0501033_0308964 | Ga0501033_0308964_493_957 | 151 |
| 393 | 3300049579 | Ga0501043_0134839 | Ga0501043_0134839_248_712 | 151 |
| 394 | 3300049580 | Ga0501046_0154066 | Ga0501046_0154066_423_887 | 151 |
| 395 | 3300049581 | Ga0501047_0225666 | Ga0501047_0225666_59_523 | 151 |
| 396 | 3300049581 | Ga0501047_1005685 | Ga0501047_1005685_70_531 | 151 |
| 397 | 3300049586 | Ga0501070_0166875 | Ga0501070_0166875_73_537 | 151 |
| 398 | 3300049822 | Ga0501035_0256721 | Ga0501035_0256721_70_534 | 151 |
| 399 | 3300049823 | Ga0501044_0114264 | Ga0501044_0114264_459_923 | 151 |
| 400 | 3300049823 | Ga0501044_0134311 | Ga0501044_0134311_60_524 | 151 |
| 401 | 3300049823 | Ga0501044_0370122 | Ga0501044_0370122_414_878 | 151 |
| 402 | iso_pu_bacteria | 2876808645 | 2876815947 | 151 |
| 403 | iso_pu_bacteria | 2879110137 | 2879112809 | 151 |
| 404 | iso_pu_bacteria | 8006984368 | 8006992443 | 151 |
| 405 | iso_pu_bacteria | 8056681323 | 8056683029 | 151 |
| 406 | 3300031456 | Ga0307513_10208951 | Ga0307513_102089511 | 152 |
| 407 | 3300046519 | Ga0495632_0068529 | Ga0495632_0068529_839_1303 | 152 |
| 408 | 3300046660 | Ga0495625_0476151 | Ga0495625_0476151_260_739 | 152 |
| 409 | 3300048088 | Ga0495602_0287598 | Ga0495602_0287598_114_584 | 152 |
| 410 | 3300053077 | Ga0495601_0213306 | Ga0495601_0213306_643_1122 | 152 |
| 411 | 3300053727 | Ga0500611_194436 | Ga0500611_194436_53_532 | 152 |
| 412 | 3300053730 | Ga0500645_032291 | Ga0500645_032291_708_1172 | 152 |
| 413 | iso_pu_bacteria | 2513237098 | 2513673919 | 152 |
| 414 | iso_pu_bacteria | 2513237141 | 2513890399 | 152 |
| 415 | iso_pu_bacteria | 2524023210 | 2524468369 | 152 |
| 416 | iso_pu_bacteria | 2524023228 | 2524535241 | 152 |
| 417 | iso_pu_bacteria | 2728368998 | 2728752039 | 152 |
| 418 | iso_pu_bacteria | 2885383462 | 2885389452 | 152 |
| 419 | iso_pu_bacteria | 2903768456 | 2903775704 | 152 |
| 420 | iso_pu_bacteria | 2904690495 | 2904699254 | 152 |
| 421 | iso_pu_bacteria | 2904699407 | 2904707971 | 152 |
| 422 | iso_pu_bacteria | 2908756301 | 2908758853 | 152 |
| 423 | iso_pu_bacteria | 8006933436 | 8006936708 | 152 |
| 424 | iso_pu_bacteria | 8006973647 | 8006976678 | 152 |
| 425 | iso_pu_bacteria | 8056689827 | 8056693968 | 152 |
| 426 | 3300001990 | JGI24737J22298_10023916 | JGI24737J22298_100239164 | 153 |
| 427 | 3300002067 | JGI24735J21928_10032987 | JGI24735J21928_100329872 | 153 |
| 428 | 3300002075 | JGI24738J21930_10035415 | JGI24738J21930_100354152 | 153 |
| 429 | 3300005339 | Ga0070660_100954265 | Ga0070660_1009542651 | 153 |
| 430 | 3300005539 | Ga0068853_100021142 | Ga0068853_1000211424 | 153 |
| 431 | 3300005563 | Ga0068855_100100067 | Ga0068855_1001000672 | 153 |
| 432 | 3300005577 | Ga0068857_100005806 | Ga0068857_10000580610 | 153 |
| 433 | 3300005578 | Ga0068854_100003966 | Ga0068854_1000039662 | 153 |
| 434 | 3300005614 | Ga0068856_100059629 | Ga0068856_1000596292 | 153 |
| 435 | 3300005616 | Ga0068852_100070502 | Ga0068852_1000705024 | 153 |
| 436 | 3300009093 | Ga0105240_10010949 | Ga0105240_100109496 | 153 |
| 437 | 3300009174 | Ga0105241_10225803 | Ga0105241_102258031 | 153 |
| 438 | 3300009545 | Ga0105237_10047943 | Ga0105237_100479433 | 153 |
| 439 | 3300009551 | Ga0105238_10021839 | Ga0105238_100218395 | 153 |
| 440 | 3300010375 | Ga0105239_10006974 | Ga0105239_1000697411 | 153 |
| 441 | 3300013307 | Ga0157372_11680900 | Ga0157372_116809001 | 153 |
| 442 | 3300025904 | Ga0207647_10007113 | Ga0207647_100071135 | 153 |
| 443 | 3300025913 | Ga0207695_10120304 | Ga0207695_101203041 | 153 |
| 444 | 3300025919 | Ga0207657_10224606 | Ga0207657_102246062 | 153 |
| 445 | 3300025924 | Ga0207694_10088228 | Ga0207694_100882282 | 153 |
| 446 | 3300025949 | Ga0207667_10002298 | Ga0207667_1000229820 | 153 |
| 447 | 3300025981 | Ga0207640_10049724 | Ga0207640_100497242 | 153 |
| 448 | 3300026041 | Ga0207639_10002667 | Ga0207639_100026679 | 153 |
| 449 | 3300026078 | Ga0207702_10032539 | Ga0207702_100325394 | 153 |
| 450 | 3300026116 | Ga0207674_10007557 | Ga0207674_100075576 | 153 |
| 451 | 3300031548 | Ga0307408_100706468 | Ga0307408_1007064682 | 153 |
| 452 | iso_pu_bacteria | 2513237102 | 2513700406 | 153 |
| 453 | iso_pu_bacteria | 2513237104 | 2513718811 | 153 |
| 454 | iso_pu_bacteria | 2824617872 | 2824625623 | 153 |
| 455 | iso_pu_bacteria | 2824626560 | 2824631758 | 153 |
| 456 | iso_pu_bacteria | 2824635225 | 2824643000 | 153 |
| 457 | iso_pu_bacteria | 2824644064 | 2824651014 | 153 |
| 458 | iso_pu_bacteria | 2824723954 | 2824731174 | 153 |
| 459 | 3300002070 | JGI24750J21931_1008207 | JGI24750J21931_10082071 | 154 |
| 460 | 3300002077 | JGI24744J21845_10038948 | JGI24744J21845_100389481 | 154 |
| 461 | 3300005347 | Ga0070668_100210169 | Ga0070668_1002101691 | 154 |
| 462 | 3300005366 | Ga0070659_100532917 | Ga0070659_1005329172 | 154 |
| 463 | 3300005438 | Ga0070701_10286556 | Ga0070701_102865561 | 154 |
| 464 | 3300005441 | Ga0070700_100165208 | Ga0070700_1001652082 | 154 |
| 465 | 3300005456 | Ga0070678_100361797 | Ga0070678_1003617972 | 154 |
| 466 | 3300005539 | Ga0068853_100858830 | Ga0068853_1008588301 | 154 |
| 467 | 3300005543 | Ga0070672_100012411 | Ga0070672_1000124114 | 154 |
| 468 | 3300005544 | Ga0070686_100051206 | Ga0070686_1000512063 | 154 |
| 469 | 3300005549 | Ga0070704_100303822 | Ga0070704_1003038222 | 154 |
| 470 | 3300005564 | Ga0070664_100276777 | Ga0070664_1002767772 | 154 |
| 471 | 3300005614 | Ga0068856_100628402 | Ga0068856_1006284022 | 154 |
| 472 | 3300005615 | Ga0070702_100013586 | Ga0070702_1000135864 | 154 |
| 473 | 3300005616 | Ga0068852_100029092 | Ga0068852_1000290927 | 154 |
| 474 | 3300005844 | Ga0068862_100818555 | Ga0068862_1008185552 | 154 |
| 475 | 3300005937 | Ga0081455_10039738 | Ga0081455_100397385 | 154 |
| 476 | 3300005937 | Ga0081455_10496526 | Ga0081455_104965261 | 154 |
| 477 | 3300009093 | Ga0105240_10545811 | Ga0105240_105458111 | 154 |
| 478 | 3300009176 | Ga0105242_10839581 | Ga0105242_108395812 | 154 |
| 479 | 3300009177 | Ga0105248_10918370 | Ga0105248_109183701 | 154 |
| 480 | 3300009553 | Ga0105249_10117532 | Ga0105249_101175322 | 154 |
| 481 | 3300010375 | Ga0105239_10973640 | Ga0105239_109736401 | 154 |
| 482 | 3300013308 | Ga0157375_10568983 | Ga0157375_105689832 | 154 |
| 483 | 3300014326 | Ga0157380_10240698 | Ga0157380_102406983 | 154 |
| 484 | 3300014326 | Ga0157380_10614612 | Ga0157380_106146121 | 154 |
| 485 | 3300017792 | Ga0163161_10434855 | Ga0163161_104348552 | 154 |
| 486 | 3300025932 | Ga0207690_10250433 | Ga0207690_102504332 | 154 |
| 487 | 3300025933 | Ga0207706_10132711 | Ga0207706_101327111 | 154 |
| 488 | 3300025934 | Ga0207686_10713689 | Ga0207686_107136891 | 154 |
| 489 | 3300025940 | Ga0207691_10177935 | Ga0207691_101779353 | 154 |
| 490 | 3300025941 | Ga0207711_10604761 | Ga0207711_106047612 | 154 |
| 491 | 3300025949 | Ga0207667_10241480 | Ga0207667_102414802 | 154 |
| 492 | 3300025961 | Ga0207712_10052003 | Ga0207712_100520034 | 154 |
| 493 | 3300025986 | Ga0207658_11016494 | Ga0207658_110164942 | 154 |
| 494 | 3300026041 | Ga0207639_10289658 | Ga0207639_102896582 | 154 |
| 495 | 3300026075 | Ga0207708_10038351 | Ga0207708_100383515 | 154 |
| 496 | 3300026078 | Ga0207702_11734473 | Ga0207702_117344731 | 154 |
| 497 | 3300026088 | Ga0207641_10235160 | Ga0207641_102351603 | 154 |
| 498 | 3300026142 | Ga0207698_10032442 | Ga0207698_100324426 | 154 |
| 499 | 3300028381 | Ga0268264_10314635 | Ga0268264_103146352 | 154 |
| 500 | 3300031824 | Ga0307413_10123981 | Ga0307413_101239812 | 154 |
| 501 | 3300031903 | Ga0307407_10254612 | Ga0307407_102546122 | 154 |
| 502 | 3300037466 | Ga0395898_0191857 | Ga0395898_0191857_731_1195 | 154 |
| 503 | 3300037471 | Ga0395905_0065185 | Ga0395905_0065185_256_720 | 154 |
| 504 | 3300039437 | Ga0436365_0114911 | Ga0436365_0114911_54_527 | 154 |
| 505 | 3300044706 | Ga0466964_0730319 | Ga0466964_0730319_11_490 | 154 |
| 506 | 3300045836 | Ga0466958_0364785 | Ga0466958_0364785_63_542 | 154 |
| 507 | 3300046537 | Ga0495598_0090102 | Ga0495598_0090102_292_762 | 154 |
| 508 | 3300046684 | Ga0495669_0033533 | Ga0495669_0033533_346_816 | 154 |
| 509 | 3300046684 | Ga0495669_0265345 | Ga0495669_0265345_67_537 | 154 |
| 510 | 3300046794 | Ga0495589_0064276 | Ga0495589_0064276_873_1343 | 154 |
| 511 | 3300047472 | Ga0495686_0158941 | Ga0495686_0158941_86_556 | 154 |
| 512 | 3300048904 | Ga0496101_1226087 | Ga0496101_1226087_18_488 | 154 |
| 513 | 3300048905 | Ga0496102_0171212 | Ga0496102_0171212_694_1164 | 154 |
| 514 | 3300048917 | Ga0496114_0701495 | Ga0496114_0701495_251_721 | 154 |
| 515 | 3300048928 | Ga0496125_0004420 | Ga0496125_0004420_8575_9042 | 154 |
| 516 | 3300048929 | Ga0496126_1010303 | Ga0496126_1010303_44_511 | 154 |
| 517 | 3300001979 | JGI24740J21852_10010779 | JGI24740J21852_100107794 | 155 |
| 518 | 3300005328 | Ga0070676_10564046 | Ga0070676_105640461 | 155 |
| 519 | 3300005338 | Ga0068868_100322384 | Ga0068868_1003223842 | 155 |
| 520 | 3300005539 | Ga0068853_100000394 | Ga0068853_10000039423 | 155 |
| 521 | 3300005563 | Ga0068855_100045215 | Ga0068855_1000452151 | 155 |
| 522 | 3300005577 | Ga0068857_100003365 | Ga0068857_10000336512 | 155 |
| 523 | 3300005578 | Ga0068854_100009147 | Ga0068854_1000091476 | 155 |
| 524 | 3300005616 | Ga0068852_100087753 | Ga0068852_1000877534 | 155 |
| 525 | 3300005718 | Ga0068866_10030405 | Ga0068866_100304054 | 155 |
| 526 | 3300005834 | Ga0068851_10004148 | Ga0068851_100041488 | 155 |
| 527 | 3300006881 | Ga0068865_100609702 | Ga0068865_1006097021 | 155 |
| 528 | 3300009098 | Ga0105245_11094380 | Ga0105245_110943802 | 155 |
| 529 | 3300013104 | Ga0157370_10418348 | Ga0157370_104183482 | 155 |
| 530 | 3300025321 | Ga0207656_10014569 | Ga0207656_100145691 | 155 |
| 531 | 3300025912 | Ga0207707_10096653 | Ga0207707_100966532 | 155 |
| 532 | 3300025914 | Ga0207671_10219857 | Ga0207671_102198572 | 155 |
| 533 | 3300025921 | Ga0207652_10478754 | Ga0207652_104787542 | 155 |
| 534 | 3300025923 | Ga0207681_10491863 | Ga0207681_104918632 | 155 |
| 535 | 3300025927 | Ga0207687_10178007 | Ga0207687_101780072 | 155 |
| 536 | 3300025937 | Ga0207669_10115146 | Ga0207669_101151462 | 155 |
| 537 | 3300025938 | Ga0207704_10474503 | Ga0207704_104745031 | 155 |
| 538 | 3300025942 | Ga0207689_10379954 | Ga0207689_103799542 | 155 |
| 539 | 3300025949 | Ga0207667_10014888 | Ga0207667_100148887 | 155 |
| 540 | 3300025972 | Ga0207668_10101289 | Ga0207668_101012892 | 155 |
| 541 | 3300026116 | Ga0207674_10006606 | Ga0207674_1000660610 | 155 |
| 542 | 3300026118 | Ga0207675_100805206 | Ga0207675_1008052061 | 155 |
| 543 | 3300026142 | Ga0207698_10096343 | Ga0207698_100963433 | 155 |
| 544 | 3300033442 | Ga0315911_1000035 | Ga0315911_10000353 | 155 |
| 545 | 3300035088 | Ga0373940_0056399 | Ga0373940_0056399_585_1064 | 155 |
| 546 | 3300035241 | Ga0373961_0269299 | Ga0373961_0269299_133_606 | 155 |
| 547 | 3300044706 | Ga0466964_0310995 | Ga0466964_0310995_109_591 | 155 |
| 548 | 3300046500 | Ga0495596_0096906 | Ga0495596_0096906_181_654 | 155 |
| 549 | 3300046507 | Ga0495606_0082466 | Ga0495606_0082466_375_848 | 155 |
| 550 | 3300048924 | Ga0496121_0123287 | Ga0496121_0123287_1125_1607 | 155 |
| 551 | 3300048928 | Ga0496125_0326714 | Ga0496125_0326714_34_516 | 155 |
| 552 | 3300053119 | Ga0500595_034078 | Ga0500595_034078_183_656 | 155 |
| 553 | 3300053148 | Ga0500590_032661 | Ga0500590_032661_182_655 | 155 |
| 554 | 3300035088 | Ga0373940_0216134 | Ga0373940_0216134_43_525 | 156 |
| 555 | 3300035691 | Ga0373931_0264677 | Ga0373931_0264677_169_651 | 156 |
| 556 | 3300039450 | Ga0436363_0891060 | Ga0436363_0891060_437_916 | 156 |
| 557 | 3300044656 | Ga0466969_0042236 | Ga0466969_0042236_1553_2038 | 156 |
| 558 | 3300044684 | Ga0466966_0145950 | Ga0466966_0145950_724_1209 | 156 |
| 559 | 3300045049 | Ga0466959_0062877 | Ga0466959_0062877_603_1088 | 156 |
| 560 | 3300046499 | Ga0495594_0213996 | Ga0495594_0213996_583_1059 | 156 |
| 561 | 3300048929 | Ga0496126_0006400 | Ga0496126_0006400_12439_12912 | 156 |
| 562 | 3300006028 | Ga0070717_10164449 | Ga0070717_101644492 | 157 |
| 563 | 3300009551 | Ga0105238_10411567 | Ga0105238_104115671 | 157 |
| 564 | 3300025915 | Ga0207693_10620638 | Ga0207693_106206382 | 157 |
| 565 | 3300025924 | Ga0207694_11017146 | Ga0207694_110171461 | 157 |
| 566 | 3300036401 | Ga0373937_0280101 | Ga0373937_0280101_313_804 | 157 |
| 567 | 3300046462 | Ga0495651_0028449 | Ga0495651_0028449_1743_2234 | 157 |
| 568 | 3300048088 | Ga0495602_0350062 | Ga0495602_0350062_441_932 | 157 |
| 569 | 3300048911 | Ga0496108_1262121 | Ga0496108_1262121_91_573 | 157 |
| 570 | 3300048925 | Ga0496122_0539976 | Ga0496122_0539976_53_535 | 157 |
| 571 | 3300048926 | Ga0496123_0172118 | Ga0496123_0172118_360_842 | 157 |
| 572 | 3300048927 | Ga0496124_0016867 | Ga0496124_0016867_5625_6107 | 157 |
| 573 | 3300039438 | Ga0436360_1288387 | Ga0436360_1288387_244_765 | 159 |
| 574 | 2010549000 | RicEn_C3613 | RicEn_65090 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar