F465337

General Info

Members Datasets Scaffolds Average Seq Length
574 428 1148 324

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0028587|Ga0496103_0028587_50_1186
Length 378
Sequence MEIPFFMVSRGGLAKRTDVVQRGNDNAVTFQVSRSGGALRIRRSRLALRALSRNNPPMSIPTTHPFAFNPTYGMTLADLRAIVPPEAPPGFDAFWQARYERAIATDPQPVLRKSSLTHPDWQVLDITYTSTGGFEIGGWLLLPQRLPVRRGLVVGHGYGGRDVPDFDLPVEEAAIFFPCARGLSLSARPPIPADASGHVLQGIDNPNTYIIGGCVDDLWLAVSSLLTLYPWLSGHIGYSGVSFGGGIGALAIPFDPRIDRGHLVVPTFGDRELWLTLPTVGSADSVQTYQTTHGSVLGTLRMFDAASAASRIEVPMLAAVALFDPAVAPPCQFAVANALPTSKYNETFILDAGHFDYPGSTEQNAILREKVRDFFKVL

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
107 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
108 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
109 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
182 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
190 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
191 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
192 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
193 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
194 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
195 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
196 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
197 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
198 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
199 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
200 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
201 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
202 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
203 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
204 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
205 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
206 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
207 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
208 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
209 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
210 2519899620 Rhizobium sp. Pop5 Isolate Nodule
211 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
212 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
213 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
214 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
215 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
216 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
217 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
218 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
219 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
220 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
221 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
222 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
223 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
224 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
225 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
226 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
227 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
228 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
229 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
230 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
231 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
232 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
233 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
234 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
235 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
236 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
237 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
238 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
239 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
240 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
241 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
242 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
243 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
244 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
245 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
246 2643221582 Rhizobium sp. Root651 Isolate Unclassified
247 2643221599 Rhizobium sp. Root708 Isolate Unclassified
248 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
249 2643221693 Rhizobium sp. Root491 Isolate Unclassified
250 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
251 2718217927 Rhizobium sp. N324 Isolate Nodule
252 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
253 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
254 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
255 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
256 2718218423 Rhizobium sp. N941 Isolate Nodule
257 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
258 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
259 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
260 2721755809 Rhizobium sp. N541 Isolate Nodule
261 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
262 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
263 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
264 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
265 2738541293 Rhizobium sp. GV031 Isolate Unclassified
266 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
267 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
268 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
269 2791355256 Rhizobium sp. M10 Isolate Nodule
270 2791355260 Rhizobium sp. L9 Isolate Nodule
271 2791355261 Rhizobium sp. J15 Isolate Nodule
272 2791355262 Rhizobium sp. M1 Isolate Nodule
273 2791355263 Rhizobium chutanense C5 Isolate Nodule
274 2791355265 Rhizobium sp. H4 Isolate Nodule
275 2791355266 Rhizobium sp. L43 Isolate Nodule
276 2791355267 Rhizobium sp. L18 Isolate Nodule
277 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
278 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
279 2802429633 Rhizobium anhuiense J3 Isolate Nodule
280 2802429634 Rhizobium anhuiense S10 Isolate Nodule
281 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
282 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
283 2802429637 Rhizobium anhuiense C15 Isolate Nodule
284 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
285 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
286 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
287 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
288 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
289 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
290 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
291 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
292 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
293 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
294 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
295 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
296 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
297 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
298 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
299 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
300 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
301 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
302 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
303 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
304 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
305 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
306 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
307 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
308 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
309 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
310 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
311 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
312 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
313 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
314 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
315 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
316 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
317 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
318 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
319 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
320 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
321 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
322 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
323 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
324 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
325 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
326 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
327 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
328 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
329 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
330 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
331 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
332 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
333 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
334 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
335 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
336 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
337 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
338 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
339 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
340 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
341 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
342 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
343 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
344 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
345 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
346 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
347 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
348 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
349 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
350 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
351 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
352 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
353 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
354 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
355 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
356 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
357 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
358 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
359 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
360 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
361 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
362 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
363 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
364 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
365 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
366 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
367 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
368 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
369 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
370 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
371 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
372 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
373 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
374 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
375 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
376 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
377 2933599457 Rhizobium phaseoli M3 Isolate Nodule
378 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
379 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
380 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
381 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
382 2936381700 Rhizobium chutanense C16 Isolate Unclassified
383 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
384 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
385 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
386 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
387 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
388 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
389 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
390 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
391 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
392 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
393 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
394 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
395 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
396 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
397 8005275841 Rhizobium sp. N4311 Isolate Nodule
398 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
399 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
400 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
401 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
402 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
403 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
404 8005395548 Rhizobium sp. R339 Isolate Nodule
405 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
406 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
407 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
408 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
409 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
410 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
411 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
412 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
413 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
414 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
415 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
416 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
417 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
418 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
419 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
420 8018176218 Rhizobium sp. N122 Isolate Nodule
421 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
422 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
423 8024501048 Rhizobium sp. H4 Isolate Nodule
424 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
425 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
426 8056382006 Rhizobium croatiense 13T Isolate Nodule
427 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
428 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.36
Metatranscriptomes 0
Isolates 41.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0
Endosphere 21.78
Nodule 27.35
Rhizoplane 3.66
Rhizosphere 26.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0028587 3300048906 Bacteria 3384
2 JGI24740J21852_10009986 3300001979 Bacteria 3680
3 JGI25155J39150_1000015 3300002704 Bacteria 178839
4 JGI25156J39149_1000007 3300002705 Bacteria 252108
5 JGI25162J39368_1000119 3300002737 Bacteria 87157
6 JGI25154J39366_1000145 3300002738 Bacteria 55861
7 JGI25157J39369_1000012 3300002741 Bacteria 205167
8 JGI25150J39212_1000063 3300002774 Bacteria 64558
9 JGI25159J45721_1000158 3300002987 Bacteria 31947
10 JGI25159J45721_1009456 3300002987 Bacteria 2570
11 JGI25151J46595_10000140 3300003187 Bacteria 95958
12 JGI25151J46595_10004395 3300003187 Bacteria 7469
13 JGI25151J46595_10012076 3300003187 Bacteria 3938
14 JGI25165J46597_1000211 3300003214 Bacteria 82463
15 JGI25153J46596_10003536 3300003215 Bacteria 8719
16 JGI25153J46596_10011329 3300003215 Bacteria 3949
17 JGI25153J46596_10012584 3300003215 Bacteria 3638
18 JGI25153J46596_10024270 3300003215 Bacteria 2189
19 rootH1_10007048 3300003316 Bacteria 5687
20 rootH1_10109868 3300003316 Bacteria 1409
21 rootH2_10047955 3300003320 Bacteria 10860
22 rootL2_10004132 3300003322 Bacteria 41354
23 rootH1_10206213 3300003323 Bacteria 4297
24 JGI25160J50197_1000026 3300003354 Bacteria 184693
25 JGI25160J50197_1001632 3300003354 Bacteria 11005
26 JGI25161J50226_1000014 3300003374 Bacteria 191109
27 JGI25161J50226_1000190 3300003374 Bacteria 39988
28 Ga0055526_1002283 3300003771 Bacteria 13096
29 Ga0055526_1002411 3300003771 Bacteria 12660
30 Ga0055524_1001464 3300003775 Bacteria 13480
31 Ga0055524_1003315 3300003775 Bacteria 7865
32 Ga0055524_1007853 3300003775 Bacteria 4489
33 Ga0055536_1000808 3300003781 Bacteria 20707
34 Ga0055528_1001675 3300003790 Bacteria 12949
35 Ga0055528_1002267 3300003790 Bacteria 10429
36 Ga0055528_1009275 3300003790 Bacteria 4126
37 Ga0055528_1021085 3300003790 Bacteria 2083
38 Ga0055540_1000988 3300003792 Bacteria 18354
39 Ga0055540_1002505 3300003792 Bacteria 9603
40 Ga0055531_10010550 3300003794 Bacteria 4574
41 Ga0055543_1000079 3300004625 Bacteria 84916
42 Ga0055543_1000115 3300004625 Bacteria 68252
43 Ga0055543_1000329 3300004625 Bacteria 32613
44 Ga0065165_1000073 3300005262 Bacteria 164910
45 Ga0065165_1002408 3300005262 Bacteria 15963
46 Ga0065165_1012719 3300005262 Bacteria 3403
47 Ga0065165_1017630 3300005262 Bacteria 2621
48 Ga0070670_100002696 3300005331 Bacteria 14664
49 Ga0070666_10136490 3300005335 Bacteria 1707
50 Ga0070671_100004488 3300005355 Bacteria 11047
51 Ga0068853_100149950 3300005539 Bacteria 2098
52 Ga0070665_100014665 3300005548 Bacteria 7865
53 Ga0070665_100020401 3300005548 Bacteria 6657
54 Ga0070665_100105578 3300005548 Bacteria 2819
55 Ga0068855_100033786 3300005563 Bacteria 6102
56 Ga0068856_100056248 3300005614 Bacteria 3882
57 Ga0075365_10000600 3300006038 Bacteria 14128
58 Ga0075365_10066655 3300006038 Bacteria 2416
59 Ga0075365_10100425 3300006038 Bacteria 1981
60 Ga0075368_10001513 3300006042 Bacteria 7446
61 Ga0075363_100047842 3300006048 Bacteria 2273
62 Ga0075364_10003970 3300006051 Bacteria 8496
63 Ga0075362_10029412 3300006177 Bacteria 2367
64 Ga0075362_10043103 3300006177 Bacteria 1997
65 Ga0075367_10008024 3300006178 Bacteria 5444
66 Ga0075367_10122779 3300006178 Bacteria 1601
67 Ga0075369_10003349 3300006186 Bacteria 5825
68 Ga0075369_10025166 3300006186 Bacteria 2472
69 Ga0075370_10008391 3300006353 Bacteria 5316
70 Ga0075370_10011474 3300006353 Bacteria 4658
71 Ga0099826_10000149 3300006948 Bacteria 29916
72 Ga0099826_10004007 3300006948 Bacteria 10209
73 Ga0105251_10002518 3300009011 Bacteria 14301
74 Ga0105250_10081071 3300009092 Bacteria 1315
75 Ga0105240_10000217 3300009093 Bacteria 115649
76 Ga0105240_10038252 3300009093 Bacteria 6155
77 Ga0105240_10542679 3300009093 Bacteria 1287
78 Ga0105245_10242231 3300009098 Bacteria 1748
79 Ga0105243_10025899 3300009148 Bacteria 4486
80 Ga0105243_10167033 3300009148 Bacteria 1902
81 Ga0105241_10005766 3300009174 Bacteria 9142
82 Ga0105248_10050115 3300009177 Bacteria 4683
83 Ga0105237_10001458 3300009545 Bacteria 31192
84 Ga0105237_10025230 3300009545 Bacteria 6080
85 Ga0105249_10174029 3300009553 Bacteria 2089
86 Ga0123342_1018576 3300009766 Bacteria 5498
87 Ga0105239_10001164 3300010375 Bacteria 36154
88 Ga0105246_10036031 3300011119 Bacteria 3312
89 Ga0157373_10007095 3300013100 Bacteria 8354
90 Ga0157371_10000004 3300013102 Bacteria 512593
91 Ga0157370_10000768 3300013104 Bacteria 40191
92 Ga0157370_10008228 3300013104 Bacteria 11263
93 Ga0157374_10034180 3300013296 Bacteria 4641
94 Ga0157378_10094579 3300013297 Bacteria 2721
95 Ga0209435_100006 3300025206 Bacteria 542459
96 Ga0209436_100060 3300025208 Bacteria 60450
97 Ga0209437_100042 3300025233 Bacteria 444095
98 Ga0209437_100062 3300025233 Bacteria 336900
99 Ga0209437_105361 3300025233 Bacteria 2187
100 Ga0207425_1000080 3300025245 Bacteria 100578
101 Ga0207425_1002206 3300025245 Bacteria 7076
102 Ga0209646_1000015 3300025246 Bacteria 542459
103 Ga0209026_1000046 3300025250 Bacteria 262031
104 Ga0209677_100295 3300025253 Bacteria 32620
105 Ga0209759_1000005 3300025256 Bacteria 542459
106 Ga0209129_1000195 3300025258 Bacteria 80791
107 Ga0209129_1001740 3300025258 Bacteria 11696
108 Ga0209129_1002157 3300025258 Bacteria 9956
109 Ga0209129_1011866 3300025258 Bacteria 2047
110 Ga0209233_1000082 3300025261 Bacteria 336320
111 Ga0209233_1000103 3300025261 Bacteria 284123
112 Ga0209233_1000288 3300025261 Bacteria 66882
113 Ga0209673_1000325 3300025273 Bacteria 87535
114 Ga0209673_1006836 3300025273 Bacteria 5408
115 Ga0209673_1012570 3300025273 Bacteria 3402
116 Ga0209673_1015006 3300025273 Bacteria 2968
117 Ga0209130_1000015 3300025284 Bacteria 409631
118 Ga0209130_1000219 3300025284 Bacteria 74906
119 Ga0209676_1037104 3300025292 Bacteria 1410
120 Ga0209025_1000060 3300025294 Bacteria 305017
121 Ga0209025_1000332 3300025294 Bacteria 104326
122 Ga0209025_1000483 3300025294 Bacteria 77146
123 Ga0209564_1000703 3300025295 Bacteria 48991
124 Ga0209564_1000984 3300025295 Bacteria 35737
125 Ga0209564_1009055 3300025295 Bacteria 4796
126 Ga0209758_1000148 3300025297 Bacteria 166232
127 Ga0209758_1000263 3300025297 Bacteria 104297
128 Ga0209758_1000544 3300025297 Bacteria 59862
129 Ga0209758_1000576 3300025297 Bacteria 57318
130 Ga0209758_1001861 3300025297 Bacteria 23130
131 Ga0209758_1012600 3300025297 Bacteria 4712
132 Ga0209758_1012869 3300025297 Bacteria 4633
133 Ga0209050_1004762 3300025298 Bacteria 8958
134 Ga0209256_1000245 3300025299 Bacteria 96643
135 Ga0209256_1005344 3300025299 Bacteria 7449
136 Ga0209256_1005801 3300025299 Bacteria 6887
137 Ga0207426_1000039 3300025302 Bacteria 439937
138 Ga0207426_1000075 3300025302 Bacteria 321337
139 Ga0207426_1000122 3300025302 Bacteria 218307
140 Ga0207426_1007526 3300025302 Bacteria 4544
141 Ga0209051_1002064 3300025303 Bacteria 15232
142 Ga0209051_1002404 3300025303 Bacteria 13465
143 Ga0209051_1003118 3300025303 Bacteria 11174
144 Ga0209051_1011202 3300025303 Bacteria 4451
145 Ga0209257_1001330 3300025304 Bacteria 30051
146 Ga0207647_10004941 3300025904 Bacteria 9828
147 Ga0207654_10013521 3300025911 Bacteria 4200
148 Ga0207695_10000613 3300025913 Bacteria 71568
149 Ga0207695_10003120 3300025913 Bacteria 23704
150 Ga0207671_10000337 3300025914 Bacteria 69135
151 Ga0207671_10001160 3300025914 Bacteria 31428
152 Ga0207694_10003347 3300025924 Bacteria 12757
153 Ga0207650_10001919 3300025925 Bacteria 14650
154 Ga0207667_10036580 3300025949 Bacteria 5260
155 Ga0207667_10127742 3300025949 Bacteria 2619
156 Ga0207640_10051174 3300025981 Bacteria 2684
157 Ga0207639_10105431 3300026041 Bacteria 2287
158 Ga0207702_10120552 3300026078 Bacteria 2347
159 Ga0209371_1000009 3300027312 Bacteria 963030
160 Ga0209282_1000380 3300027666 Bacteria 21686
161 Ga0268266_10000769 3300028379 Bacteria 42897
162 Ga0268266_10090385 3300028379 Bacteria 2684
163 Ga0268266_10123595 3300028379 Bacteria 2306
164 Ga0307515_10017559 3300028794 Bacteria 13018
165 Ga0268256_1000010 3300030500 Bacteria 963034
166 Ga0307406_10002153 3300031901 Bacteria 10724
167 Ga0307412_10055646 3300031911 Bacteria 2632
168 Ga0373927_0000075 3300035695 Bacteria 72822
169 Ga0373925_0001050 3300037068 Bacteria 25040
170 Ga0395905_0005571 3300037471 Bacteria 12830
171 Ga0395905_0006484 3300037471 Bacteria 11776
172 Ga0439465_0008800 3300041413 Bacteria 3180
173 Ga0439465_0057006 3300041413 Bacteria 1288
174 Ga0451787_546452 3300041441 Bacteria 1801
175 Ga0451833_0157354 3300041491 Bacteria 6832
176 Ga0451835_1169534 3300041492 Bacteria 2910
177 Ga0451841_0262451 3300041498 Bacteria 2641
178 Ga0451847_0231158 3300041503 Bacteria 6403
179 Ga0451851_0529450 3300041507 Bacteria 1117
180 Ga0451843_1326941 3300041509 Bacteria 1313
181 Ga0451855_0293665 3300041511 Bacteria 4523
182 Ga0451853_0935403 3300041512 Bacteria 1813
183 Ga0439431_0053902 3300041997 Bacteria 1048
184 Ga0439449_0055274 3300042007 Bacteria 1466
185 Ga0439462_0009613 3300042015 Bacteria 2445
186 Ga0466969_0049345 3300044656 Bacteria 2077
187 Ga0466966_0030391 3300044684 Bacteria 3508
188 Ga0453684_0268925 3300044712 Bacteria 1949
189 Ga0466970_0019183 3300044765 Bacteria 3544
190 Ga0466957_0032037 3300044842 Bacteria 3146
191 Ga0466959_0121669 3300045049 Bacteria 1855
192 Ga0451576_0144735 3300045051 Bacteria 2478
193 Ga0495592_0308646 3300046454 Bacteria 1026
194 Ga0495638_0000395 3300046460 Bacteria 53823
195 Ga0495651_0001124 3300046462 Bacteria 20699
196 Ga0495605_0000650 3300046474 Bacteria 26529
197 Ga0495605_0040098 3300046474 Bacteria 2342
198 Ga0495585_0034695 3300046492 Bacteria 2852
199 Ga0495585_0104430 3300046492 Bacteria 1512
200 Ga0495607_0005399 3300046501 Bacteria 9155
201 Ga0495583_0014653 3300046506 Bacteria 4313
202 Ga0495583_0050882 3300046506 Bacteria 1891
203 Ga0495606_0009313 3300046507 Bacteria 8326
204 Ga0495610_0001811 3300046512 Bacteria 18572
205 Ga0495610_0007979 3300046512 Bacteria 6943
206 Ga0495616_0012217 3300046513 Bacteria 4884
207 Ga0495620_0048264 3300046515 Bacteria 1828
208 Ga0495628_0047721 3300046516 Bacteria 3396
209 Ga0495631_0000362 3300046518 Bacteria 31319
210 Ga0495632_0001545 3300046519 Bacteria 19004
211 Ga0495632_0021710 3300046519 Bacteria 3455
212 Ga0495632_0029053 3300046519 Bacteria 2882
213 Ga0495643_0011170 3300046522 Bacteria 5487
214 Ga0495643_0022049 3300046522 Bacteria 3641
215 Ga0495643_0135954 3300046522 Bacteria 1230
216 Ga0495648_0106078 3300046524 Bacteria 1539
217 Ga0495652_0236738 3300046529 Bacteria 1362
218 Ga0495654_0066170 3300046530 Bacteria 1724
219 Ga0495597_0004692 3300046542 Bacteria 7415
220 Ga0495625_0002545 3300046660 Bacteria 19606
221 Ga0495625_0015606 3300046660 Bacteria 6009
222 Ga0495625_0029081 3300046660 Bacteria 4137
223 Ga0495661_0173260 3300046665 Bacteria 1149
224 Ga0495588_0008452 3300046674 Bacteria 4727
225 Ga0495670_0156286 3300046691 Bacteria 1197
226 Ga0495671_0018597 3300046692 Bacteria 3686
227 Ga0495649_0037596 3300046694 Bacteria 2657
228 Ga0495600_0044672 3300046809 Bacteria 2890
229 Ga0495687_068892 3300047443 Bacteria 1427
230 Ga0495681_0014933 3300047470 Bacteria 4425
231 Ga0495686_0001486 3300047472 Bacteria 25489
232 Ga0495686_0023701 3300047472 Bacteria 4043
233 Ga0495686_0044790 3300047472 Bacteria 2800
234 Ga0495686_0089109 3300047472 Bacteria 1875
235 Ga0495686_0125624 3300047472 Bacteria 1525
236 Ga0495686_0180602 3300047472 Bacteria 1223
237 Ga0496100_0001458 3300048903 Bacteria 11600
238 Ga0496101_0019168 3300048904 Bacteria 4666
239 Ga0496102_0003597 3300048905 Bacteria 13128
240 Ga0496102_0041612 3300048905 Bacteria 4161
241 Ga0496103_0002492 3300048906 Bacteria 11548
242 Ga0496104_0195734 3300048907 Bacteria 1933
243 Ga0496104_0201009 3300048907 Bacteria 1905
244 Ga0496106_0002048 3300048909 Bacteria 15151
245 Ga0496106_0195420 3300048909 Bacteria 1609
246 Ga0496109_0447616 3300048912 Bacteria 1220
247 Ga0496110_0097120 3300048913 Bacteria 2640
248 Ga0496111_0000974 3300048914 Bacteria 15651
249 Ga0496111_0040832 3300048914 Bacteria 3328
250 Ga0496116_0002495 3300048919 Bacteria 19279
251 Ga0496116_0004853 3300048919 Bacteria 12683
252 Ga0496116_0022249 3300048919 Bacteria 4756
253 Ga0496116_0042301 3300048919 Bacteria 3116
254 Ga0496116_0194924 3300048919 Bacteria 1067
255 Ga0496117_0000002 3300048920 Bacteria 2483758
256 Ga0496117_0004786 3300048920 Bacteria 14671
257 Ga0496117_0029675 3300048920 Bacteria 4212
258 Ga0496117_0122124 3300048920 Bacteria 1598
259 Ga0496118_0004084 3300048921 Bacteria 17702
260 Ga0496118_0004764 3300048921 Bacteria 15870
261 Ga0496118_0005381 3300048921 Bacteria 14579
262 Ga0496118_0050862 3300048921 Bacteria 3175
263 Ga0496118_0064841 3300048921 Bacteria 2677
264 Ga0496118_0254420 3300048921 Bacteria 996
265 Ga0496119_0004967 3300048922 Bacteria 12997
266 Ga0496119_0016900 3300048922 Bacteria 5521
267 Ga0496119_0024786 3300048922 Bacteria 4209
268 Ga0496119_0045458 3300048922 Bacteria 2752
269 Ga0496120_0000034 3300048923 Bacteria 215228
270 Ga0496120_0004041 3300048923 Bacteria 12700
271 Ga0496120_0095268 3300048923 Bacteria 1583
272 Ga0496121_0006476 3300048924 Bacteria 14512
273 Ga0496121_0008946 3300048924 Bacteria 11621
274 Ga0496121_0012128 3300048924 Bacteria 9461
275 Ga0496121_0022517 3300048924 Bacteria 6110
276 Ga0496121_0143695 3300048924 Bacteria 1766
277 Ga0496122_0000001 3300048925 Bacteria 1827766
278 Ga0496122_0000107 3300048925 Bacteria 193163
279 Ga0496122_0006549 3300048925 Bacteria 13317
280 Ga0496122_0017559 3300048925 Bacteria 6680
281 Ga0496122_0036132 3300048925 Bacteria 4003
282 Ga0496122_0071820 3300048925 Bacteria 2464
283 Ga0496123_0000001 3300048926 Bacteria 1831497
284 Ga0496123_0000063 3300048926 Bacteria 216072
285 Ga0496123_0004822 3300048926 Bacteria 13919
286 Ga0496123_0007564 3300048926 Bacteria 10184
287 Ga0496123_0052465 3300048926 Bacteria 2706
288 Ga0496124_0005510 3300048927 Bacteria 14211
289 Ga0496124_0009023 3300048927 Bacteria 10317
290 Ga0496124_0013288 3300048927 Bacteria 8045
291 Ga0496124_0054242 3300048927 Bacteria 3394
292 Ga0496124_0054340 3300048927 Bacteria 3390
293 Ga0496124_0060158 3300048927 Bacteria 3188
294 Ga0496124_0064873 3300048927 Bacteria 3047
295 Ga0496125_0007481 3300048928 Bacteria 11618
296 Ga0496125_0016911 3300048928 Bacteria 6980
297 Ga0496125_0038705 3300048928 Bacteria 4120
298 Ga0496125_0062158 3300048928 Bacteria 2989
299 Ga0496125_0064277 3300048928 Bacteria 2917
300 Ga0496125_0103954 3300048928 Bacteria 2082
301 Ga0496126_0050423 3300048929 Bacteria 3793
302 Ga0496126_0059488 3300048929 Bacteria 3440
303 Ga0496126_0125338 3300048929 Bacteria 2224
304 Ga0496126_0154275 3300048929 Bacteria 1966
305 Ga0495678_060663 3300049459 Bacteria 1422
306 Ga0501036_0302081 3300049572 Bacteria 1339
307 Ga0501241_011489 3300049758 Bacteria 1607
308 nmdc:mga03683_8336_c1 3300050489 Bacteria 3639
309 nmdc:mga00v17_270_c1 3300050491 Bacteria 30629
310 nmdc:mga00v17_7480_c1 3300050491 Bacteria 5831
311 nmdc:mga0yw44_54021_c1 3300050492 Bacteria 2440
312 nmdc:mga0yw44_5875_c1 3300050492 Bacteria 5863
313 nmdc:mga0k408_31039_c1 3300050493 Bacteria 3049
314 nmdc:mga07m45_2189_c1 3300050496 Bacteria 9119
315 nmdc:mga07m45_52431_c1 3300050496 Bacteria 2303
316 nmdc:mga0sz30_208_c1 3300050516 Bacteria 22004
317 nmdc:mga0sz30_31874_c1 3300050516 Bacteria 2183
318 Ga0500560_005056 3300053107 Bacteria 2876
319 Ga0500569_051921 3300053109 Bacteria 1239
320 Ga0500594_0011957 3300053118 Bacteria 2035
321 Ga0500618_005686 3300053125 Bacteria 3760
322 Ga0500618_007276 3300053125 Bacteria 3175
323 Ga0500658_0000642 3300053134 Bacteria 14510
324 Ga0500658_0004206 3300053134 Bacteria 5403
325 Ga0500559_0016896 3300053136 Bacteria 3082
326 Ga0500561_0000741 3300053137 Bacteria 5174
327 Ga0500568_0000845 3300053139 Bacteria 21549
328 Ga0500568_0001485 3300053139 Bacteria 14998
329 Ga0500568_0054925 3300053139 Bacteria 1556
330 Ga0500616_0000709 3300053153 Bacteria 38615
331 Ga0500616_0001350 3300053153 Bacteria 23981
332 Ga0500616_0003848 3300053153 Bacteria 11090
333 Ga0500622_0000618 3300053156 Bacteria 32174
334 Ga0500627_0050498 3300053158 Bacteria 1812
335 Ga0500633_0000532 3300053160 Bacteria 6153
336 2509446641 2509276033 Bacteria 7180565
337 2510133566 2510065019 Bacteria 6903379
338 2510894947 2510461076 Bacteria 8618824
339 2511135682 2510917022 Bacteria 6504556
340 2511187331 2510917028 Bacteria 6185411
341 2511197876 2510917030 Bacteria 7460662
342 2513573351 2513237084 Bacteria 7231967
343 2513577518 2513237085 Bacteria 7695351
344 2513629833 2513237093 Bacteria 7545552
345 2513708467 2513237103 Bacteria 7647401
346 2513867003 2513237138 Bacteria 7368160
347 2514022071 2513237162 Bacteria 7468464
348 2515112546 2515075009 Bacteria 7288508
349 2515632888 2515154113 Bacteria 7807172
350 2515640032 2515154114 Bacteria 7848616
351 2515655773 2515154116 Bacteria 7552979
352 2515740225 2515154134 Bacteria 7220242
353 2517036272 2516653077 Bacteria 7555578
354 2517076634 2516653085 Bacteria 7346596
355 2517095409 2517093000 Bacteria 7412387
356 2520382121 2519899620 Bacteria 6499161
357 2524459761 2524023209 Bacteria 6679728
358 2530645739 2529292951 Bacteria 6916614
359 2535519376 2534681796 Bacteria 7146037
360 2537873312 2537561587 Bacteria 5425293
361 2554246429 2554235003 Bacteria 5877155
362 2559293651 2558860242 Bacteria 5568029
363 2585225433 2582581298 Bacteria 7315509
364 2585257904 2582581304 Bacteria 5831370
365 2585272757 2582581307 Bacteria 6597605
366 2585281258 2582581308 Bacteria 7413247
367 2585327366 2582581315 Bacteria 7318924
368 2585390746 2582581865 Bacteria 6644329
369 2585402276 2582581867 Bacteria 7184437
370 2585527027 2585427526 Bacteria 7258840
371 2585536081 2585427527 Bacteria 7273426
372 2585537789 2585427528 Bacteria 6842387
373 2585548292 2585427529 Bacteria 7395659
374 2585557392 2585427530 Bacteria 7383882
375 2585562425 2585427531 Bacteria 6992870
376 2585822424 2585427590 Bacteria 6824633
377 2585835739 2585427593 Bacteria 7141551
378 2585845440 2585427594 Bacteria 6180594
379 2585896873 2585427608 Bacteria 6544331
380 2585906408 2585427609 Bacteria 6667127
381 2585997160 2585427633 Bacteria 6413184
382 2586001758 2585427634 Bacteria 6455027
383 2587981830 2585428125 Bacteria 6662905
384 2599332016 2599185156 Bacteria 5403036
385 2599605776 2599185210 Bacteria 5624189
386 2599720118 2599185236 Bacteria 6875203
387 2601609327 2600255279 Bacteria 5605316
388 2601746102 2600255308 Bacteria 5611129
389 2616310940 2615840626 Bacteria 7921970
390 2616551869 2615840698 Bacteria 7319877
391 2617382872 2617270742 Bacteria 6808054
392 2643920814 2643221582 Bacteria 5804683
393 2644006509 2643221599 Bacteria 6292121
394 2644241927 2643221643 Bacteria 5749658
395 2644519382 2643221693 Bacteria 5513853
396 2671116774 2667528174 Bacteria 6435400
397 2719385980 2718217927 Bacteria 6972593
398 2720492219 2718218199 Bacteria 6740745
399 2720620360 2718218233 Bacteria 6662049
400 2720631783 2718218235 Bacteria 6630699
401 2720775511 2718218269 Bacteria 6906114
402 2721399760 2718218423 Bacteria 6438183
403 2723027130 2721755556 Bacteria 6745503
404 2723560742 2721755684 Bacteria 6859907
405 2723567330 2721755685 Bacteria 6704835
406 2724038573 2721755809 Bacteria 6438790
407 2724090118 2721755819 Bacteria 6906405
408 2724104595 2721755822 Bacteria 6726041
409 2725950508 2724679232 Bacteria 7646494
410 2730108066 2728369352 Bacteria 6745171
411 2738800367 2738541293 Bacteria 7065685
412 2739032445 2738541333 Bacteria 7106503
413 2766066889 2765235942 Bacteria 7445910
414 2793280101 2791355253 Bacteria 5171699
415 2793294887 2791355256 Bacteria 6798008
416 2793323001 2791355260 Bacteria 6598818
417 2793331843 2791355261 Bacteria 6661293
418 2793335847 2791355262 Bacteria 6774204
419 2793341725 2791355263 Bacteria 6872478
420 2793352848 2791355265 Bacteria 6539969
421 2793360714 2791355266 Bacteria 7116587
422 2793366945 2791355267 Bacteria 7222458
423 2805925908 2802429605 Bacteria 6875453
424 2805937550 2802429606 Bacteria 6346811
425 2806043421 2802429633 Bacteria 7341974
426 2806050646 2802429634 Bacteria 7083200
427 2806057463 2802429635 Bacteria 7650140
428 2806064844 2802429636 Bacteria 7597525
429 2806072110 2802429637 Bacteria 7067217
430 2808986578 2808606387 Bacteria 5697198
431 2819556649 2818991439 Bacteria 6907412
432 2819607508 2818991448 Bacteria 6772224
433 2819643943 2818991453 Bacteria 7181617
434 2819686428 2818991461 Bacteria 7026071
435 2838018011 2838016132 Bacteria 6577831
436 2838032007 2838029111 Bacteria 6603031
437 2838043643 2838042994 Bacteria 6046894
438 2838074325 2838068647 Bacteria 6208656
439 2838673646 2838668709 Bacteria 6671819
440 2838677383 2838675328 Bacteria 4909118
441 2838681975 2838680041 Bacteria 6545511
442 2838692021 2838686498 Bacteria 7807632
443 2838696546 2838694306 Bacteria 6853137
444 2838706042 2838701080 Bacteria 6669771
445 2838710214 2838707686 Bacteria 6619912
446 2838716271 2838714209 Bacteria 5525906
447 2838719929 2838719591 Bacteria 5523910
448 2838727023 2838724970 Bacteria 4908691
449 2838732833 2838729681 Bacteria 7400765
450 2838745711 2838742623 Bacteria 7396178
451 2841846860 2841846520 Bacteria 5345850
452 2841855831 2841851746 Bacteria 7532261
453 2841860611 2841859092 Bacteria 5436171
454 2841864332 2841864319 Bacteria 6742987
455 2842078388 2842077413 Bacteria 6508645
456 2842114158 2842110456 Bacteria 7656360
457 2842119103 2842118031 Bacteria 7033875
458 2842127111 2842124991 Bacteria 5346824
459 2842132276 2842130223 Bacteria 4909145
460 2842150895 2842146304 Bacteria 5957337
461 2842152555 2842152218 Bacteria 4908957
462 2842157177 2842156927 Bacteria 6894975
463 2842167838 2842163707 Bacteria 6916235
464 2842172516 2842170452 Bacteria 5525737
465 2842176174 2842175837 Bacteria 4908771
466 2842181239 2842180545 Bacteria 6888678
467 2842189378 2842187318 Bacteria 5524014
468 2842201860 2842198810 Bacteria 6608673
469 2842205827 2842205361 Bacteria 6340321
470 2842213692 2842211629 Bacteria 5523832
471 2842217504 2842217011 Bacteria 7497767
472 2842224690 2842224351 Bacteria 5524473
473 2842230710 2842229732 Bacteria 7475766
474 2842239626 2842237096 Bacteria 6620661
475 2842245190 2842243621 Bacteria 7421798
476 2842255856 2842250916 Bacteria 6579627
477 2842259003 2842257432 Bacteria 7401195
478 2842265846 2842264693 Bacteria 6472963
479 2842276327 2842271015 Bacteria 7807131
480 2842279284 2842278818 Bacteria 6340002
481 2842292050 2842291075 Bacteria 7076806
482 2842301636 2842298080 Bacteria 6123127
483 2842304530 2842304105 Bacteria 7023636
484 2842361795 2842357229 Bacteria 6485165
485 2842364781 2842363717 Bacteria 6844742
486 2842372541 2842370503 Bacteria 7038661
487 2842378446 2842377471 Bacteria 7140707
488 2842385613 2842384541 Bacteria 7057858
489 2842398895 2842395702 Bacteria 6780583
490 2842427560 2842422224 Bacteria 6239196
491 2842429517 2842428310 Bacteria 6767288
492 2842436130 2842434925 Bacteria 6502746
493 2842442477 2842441272 Bacteria 6769273
494 2842463938 2842462802 Bacteria 6588055
495 2842470459 2842469257 Bacteria 6752936
496 2842478739 2842475841 Bacteria 6603183
497 2842490239 2842489311 Bacteria 6620893
498 2842495966 2842495871 Bacteria 6820686
499 2842505942 2842502639 Bacteria 6604161
500 2842513464 2842509118 Bacteria 6850950
501 2842517396 2842515876 Bacteria 5436280
502 2842924351 2842922631 Bacteria 5824079
503 2844458924 2844454524 Bacteria 7952546
504 2852395165 2852387548 Bacteria 8025568
505 2854900223 2854896431 Bacteria 5869725
506 2854919175 2854916844 Bacteria 5725939
507 2857519950 2857516855 Bacteria 7787325
508 2899794597 2899792073 Bacteria 4926588
509 2899804147 2899803654 Bacteria 5577784
510 2899845940 2899845264 Bacteria 5672268
511 2919100832 2919100787 Bacteria 7710546
512 2919116475 2919114240 Bacteria 5700270
513 2919173454 2919171160 Bacteria 6499771
514 2919413102 2919408235 Bacteria 6149349
515 2923558729 2923556063 Bacteria 6793593
516 2926754497 2926754445 Bacteria 5964435
517 2926761670 2926760298 Bacteria 5505990
518 2933007201 2933006813 Bacteria 4912075
519 2933015208 2933011516 Bacteria 5439334
520 2933571803 2933570622 Bacteria 7023390
521 2933590254 2933586486 Bacteria 7667493
522 2933594403 2933594066 Bacteria 5594265
523 2933604782 2933599457 Bacteria 5858799
524 2935897598 2935894831 Bacteria 6620579
525 2935905448 2935901341 Bacteria 7341747
526 2936372464 2936367885 Bacteria 7324495
527 2936376546 2936375103 Bacteria 6652732
528 2936388416 2936381700 Bacteria 7006523
529 2979093067 2979089926 Bacteria 5670289
530 2979099545 2979095461 Bacteria 5669583
531 2979105037 2979100975 Bacteria 5423623
532 2984513149 2984509177 Bacteria 5274802
533 2984520484 2984518228 Bacteria 5277463
534 2984539778 2984537506 Bacteria 5277481
535 2984601992 2984601300 Bacteria 5455244
536 3005414626 3005409236 Bacteria 7188837
537 3005421924 3005416602 Bacteria 7064308
538 3005446593 3005445848 Bacteria 6906074
539 3005455626 3005452660 Bacteria 5889319
540 639648786 639633055 Bacteria 7751309
541 650738892 650716007 Bacteria 5573770
542 8003572449 8003570095 Bacteria 5747666
543 8005280763 8005275841 Bacteria 6929066
544 8005285292 8005282627 Bacteria 6675747
545 8005293299 8005289223 Bacteria 6634003
546 8005302774 8005301065 Bacteria 6614431
547 8005312402 8005307578 Bacteria 7395396
548 8005321206 8005314921 Bacteria 7072929
549 8005379459 8005376324 Bacteria 6590079
550 8005396566 8005395548 Bacteria 6806915
551 8005463219 8005460587 Bacteria 7157962
552 8005490053 8005484373 Bacteria 6297373
553 8005500532 8005497431 Bacteria 6477605
554 8005547063 8005542996 Bacteria 7077758
555 8005557456 8005556819 Bacteria 6908598
556 8005568635 8005563573 Bacteria 7153261
557 8005574502 8005570704 Bacteria 6957481
558 8005621910 8005619151 Bacteria 7030230
559 8005627152 8005626139 Bacteria 6534237
560 8005650927 8005645114 Bacteria 6950293
561 8005671950 8005668836 Bacteria 6953162
562 8005688187 8005682033 Bacteria 6726518
563 8005699794 8005695170 Bacteria 6912330
564 8018151348 8018150411 Bacteria 5549903
565 8018166546 8018163183 Bacteria 7277977
566 8018178727 8018176218 Bacteria 6896178
567 8023685147 8023680758 Bacteria 7729763
568 8024483291 8024479707 Bacteria 6954785
569 8024501426 8024501048 Bacteria 6427847
570 8046769087 8046767195 Bacteria 7547379
571 8056376831 8056375014 Bacteria 7006639
572 8056388058 8056382006 Bacteria 6408074
573 8057576448 8057575449 Bacteria 7367519
574 8057874798 8057874678 Bacteria 7494653
575 Ga0496103_0028587
576 JGI24740J21852_10009986
577 JGI25155J39150_1000015
578 JGI25156J39149_1000007
579 JGI25162J39368_1000119
580 JGI25154J39366_1000145
581 JGI25157J39369_1000012
582 JGI25150J39212_1000063
583 JGI25159J45721_1000158
584 JGI25159J45721_1009456
585 JGI25151J46595_10000140
586 JGI25151J46595_10004395
587 JGI25151J46595_10012076
588 JGI25165J46597_1000211
589 JGI25153J46596_10003536
590 JGI25153J46596_10011329
591 JGI25153J46596_10012584
592 JGI25153J46596_10024270
593 rootH1_10007048
594 rootH1_10109868
595 rootH2_10047955
596 rootL2_10004132
597 rootH1_10206213
598 JGI25160J50197_1000026
599 JGI25160J50197_1001632
600 JGI25161J50226_1000014
601 JGI25161J50226_1000190
602 Ga0055526_1002283
603 Ga0055526_1002411
604 Ga0055524_1001464
605 Ga0055524_1003315
606 Ga0055524_1007853
607 Ga0055536_1000808
608 Ga0055528_1001675
609 Ga0055528_1002267
610 Ga0055528_1009275
611 Ga0055528_1021085
612 Ga0055540_1000988
613 Ga0055540_1002505
614 Ga0055531_10010550
615 Ga0055543_1000079
616 Ga0055543_1000115
617 Ga0055543_1000329
618 Ga0065165_1000073
619 Ga0065165_1002408
620 Ga0065165_1012719
621 Ga0065165_1017630
622 Ga0070670_100002696
623 Ga0070666_10136490
624 Ga0070671_100004488
625 Ga0068853_100149950
626 Ga0070665_100014665
627 Ga0070665_100020401
628 Ga0070665_100105578
629 Ga0068855_100033786
630 Ga0068856_100056248
631 Ga0075365_10000600
632 Ga0075365_10066655
633 Ga0075365_10100425
634 Ga0075368_10001513
635 Ga0075363_100047842
636 Ga0075364_10003970
637 Ga0075362_10029412
638 Ga0075362_10043103
639 Ga0075367_10008024
640 Ga0075367_10122779
641 Ga0075369_10003349
642 Ga0075369_10025166
643 Ga0075370_10008391
644 Ga0075370_10011474
645 Ga0099826_10000149
646 Ga0099826_10004007
647 Ga0105251_10002518
648 Ga0105250_10081071
649 Ga0105240_10000217
650 Ga0105240_10038252
651 Ga0105240_10542679
652 Ga0105245_10242231
653 Ga0105243_10025899
654 Ga0105243_10167033
655 Ga0105241_10005766
656 Ga0105248_10050115
657 Ga0105237_10001458
658 Ga0105237_10025230
659 Ga0105249_10174029
660 Ga0123342_1018576
661 Ga0105239_10001164
662 Ga0105246_10036031
663 Ga0157373_10007095
664 Ga0157371_10000004
665 Ga0157370_10000768
666 Ga0157370_10008228
667 Ga0157374_10034180
668 Ga0157378_10094579
669 Ga0209435_100006
670 Ga0209436_100060
671 Ga0209437_100042
672 Ga0209437_100062
673 Ga0209437_105361
674 Ga0207425_1000080
675 Ga0207425_1002206
676 Ga0209646_1000015
677 Ga0209026_1000046
678 Ga0209677_100295
679 Ga0209759_1000005
680 Ga0209129_1000195
681 Ga0209129_1001740
682 Ga0209129_1002157
683 Ga0209129_1011866
684 Ga0209233_1000082
685 Ga0209233_1000103
686 Ga0209233_1000288
687 Ga0209673_1000325
688 Ga0209673_1006836
689 Ga0209673_1012570
690 Ga0209673_1015006
691 Ga0209130_1000015
692 Ga0209130_1000219
693 Ga0209676_1037104
694 Ga0209025_1000060
695 Ga0209025_1000332
696 Ga0209025_1000483
697 Ga0209564_1000703
698 Ga0209564_1000984
699 Ga0209564_1009055
700 Ga0209758_1000148
701 Ga0209758_1000263
702 Ga0209758_1000544
703 Ga0209758_1000576
704 Ga0209758_1001861
705 Ga0209758_1012600
706 Ga0209758_1012869
707 Ga0209050_1004762
708 Ga0209256_1000245
709 Ga0209256_1005344
710 Ga0209256_1005801
711 Ga0207426_1000039
712 Ga0207426_1000075
713 Ga0207426_1000122
714 Ga0207426_1007526
715 Ga0209051_1002064
716 Ga0209051_1002404
717 Ga0209051_1003118
718 Ga0209051_1011202
719 Ga0209257_1001330
720 Ga0207647_10004941
721 Ga0207654_10013521
722 Ga0207695_10000613
723 Ga0207695_10003120
724 Ga0207671_10000337
725 Ga0207671_10001160
726 Ga0207694_10003347
727 Ga0207650_10001919
728 Ga0207667_10036580
729 Ga0207667_10127742
730 Ga0207640_10051174
731 Ga0207639_10105431
732 Ga0207702_10120552
733 Ga0209371_1000009
734 Ga0209282_1000380
735 Ga0268266_10000769
736 Ga0268266_10090385
737 Ga0268266_10123595
738 Ga0307515_10017559
739 Ga0268256_1000010
740 Ga0307406_10002153
741 Ga0307412_10055646
742 Ga0373927_0000075
743 Ga0373925_0001050
744 Ga0395905_0005571
745 Ga0395905_0006484
746 Ga0439465_0008800
747 Ga0439465_0057006
748 Ga0451787_546452
749 Ga0451833_0157354
750 Ga0451835_1169534
751 Ga0451841_0262451
752 Ga0451847_0231158
753 Ga0451851_0529450
754 Ga0451843_1326941
755 Ga0451855_0293665
756 Ga0451853_0935403
757 Ga0439431_0053902
758 Ga0439449_0055274
759 Ga0439462_0009613
760 Ga0466969_0049345
761 Ga0466966_0030391
762 Ga0453684_0268925
763 Ga0466970_0019183
764 Ga0466957_0032037
765 Ga0466959_0121669
766 Ga0451576_0144735
767 Ga0495592_0308646
768 Ga0495638_0000395
769 Ga0495651_0001124
770 Ga0495605_0000650
771 Ga0495605_0040098
772 Ga0495585_0034695
773 Ga0495585_0104430
774 Ga0495607_0005399
775 Ga0495583_0014653
776 Ga0495583_0050882
777 Ga0495606_0009313
778 Ga0495610_0001811
779 Ga0495610_0007979
780 Ga0495616_0012217
781 Ga0495620_0048264
782 Ga0495628_0047721
783 Ga0495631_0000362
784 Ga0495632_0001545
785 Ga0495632_0021710
786 Ga0495632_0029053
787 Ga0495643_0011170
788 Ga0495643_0022049
789 Ga0495643_0135954
790 Ga0495648_0106078
791 Ga0495652_0236738
792 Ga0495654_0066170
793 Ga0495597_0004692
794 Ga0495625_0002545
795 Ga0495625_0015606
796 Ga0495625_0029081
797 Ga0495661_0173260
798 Ga0495588_0008452
799 Ga0495670_0156286
800 Ga0495671_0018597
801 Ga0495649_0037596
802 Ga0495600_0044672
803 Ga0495687_068892
804 Ga0495681_0014933
805 Ga0495686_0001486
806 Ga0495686_0023701
807 Ga0495686_0044790
808 Ga0495686_0089109
809 Ga0495686_0125624
810 Ga0495686_0180602
811 Ga0496100_0001458
812 Ga0496101_0019168
813 Ga0496102_0003597
814 Ga0496102_0041612
815 Ga0496103_0002492
816 Ga0496104_0195734
817 Ga0496104_0201009
818 Ga0496106_0002048
819 Ga0496106_0195420
820 Ga0496109_0447616
821 Ga0496110_0097120
822 Ga0496111_0000974
823 Ga0496111_0040832
824 Ga0496116_0002495
825 Ga0496116_0004853
826 Ga0496116_0022249
827 Ga0496116_0042301
828 Ga0496116_0194924
829 Ga0496117_0000002
830 Ga0496117_0004786
831 Ga0496117_0029675
832 Ga0496117_0122124
833 Ga0496118_0004084
834 Ga0496118_0004764
835 Ga0496118_0005381
836 Ga0496118_0050862
837 Ga0496118_0064841
838 Ga0496118_0254420
839 Ga0496119_0004967
840 Ga0496119_0016900
841 Ga0496119_0024786
842 Ga0496119_0045458
843 Ga0496120_0000034
844 Ga0496120_0004041
845 Ga0496120_0095268
846 Ga0496121_0006476
847 Ga0496121_0008946
848 Ga0496121_0012128
849 Ga0496121_0022517
850 Ga0496121_0143695
851 Ga0496122_0000001
852 Ga0496122_0000107
853 Ga0496122_0006549
854 Ga0496122_0017559
855 Ga0496122_0036132
856 Ga0496122_0071820
857 Ga0496123_0000001
858 Ga0496123_0000063
859 Ga0496123_0004822
860 Ga0496123_0007564
861 Ga0496123_0052465
862 Ga0496124_0005510
863 Ga0496124_0009023
864 Ga0496124_0013288
865 Ga0496124_0054242
866 Ga0496124_0054340
867 Ga0496124_0060158
868 Ga0496124_0064873
869 Ga0496125_0007481
870 Ga0496125_0016911
871 Ga0496125_0038705
872 Ga0496125_0062158
873 Ga0496125_0064277
874 Ga0496125_0103954
875 Ga0496126_0050423
876 Ga0496126_0059488
877 Ga0496126_0125338
878 Ga0496126_0154275
879 Ga0495678_060663
880 Ga0501036_0302081
881 Ga0501241_011489
882 nmdc:mga03683_8336_c1
883 nmdc:mga00v17_270_c1
884 nmdc:mga00v17_7480_c1
885 nmdc:mga0yw44_54021_c1
886 nmdc:mga0yw44_5875_c1
887 nmdc:mga0k408_31039_c1
888 nmdc:mga07m45_2189_c1
889 nmdc:mga07m45_52431_c1
890 nmdc:mga0sz30_208_c1
891 nmdc:mga0sz30_31874_c1
892 Ga0500560_005056
893 Ga0500569_051921
894 Ga0500594_0011957
895 Ga0500618_005686
896 Ga0500618_007276
897 Ga0500658_0000642
898 Ga0500658_0004206
899 Ga0500559_0016896
900 Ga0500561_0000741
901 Ga0500568_0000845
902 Ga0500568_0001485
903 Ga0500568_0054925
904 Ga0500616_0000709
905 Ga0500616_0001350
906 Ga0500616_0003848
907 Ga0500622_0000618
908 Ga0500627_0050498
909 Ga0500633_0000532
910 2509446641
911 2510133566
912 2510894947
913 2511135682
914 2511187331
915 2511197876
916 2513573351
917 2513577518
918 2513629833
919 2513708467
920 2513867003
921 2514022071
922 2515112546
923 2515632888
924 2515640032
925 2515655773
926 2515740225
927 2517036272
928 2517076634
929 2517095409
930 2520382121
931 2524459761
932 2530645739
933 2535519376
934 2537873312
935 2554246429
936 2559293651
937 2585225433
938 2585257904
939 2585272757
940 2585281258
941 2585327366
942 2585390746
943 2585402276
944 2585527027
945 2585536081
946 2585537789
947 2585548292
948 2585557392
949 2585562425
950 2585822424
951 2585835739
952 2585845440
953 2585896873
954 2585906408
955 2585997160
956 2586001758
957 2587981830
958 2599332016
959 2599605776
960 2599720118
961 2601609327
962 2601746102
963 2616310940
964 2616551869
965 2617382872
966 2643920814
967 2644006509
968 2644241927
969 2644519382
970 2671116774
971 2719385980
972 2720492219
973 2720620360
974 2720631783
975 2720775511
976 2721399760
977 2723027130
978 2723560742
979 2723567330
980 2724038573
981 2724090118
982 2724104595
983 2725950508
984 2730108066
985 2738800367
986 2739032445
987 2766066889
988 2793280101
989 2793294887
990 2793323001
991 2793331843
992 2793335847
993 2793341725
994 2793352848
995 2793360714
996 2793366945
997 2805925908
998 2805937550
999 2806043421
1000 2806050646
1001 2806057463
1002 2806064844
1003 2806072110
1004 2808986578
1005 2819556649
1006 2819607508
1007 2819643943
1008 2819686428
1009 2838018011
1010 2838032007
1011 2838043643
1012 2838074325
1013 2838673646
1014 2838677383
1015 2838681975
1016 2838692021
1017 2838696546
1018 2838706042
1019 2838710214
1020 2838716271
1021 2838719929
1022 2838727023
1023 2838732833
1024 2838745711
1025 2841846860
1026 2841855831
1027 2841860611
1028 2841864332
1029 2842078388
1030 2842114158
1031 2842119103
1032 2842127111
1033 2842132276
1034 2842150895
1035 2842152555
1036 2842157177
1037 2842167838
1038 2842172516
1039 2842176174
1040 2842181239
1041 2842189378
1042 2842201860
1043 2842205827
1044 2842213692
1045 2842217504
1046 2842224690
1047 2842230710
1048 2842239626
1049 2842245190
1050 2842255856
1051 2842259003
1052 2842265846
1053 2842276327
1054 2842279284
1055 2842292050
1056 2842301636
1057 2842304530
1058 2842361795
1059 2842364781
1060 2842372541
1061 2842378446
1062 2842385613
1063 2842398895
1064 2842427560
1065 2842429517
1066 2842436130
1067 2842442477
1068 2842463938
1069 2842470459
1070 2842478739
1071 2842490239
1072 2842495966
1073 2842505942
1074 2842513464
1075 2842517396
1076 2842924351
1077 2844458924
1078 2852395165
1079 2854900223
1080 2854919175
1081 2857519950
1082 2899794597
1083 2899804147
1084 2899845940
1085 2919100832
1086 2919116475
1087 2919173454
1088 2919413102
1089 2923558729
1090 2926754497
1091 2926761670
1092 2933007201
1093 2933015208
1094 2933571803
1095 2933590254
1096 2933594403
1097 2933604782
1098 2935897598
1099 2935905448
1100 2936372464
1101 2936376546
1102 2936388416
1103 2979093067
1104 2979099545
1105 2979105037
1106 2984513149
1107 2984520484
1108 2984539778
1109 2984601992
1110 3005414626
1111 3005421924
1112 3005446593
1113 3005455626
1114 639648786
1115 650738892
1116 8003572449
1117 8005280763
1118 8005285292
1119 8005293299
1120 8005302774
1121 8005312402
1122 8005321206
1123 8005379459
1124 8005396566
1125 8005463219
1126 8005490053
1127 8005500532
1128 8005547063
1129 8005557456
1130 8005568635
1131 8005574502
1132 8005621910
1133 8005627152
1134 8005650927
1135 8005671950
1136 8005688187
1137 8005699794
1138 8018151348
1139 8018166546
1140 8018178727
1141 8023685147
1142 8024483291
1143 8024501426
1144 8046769087
1145 8056376831
1146 8056388058
1147 8057576448
1148 8057874798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05448

AXE1

Acetyl xylan esterase (AXE1)

71

369

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7a-assembly1.cif.gz_A structural genomics, crystal structure of cephalosporin c deacetylase 0.871 31 327
1ods-assembly1.cif.gz_A cephalosporin c deacetylase from bacillus subtilis 0.8674 31 330
1odt-assembly1.cif.gz_C cephalosporin c deacetylase mutated, in complex with acetate 0.8611 31 330
6agq-assembly1.cif.gz_D acetyl xylan esterase from paenibacillus sp. r4 0.861 31 324
2xlb-assembly1.cif.gz_G acetyl xylan esterase from bacillus pumilus without ligands 0.8561 31 324
ID Description Score Start End Superfamily
6agqE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.846 31 324 3.40.50.1820
3fcyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8337 31 325 3.40.50.1820
3m83C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8313 31 329 3.40.50.1820
3fvtF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8264 31 324 3.40.50.1820
6fkxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7998 18 324 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A387G278-F1-model_v4 Acetylxylan esterase 0.9972 16 332 GO:0005976
GO:0052689
AF-A0A1S7TYW7-F1-model_v4 deleted 0.9916 9 332
AF-A0A495VGX0-F1-model_v4 Cephalosporin-C deacetylase 0.9889 65 329 GO:0005976
GO:0052689
AF-A0A387G278-F1-model_v4 Acetylxylan esterase 0.9879 16 332 GO:0005976
GO:0052689
AF-A0A7C6W0B0-F1-model_v4 Acetylxylan esterase 0.9816 18 332 GO:0005976
GO:0052689

Map