F465397

General Info

Members Datasets Scaffolds Average Seq Length
575 304 1150 257

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10325931|Ga0157369_103259312
Length 299
Sequence MGAVTAPCYDAGDEFRPAKTSLFCAQNAAQPNLEATMPTRNHAPIGAPCWVELATSDADRARAFYTELFGWSAEEPVADFANYFNFRQNDVRVAGAWPFEPGGAGQADTWAIYLASDDAAKTVELATAHGGQVVAEAMSVADLGTMAVLIDPTGAGIGVWQPARHTGFGLIGEHGTPTWFELLTRDYTAAVDFYRDVFRWHTEEMGNTAEFRYTVQTDGDDRLAGIMDATAFLPAEAPAHWSVYFWVNDTDDAVATAQRLGGSVVYPAEDTPYGRLATVADPMGAQFKLMAANDQMPAR

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
204 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
205 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
290 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
291 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
292 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
293 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
294 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
295 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
296 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
297 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
298 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
299 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
300 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
301 2922554459 Rhodococcus sp. 66b Isolate Unclassified
302 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
303 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
304 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 1.57
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 10.96
Rhizosphere 74.61
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10325931 3300013105 Unclassified 1596
2 JGI24745J21846_1014115 3300002073 Bacteria 924
3 JGI24738J21930_10001978 3300002075 Bacteria 5511
4 JGI24744J21845_10004456 3300002077 Bacteria 2894
5 Ga0055540_1000022 3300003792 Bacteria 201257
6 Ga0070658_10006927 3300005327 Bacteria 9153
7 Ga0070676_10003893 3300005328 Bacteria 7833
8 Ga0070683_100003345 3300005329 Bacteria 12977
9 Ga0070683_100082483 3300005329 Bacteria 3011
10 Ga0070683_100207092 3300005329 Bacteria 1863
11 Ga0070690_100173701 3300005330 Bacteria 1485
12 Ga0068869_100021870 3300005334 Bacteria 4401
13 Ga0068869_100040836 3300005334 Bacteria 3319
14 Ga0070666_10038435 3300005335 Bacteria 3185
15 Ga0070680_100095168 3300005336 Bacteria 2469
16 Ga0070680_100142561 3300005336 Bacteria 2009
17 Ga0070680_100235880 3300005336 Bacteria 1545
18 Ga0070682_100001201 3300005337 Bacteria 14749
19 Ga0070682_100004022 3300005337 Bacteria 8171
20 Ga0070682_100022270 3300005337 Bacteria 3751
21 Ga0070682_100094712 3300005337 Unclassified 1960
22 Ga0070682_100330851 3300005337 Bacteria 1129
23 Ga0068868_100001850 3300005338 Bacteria 14534
24 Ga0068868_100016196 3300005338 Bacteria 5531
25 Ga0068868_100282542 3300005338 Bacteria 1405
26 Ga0070660_100002237 3300005339 Bacteria 13323
27 Ga0070689_100013389 3300005340 Bacteria 5933
28 Ga0070689_100605530 3300005340 Bacteria 949
29 Ga0070661_100001567 3300005344 Bacteria 15885
30 Ga0070661_100043867 3300005344 Bacteria 3267
31 Ga0070692_10006330 3300005345 Bacteria 5136
32 Ga0070692_10028101 3300005345 Bacteria 2794
33 Ga0070668_100000260 3300005347 Bacteria 35142
34 Ga0070669_100100220 3300005353 Bacteria 2184
35 Ga0070669_100399849 3300005353 Bacteria 1124
36 Ga0070675_100011594 3300005354 Bacteria 6904
37 Ga0070675_100284816 3300005354 Bacteria 1453
38 Ga0070671_100404637 3300005355 Bacteria 1168
39 Ga0070671_100514674 3300005355 Bacteria 1030
40 Ga0070674_100015264 3300005356 Bacteria 4792
41 Ga0070674_100053095 3300005356 Bacteria 2797
42 Ga0070673_100138546 3300005364 Bacteria 2051
43 Ga0070688_100021257 3300005365 Bacteria 3788
44 Ga0070659_100007076 3300005366 Bacteria 8131
45 Ga0070659_100262650 3300005366 Bacteria 1433
46 Ga0070659_100422548 3300005366 Bacteria 1127
47 Ga0070667_100000443 3300005367 Bacteria 43082
48 Ga0070667_100003272 3300005367 Bacteria 13841
49 Ga0070667_100039509 3300005367 Bacteria 3955
50 Ga0070667_100756972 3300005367 Bacteria 901
51 Ga0070714_100152182 3300005435 Bacteria 2086
52 Ga0070714_100363476 3300005435 Bacteria 1361
53 Ga0070713_100585189 3300005436 Bacteria 1059
54 Ga0070710_10000303 3300005437 Bacteria 23421
55 Ga0070701_10009942 3300005438 Bacteria 4188
56 Ga0070701_10038643 3300005438 Bacteria 2417
57 Ga0070711_100001503 3300005439 Bacteria 12819
58 Ga0070705_100009744 3300005440 Bacteria 4786
59 Ga0070705_100024467 3300005440 Bacteria 3260
60 Ga0070705_100053395 3300005440 Bacteria 2366
61 Ga0070700_100004307 3300005441 Bacteria 7427
62 Ga0070700_100009499 3300005441 Bacteria 5343
63 Ga0070700_100195816 3300005441 Bacteria 1416
64 Ga0070694_100032942 3300005444 Bacteria 3405
65 Ga0070663_100027714 3300005455 Bacteria 3850
66 Ga0070663_100403006 3300005455 Bacteria 1118
67 Ga0070678_100005572 3300005456 Bacteria 7302
68 Ga0070678_100037263 3300005456 Bacteria 3413
69 Ga0070678_100111836 3300005456 Bacteria 2138
70 Ga0070678_100406112 3300005456 Bacteria 1184
71 Ga0070678_100480013 3300005456 Bacteria 1094
72 Ga0070662_100022478 3300005457 Bacteria 4319
73 Ga0070681_10003519 3300005458 Bacteria 14668
74 Ga0070681_10433402 3300005458 Bacteria 1227
75 Ga0068867_100002967 3300005459 Bacteria 11948
76 Ga0068867_100031300 3300005459 Bacteria 3840
77 Ga0068867_100036566 3300005459 Bacteria 3565
78 Ga0070685_10079316 3300005466 Bacteria 1964
79 Ga0070685_10283053 3300005466 Bacteria 1111
80 Ga0070698_100423346 3300005471 Bacteria 1266
81 Ga0070684_100053699 3300005535 Bacteria 3509
82 Ga0068853_100001940 3300005539 Bacteria 15256
83 Ga0068853_100017613 3300005539 Bacteria 5896
84 Ga0068853_100047955 3300005539 Bacteria 3667
85 Ga0070672_100135636 3300005543 Bacteria 2027
86 Ga0070686_100059888 3300005544 Bacteria 2454
87 Ga0070686_100063337 3300005544 Bacteria 2395
88 Ga0070695_100029691 3300005545 Bacteria 3399
89 Ga0070695_100122202 3300005545 Bacteria 1783
90 Ga0070696_100061922 3300005546 Bacteria 2618
91 Ga0070693_100004312 3300005547 Bacteria 6713
92 Ga0070693_100080759 3300005547 Bacteria 1938
93 Ga0070665_100132393 3300005548 Bacteria 2495
94 Ga0070665_100370651 3300005548 Bacteria 1439
95 Ga0070704_100000340 3300005549 Bacteria 21256
96 Ga0070704_100046295 3300005549 Bacteria 3032
97 Ga0068855_100036371 3300005563 Bacteria 5861
98 Ga0070664_100097682 3300005564 Bacteria 2550
99 Ga0070664_100363840 3300005564 Unclassified 1318
100 Ga0068857_100382307 3300005577 Bacteria 1308
101 Ga0068854_100001782 3300005578 Bacteria 13115
102 Ga0068854_100008668 3300005578 Bacteria 6547
103 Ga0068854_100171193 3300005578 Bacteria 1690
104 Ga0068854_100420201 3300005578 Bacteria 1110
105 Ga0068854_100448092 3300005578 Unclassified 1077
106 Ga0068856_100002165 3300005614 Bacteria 20350
107 Ga0068856_100038896 3300005614 Bacteria 4670
108 Ga0070702_100000276 3300005615 Bacteria 17521
109 Ga0070702_100011005 3300005615 Bacteria 4485
110 Ga0070702_100035020 3300005615 Bacteria 2771
111 Ga0070702_100160563 3300005615 Bacteria 1452
112 Ga0068852_100007205 3300005616 Bacteria 8107
113 Ga0068859_100002195 3300005617 Bacteria 19815
114 Ga0068864_100535225 3300005618 Bacteria 1131
115 Ga0068866_10043357 3300005718 Bacteria 2245
116 Ga0068866_10175428 3300005718 Unclassified 1262
117 Ga0068861_100000790 3300005719 Bacteria 19056
118 Ga0068861_100116861 3300005719 Bacteria 2145
119 Ga0068851_10029511 3300005834 Bacteria 2716
120 Ga0068870_10180559 3300005840 Bacteria 1266
121 Ga0068863_100055545 3300005841 Bacteria 3749
122 Ga0068858_100090737 3300005842 Bacteria 2844
123 Ga0068858_100130138 3300005842 Bacteria 2359
124 Ga0068860_100000694 3300005843 Bacteria 38692
125 Ga0068860_100144826 3300005843 Bacteria 2285
126 Ga0068860_100468163 3300005843 Bacteria 1255
127 Ga0068862_100051254 3300005844 Bacteria 3529
128 Ga0081455_10005711 3300005937 Bacteria 13575
129 Ga0081455_10057208 3300005937 Bacteria 3306
130 Ga0081455_10060600 3300005937 Bacteria 3189
131 Ga0081455_10071615 3300005937 Bacteria 2873
132 Ga0081539_10024439 3300005985 Bacteria 3919
133 Ga0075365_10024792 3300006038 Bacteria 3790
134 Ga0075368_10033147 3300006042 Bacteria 2009
135 Ga0075363_100016120 3300006048 Bacteria 3687
136 Ga0075363_100239795 3300006048 Bacteria 1042
137 Ga0075363_100275434 3300006048 Bacteria 972
138 Ga0075364_10001722 3300006051 Bacteria 12049
139 Ga0075364_10002641 3300006051 Bacteria 10062
140 Ga0075364_10005849 3300006051 Bacteria 7183
141 Ga0075364_10011861 3300006051 Bacteria 5307
142 Ga0075364_10012906 3300006051 Bacteria 5127
143 Ga0075364_10041331 3300006051 Bacteria 2993
144 Ga0075432_10006127 3300006058 Bacteria 4089
145 Ga0070715_10005040 3300006163 Bacteria 4379
146 Ga0070716_100000551 3300006173 Bacteria 15665
147 Ga0070712_100004121 3300006175 Bacteria 8934
148 Ga0075362_10023061 3300006177 Bacteria 2629
149 Ga0075362_10057985 3300006177 Bacteria 1746
150 Ga0075362_10262629 3300006177 Bacteria 851
151 Ga0075367_10057643 3300006178 Bacteria 2310
152 Ga0075369_10000746 3300006186 Bacteria 10557
153 Ga0097621_100014529 3300006237 Bacteria 5896
154 Ga0097621_100097410 3300006237 Bacteria 2470
155 Ga0075370_10000407 3300006353 Bacteria 15914
156 Ga0075370_10022616 3300006353 Bacteria 3454
157 Ga0075370_10138584 3300006353 Bacteria 1422
158 Ga0068871_100365016 3300006358 Bacteria 1280
159 Ga0075428_100012405 3300006844 Bacteria 9479
160 Ga0075430_100023423 3300006846 Bacteria 5255
161 Ga0075430_100186426 3300006846 Bacteria 1725
162 Ga0075431_100028346 3300006847 Bacteria 5753
163 Ga0075434_100482316 3300006871 Bacteria 1261
164 Ga0068865_100003268 3300006881 Bacteria 9703
165 Ga0068865_100011368 3300006881 Bacteria 5567
166 Ga0068865_100041658 3300006881 Bacteria 3126
167 Ga0068865_100077013 3300006881 Bacteria 2382
168 Ga0097620_100002195 3300006931 Bacteria 19815
169 Ga0105240_10023696 3300009093 Bacteria 8107
170 Ga0111539_10131871 3300009094 Bacteria 2926
171 Ga0105245_10002064 3300009098 Bacteria 18224
172 Ga0105245_10004378 3300009098 Bacteria 12498
173 Ga0105245_10036594 3300009098 Bacteria 4361
174 Ga0105245_10640642 3300009098 Bacteria 1092
175 Ga0105247_10000541 3300009101 Bacteria 30700
176 Ga0105247_10089022 3300009101 Bacteria 1957
177 Ga0105247_10299553 3300009101 Bacteria 1115
178 Ga0114129_10035682 3300009147 Bacteria 7024
179 Ga0105243_10000560 3300009148 Bacteria 37602
180 Ga0105243_10006491 3300009148 Bacteria 9045
181 Ga0105243_10009669 3300009148 Bacteria 7341
182 Ga0105243_10026375 3300009148 Bacteria 4447
183 Ga0105243_10061798 3300009148 Bacteria 2997
184 Ga0105243_10117784 3300009148 Bacteria 2234
185 Ga0105241_10081552 3300009174 Bacteria 2534
186 Ga0105241_10246142 3300009174 Bacteria 1514
187 Ga0105241_10290346 3300009174 Bacteria 1400
188 Ga0105242_10000572 3300009176 Bacteria 29126
189 Ga0105242_10008599 3300009176 Bacteria 7840
190 Ga0105242_10064604 3300009176 Bacteria 3018
191 Ga0105242_10164564 3300009176 Bacteria 1945
192 Ga0105242_10169056 3300009176 Bacteria 1920
193 Ga0105248_10108657 3300009177 Bacteria 3127
194 Ga0105248_10400329 3300009177 Bacteria 1546
195 Ga0105237_10016374 3300009545 Bacteria 7706
196 Ga0105237_10021850 3300009545 Bacteria 6573
197 Ga0105237_10060013 3300009545 Bacteria 3805
198 Ga0105237_10419759 3300009545 Unclassified 1343
199 Ga0105238_10022558 3300009551 Bacteria 6416
200 Ga0105238_10289403 3300009551 Bacteria 1620
201 Ga0105249_10008808 3300009553 Bacteria 8809
202 Ga0105249_10108473 3300009553 Bacteria 2621
203 Ga0105249_10145329 3300009553 Bacteria 2278
204 Ga0105249_11024881 3300009553 Bacteria 894
205 Ga0105239_10028063 3300010375 Bacteria 6193
206 Ga0105239_10049459 3300010375 Bacteria 4610
207 Ga0105239_10055409 3300010375 Bacteria 4348
208 Ga0105239_10059405 3300010375 Bacteria 4196
209 Ga0105239_10207442 3300010375 Bacteria 2196
210 Ga0105246_10076991 3300011119 Bacteria 2365
211 Ga0105246_10136538 3300011119 Bacteria 1839
212 Ga0157371_10018110 3300013102 Bacteria 5214
213 Ga0157371_10071809 3300013102 Unclassified 2451
214 Ga0157370_10020554 3300013104 Bacteria 6591
215 Ga0157369_10023750 3300013105 Bacteria 6826
216 Ga0157369_10347663 3300013105 Bacteria 1540
217 Ga0157374_10039682 3300013296 Bacteria 4333
218 Ga0157374_10099207 3300013296 Bacteria 2789
219 Ga0157374_10217066 3300013296 Bacteria 1876
220 Ga0157378_10008464 3300013297 Bacteria 8961
221 Ga0157378_10088862 3300013297 Bacteria 2805
222 Ga0157378_10537685 3300013297 Bacteria 1172
223 Ga0163162_10018447 3300013306 Bacteria 6837
224 Ga0163162_10030423 3300013306 Bacteria 5350
225 Ga0163162_10050782 3300013306 Bacteria 4159
226 Ga0163162_10564791 3300013306 Bacteria 1265
227 Ga0157372_10009160 3300013307 Bacteria 10518
228 Ga0157372_10015340 3300013307 Bacteria 8212
229 Ga0157372_10062650 3300013307 Bacteria 4167
230 Ga0157372_10422254 3300013307 Bacteria 1554
231 Ga0157375_10036572 3300013308 Bacteria 4699
232 Ga0157375_10072512 3300013308 Bacteria 3460
233 Ga0157375_10324569 3300013308 Bacteria 1704
234 Ga0163163_10069880 3300014325 Bacteria 3496
235 Ga0163163_10133819 3300014325 Bacteria 2519
236 Ga0157380_10002342 3300014326 Bacteria 12732
237 Ga0157380_10122463 3300014326 Bacteria 2205
238 Ga0157377_10002507 3300014745 Bacteria 8131
239 Ga0157379_10015398 3300014968 Bacteria 6708
240 Ga0157379_10041599 3300014968 Bacteria 4103
241 Ga0157379_10610712 3300014968 Bacteria 1019
242 Ga0157376_10073981 3300014969 Bacteria 2903
243 Ga0157376_10084438 3300014969 Bacteria 2734
244 Ga0157376_10150740 3300014969 Bacteria 2097
245 Ga0163161_10001874 3300017792 Bacteria 15351
246 Ga0163161_10038693 3300017792 Bacteria 3421
247 Ga0163161_10049696 3300017792 Bacteria 3032
248 Ga0163161_10267912 3300017792 Bacteria 1336
249 Ga0163161_10331045 3300017792 Bacteria 1206
250 Ga0197907_10500900 3300020069 Bacteria 2996
251 Ga0197907_11076189 3300020069 Bacteria 920
252 Ga0206356_11120987 3300020070 Bacteria 1414
253 Ga0206356_11345446 3300020070 Bacteria 888
254 Ga0206356_11785785 3300020070 Bacteria 2284
255 Ga0206349_1863168 3300020075 Bacteria 847
256 Ga0206352_11221409 3300020078 Bacteria 832
257 Ga0206354_11478218 3300020081 Bacteria 1192
258 Ga0206353_10308750 3300020082 Bacteria 2052
259 Ga0213876_10012943 3300021384 Bacteria 4435
260 Ga0213875_10000218 3300021388 Bacteria 58140
261 Ga0213875_10017388 3300021388 Bacteria 3473
262 Ga0209051_1000033 3300025303 Bacteria 380540
263 Ga0207692_10003016 3300025898 Bacteria 6527
264 Ga0207642_10023875 3300025899 Bacteria 2450
265 Ga0207642_10174288 3300025899 Bacteria 1166
266 Ga0207710_10012078 3300025900 Bacteria 3630
267 Ga0207710_10116335 3300025900 Bacteria 1273
268 Ga0207688_10000299 3300025901 Bacteria 22710
269 Ga0207688_10061531 3300025901 Bacteria 2116
270 Ga0207680_10030705 3300025903 Bacteria 3035
271 Ga0207699_10083335 3300025906 Bacteria 1989
272 Ga0207645_10005579 3300025907 Bacteria 9103
273 Ga0207643_10047857 3300025908 Bacteria 2421
274 Ga0207705_10061585 3300025909 Bacteria 2710
275 Ga0207705_10652342 3300025909 Bacteria 818
276 Ga0207654_10064310 3300025911 Bacteria 2156
277 Ga0207707_10802107 3300025912 Bacteria 784
278 Ga0207695_10152010 3300025913 Bacteria 2253
279 Ga0207671_10012298 3300025914 Bacteria 6890
280 Ga0207671_10048250 3300025914 Bacteria 3152
281 Ga0207693_10000174 3300025915 Bacteria 58853
282 Ga0207660_10055501 3300025917 Bacteria 2831
283 Ga0207660_10267319 3300025917 Bacteria 1354
284 Ga0207662_10032807 3300025918 Bacteria 3024
285 Ga0207657_10006358 3300025919 Bacteria 12272
286 Ga0207649_10111959 3300025920 Bacteria 1825
287 Ga0207652_10352845 3300025921 Bacteria 1327
288 Ga0207681_10123524 3300025923 Bacteria 1902
289 Ga0207694_10206297 3300025924 Bacteria 1600
290 Ga0207650_10161760 3300025925 Bacteria 1774
291 Ga0207659_10021076 3300025926 Bacteria 4319
292 Ga0207687_10001202 3300025927 Bacteria 17707
293 Ga0207687_10030805 3300025927 Bacteria 3620
294 Ga0207687_10045428 3300025927 Bacteria 3036
295 Ga0207700_10105498 3300025928 Bacteria 2257
296 Ga0207700_10514721 3300025928 Bacteria 1060
297 Ga0207664_10252015 3300025929 Unclassified 1541
298 Ga0207690_10355532 3300025932 Bacteria 1159
299 Ga0207706_10006296 3300025933 Bacteria 11028
300 Ga0207706_10409126 3300025933 Bacteria 1176
301 Ga0207709_10000770 3300025935 Bacteria 25211
302 Ga0207709_10006674 3300025935 Bacteria 6473
303 Ga0207709_10067202 3300025935 Bacteria 2261
304 Ga0207669_10005973 3300025937 Bacteria 5519
305 Ga0207669_10158229 3300025937 Bacteria 1596
306 Ga0207704_10000200 3300025938 Bacteria 30767
307 Ga0207704_10011649 3300025938 Bacteria 4338
308 Ga0207704_10097943 3300025938 Bacteria 1947
309 Ga0207691_10076010 3300025940 Bacteria 3027
310 Ga0207711_10185380 3300025941 Bacteria 1894
311 Ga0207689_10054309 3300025942 Bacteria 3300
312 Ga0207661_10046423 3300025944 Bacteria 3444
313 Ga0207661_10061167 3300025944 Bacteria 3041
314 Ga0207679_10098262 3300025945 Bacteria 2282
315 Ga0207679_10109534 3300025945 Bacteria 2177
316 Ga0207651_10033221 3300025960 Bacteria 3325
317 Ga0207651_10044837 3300025960 Bacteria 2962
318 Ga0207712_10032726 3300025961 Bacteria 3511
319 Ga0207712_10220290 3300025961 Bacteria 1517
320 Ga0207668_10837648 3300025972 Bacteria 816
321 Ga0207640_10014693 3300025981 Bacteria 4512
322 Ga0207640_10020555 3300025981 Bacteria 3921
323 Ga0207640_10138506 3300025981 Bacteria 1770
324 Ga0207658_10020989 3300025986 Bacteria 4528
325 Ga0207658_10184184 3300025986 Bacteria 1730
326 Ga0207677_10019275 3300026023 Bacteria 4117
327 Ga0207677_10435003 3300026023 Bacteria 1121
328 Ga0207677_10469173 3300026023 Bacteria 1082
329 Ga0207703_10003338 3300026035 Bacteria 13477
330 Ga0207703_10252461 3300026035 Bacteria 1590
331 Ga0207703_10330193 3300026035 Bacteria 1399
332 Ga0207639_10020609 3300026041 Bacteria 4722
333 Ga0207639_10038908 3300026041 Bacteria 3541
334 Ga0207639_10128455 3300026041 Bacteria 2094
335 Ga0207639_10286312 3300026041 Bacteria 1451
336 Ga0207678_10064053 3300026067 Bacteria 3159
337 Ga0207678_10132716 3300026067 Bacteria 2125
338 Ga0207708_10000934 3300026075 Bacteria 21911
339 Ga0207708_10066149 3300026075 Bacteria 2764
340 Ga0207708_10079879 3300026075 Bacteria 2513
341 Ga0207702_10001872 3300026078 Bacteria 20635
342 Ga0207702_10106040 3300026078 Bacteria 2490
343 Ga0207702_10604168 3300026078 Bacteria 1076
344 Ga0207641_10029672 3300026088 Bacteria 4524
345 Ga0207641_10666118 3300026088 Bacteria 1023
346 Ga0207648_10000562 3300026089 Bacteria 41578
347 Ga0207648_10197135 3300026089 Bacteria 1785
348 Ga0207676_10073629 3300026095 Bacteria 2750
349 Ga0207674_10829890 3300026116 Bacteria 892
350 Ga0207675_100000185 3300026118 Bacteria 56425
351 Ga0207675_100188455 3300026118 Bacteria 1978
352 Ga0207675_100723256 3300026118 Bacteria 1005
353 Ga0207683_10000357 3300026121 Bacteria 41951
354 Ga0207683_10013181 3300026121 Bacteria 7053
355 Ga0207683_10029235 3300026121 Bacteria 4771
356 Ga0207683_10034421 3300026121 Bacteria 4402
357 Ga0207698_10028747 3300026142 Bacteria 3969
358 Ga0207698_10040062 3300026142 Bacteria 3476
359 Ga0209813_10016019 3300027866 Bacteria 2039
360 Ga0207428_10043915 3300027907 Bacteria 3607
361 Ga0268266_10016779 3300028379 Bacteria 6260
362 Ga0268266_10122965 3300028379 Bacteria 2311
363 Ga0268265_10007009 3300028380 Bacteria 7622
364 Ga0268265_10335401 3300028380 Bacteria 1375
365 Ga0268264_10255636 3300028381 Bacteria 1629
366 Ga0265327_10000119 3300031251 Bacteria 171254
367 Ga0265327_10003407 3300031251 Bacteria 15226
368 Ga0265327_10020829 3300031251 Bacteria 3980
369 Ga0265327_10161389 3300031251 Bacteria 1035
370 Ga0307408_100762715 3300031548 Unclassified 875
371 Ga0307416_100045277 3300032002 Bacteria 3464
372 Ga0307416_101109260 3300032002 Bacteria 896
373 Ga0307415_100196811 3300032126 Bacteria 1595
374 Ga0373950_0047893 3300034818 Bacteria 834
375 Ga0373958_0012498 3300034819 Bacteria 1453
376 Ga0373959_0016976 3300034820 Bacteria 1355
377 Ga0373949_0050267 3300035090 Bacteria 1048
378 Ga0373951_0020286 3300035091 Bacteria 1521
379 Ga0373941_0023290 3300035115 Bacteria 1766
380 Ga0373931_0012154 3300035691 Bacteria 4168
381 Ga0373937_0034288 3300036401 Unclassified 4617
382 Ga0373937_0271838 3300036401 Bacteria 1600
383 Ga0436364_0538624 3300037853 Bacteria 74940
384 Ga0436364_1301844 3300037853 Bacteria 8498
385 Ga0436365_1293907 3300039437 Bacteria 6860
386 Ga0439461_0007045 3300041410 Bacteria 1978
387 Ga0439466_0011724 3300041411 Bacteria 3237
388 Ga0439466_0027320 3300041411 Bacteria 1977
389 Ga0439465_0010502 3300041413 Bacteria 2907
390 Ga0451802_1690304 3300041460 Bacteria 1171
391 Ga0451835_0652942 3300041492 Bacteria 869
392 Ga0439445_0001240 3300042004 Bacteria 5523
393 Ga0439445_0021033 3300042004 Bacteria 1637
394 Ga0466972_0014461 3300044658 Bacteria 3952
395 Ga0466972_0078685 3300044658 Bacteria 1570
396 Ga0466972_0189043 3300044658 Bacteria 965
397 Ga0466965_0010471 3300044683 Bacteria 4327
398 Ga0466965_0033310 3300044683 Bacteria 2517
399 Ga0466965_0075818 3300044683 Bacteria 1696
400 Ga0466966_0006770 3300044684 Bacteria 7587
401 Ga0466961_0025522 3300044693 Bacteria 3800
402 Ga0466971_0009733 3300044719 Bacteria 4195
403 Ga0466968_0091104 3300044735 Bacteria 1351
404 Ga0466970_0025566 3300044765 Bacteria 3092
405 Ga0466960_0000873 3300044901 Bacteria 10665
406 Ga0466959_0039495 3300045049 Bacteria 3487
407 Ga0466959_0055739 3300045049 Bacteria 2885
408 Ga0466958_0001358 3300045836 Bacteria 11558
409 Ga0466967_0032137 3300045976 Bacteria 4428
410 Ga0466967_0066682 3300045976 Bacteria 3208
411 Ga0466967_0084081 3300045976 Bacteria 2879
412 Ga0495603_0028111 3300046455 Bacteria 3392
413 Ga0495582_0101438 3300046473 Bacteria 1612
414 Ga0495605_0052488 3300046474 Bacteria 1981
415 Ga0495596_0049234 3300046500 Bacteria 1652
416 Ga0495606_0073469 3300046507 Bacteria 2146
417 Ga0495644_0054620 3300046523 Bacteria 1500
418 Ga0495654_0039308 3300046530 Bacteria 2362
419 Ga0495665_0124515 3300046531 Bacteria 1350
420 Ga0495668_0000204 3300046616 Bacteria 86683
421 Ga0495588_0027509 3300046674 Bacteria 2842
422 Ga0495669_0044552 3300046684 Bacteria 1977
423 Ga0495624_0239737 3300046690 Bacteria 1098
424 Ga0495581_0021455 3300047315 Bacteria 3744
425 Ga0495672_0019952 3300047320 Bacteria 4405
426 Ga0495672_0213017 3300047320 Bacteria 958
427 Ga0495673_0002322 3300047469 Bacteria 13589
428 Ga0496100_0000103 3300048903 Bacteria 48997
429 Ga0496100_0000851 3300048903 Bacteria 14590
430 Ga0496100_0004104 3300048903 Bacteria 7681
431 Ga0496100_0028070 3300048903 Bacteria 3468
432 Ga0496100_0111908 3300048903 Bacteria 1898
433 Ga0496100_0152893 3300048903 Bacteria 1648
434 Ga0496100_0531862 3300048903 Bacteria 908
435 Ga0496100_0532746 3300048903 Bacteria 907
436 Ga0496101_0000032 3300048904 Bacteria 186783
437 Ga0496101_0000049 3300048904 Bacteria 146432
438 Ga0496101_0006628 3300048904 Bacteria 7462
439 Ga0496101_0022781 3300048904 Bacteria 4316
440 Ga0496101_0093843 3300048904 Bacteria 2235
441 Ga0496102_0000011 3300048905 Bacteria 321716
442 Ga0496102_0014660 3300048905 Bacteria 6813
443 Ga0496102_0059645 3300048905 Bacteria 3489
444 Ga0496102_0278430 3300048905 Bacteria 1577
445 Ga0496103_0000032 3300048906 Bacteria 201453
446 Ga0496103_0000225 3300048906 Bacteria 55167
447 Ga0496103_0000570 3300048906 Bacteria 29250
448 Ga0496103_0107007 3300048906 Bacteria 1774
449 Ga0496104_0373397 3300048907 Bacteria 1339
450 Ga0496104_0388958 3300048907 Bacteria 1307
451 Ga0496105_0047024 3300048908 Bacteria 3561
452 Ga0496105_0615817 3300048908 Bacteria 841
453 Ga0496106_0000351 3300048909 Bacteria 32650
454 Ga0496106_0001136 3300048909 Bacteria 19712
455 Ga0496106_0043232 3300048909 Bacteria 3380
456 Ga0496106_0126522 3300048909 Bacteria 2001
457 Ga0496107_0000393 3300048910 Bacteria 23705
458 Ga0496107_0000415 3300048910 Bacteria 23189
459 Ga0496107_0040489 3300048910 Bacteria 3345
460 Ga0496108_0000571 3300048911 Bacteria 28843
461 Ga0496108_0029135 3300048911 Bacteria 4570
462 Ga0496108_0051507 3300048911 Bacteria 3449
463 Ga0496108_0260519 3300048911 Bacteria 1509
464 Ga0496108_0395621 3300048911 Bacteria 1207
465 Ga0496109_0000030 3300048912 Bacteria 164120
466 Ga0496109_0009394 3300048912 Bacteria 8333
467 Ga0496109_0143573 3300048912 Bacteria 2233
468 Ga0496109_0180159 3300048912 Bacteria 1984
469 Ga0496109_0318054 3300048912 Bacteria 1469
470 Ga0496109_0366197 3300048912 Bacteria 1361
471 Ga0496109_0806423 3300048912 Bacteria 877
472 Ga0496110_0011001 3300048913 Bacteria 7383
473 Ga0496110_0016950 3300048913 Bacteria 6089
474 Ga0496110_0064930 3300048913 Bacteria 3227
475 Ga0496110_0733117 3300048913 Bacteria 891
476 Ga0496111_0006235 3300048914 Bacteria 7729
477 Ga0496111_0020792 3300048914 Bacteria 4575
478 Ga0496111_0294944 3300048914 Bacteria 1202
479 Ga0496112_0081142 3300048915 Bacteria 3207
480 Ga0496112_0505395 3300048915 Bacteria 1144
481 Ga0496113_0018150 3300048916 Bacteria 4897
482 Ga0496113_0028075 3300048916 Bacteria 4043
483 Ga0496113_0243277 3300048916 Bacteria 1436
484 Ga0496114_0002555 3300048917 Bacteria 13898
485 Ga0496114_0022438 3300048917 Bacteria 5146
486 Ga0496114_0032306 3300048917 Bacteria 4306
487 Ga0496114_0124105 3300048917 Bacteria 2224
488 Ga0496114_0323384 3300048917 Unclassified 1363
489 Ga0496115_0016536 3300048918 Bacteria 5620
490 Ga0496116_0000072 3300048919 Bacteria 238158
491 Ga0496116_0004860 3300048919 Bacteria 12676
492 Ga0496117_0000039 3300048920 Bacteria 322143
493 Ga0496117_0017921 3300048920 Bacteria 5895
494 Ga0496117_0140426 3300048920 Bacteria 1448
495 Ga0496118_0000035 3300048921 Bacteria 322143
496 Ga0496118_0009238 3300048921 Bacteria 10008
497 Ga0496119_0001807 3300048922 Bacteria 24866
498 Ga0496119_0002482 3300048922 Bacteria 20186
499 Ga0496119_0097077 3300048922 Bacteria 1661
500 Ga0496120_0000190 3300048923 Bacteria 105211
501 Ga0496120_0034871 3300048923 Bacteria 3011
502 Ga0496121_0000004 3300048924 Bacteria 1139011
503 Ga0496121_0000351 3300048924 Bacteria 95963
504 Ga0496122_0000173 3300048925 Bacteria 153768
505 Ga0496123_0003309 3300048926 Bacteria 18263
506 Ga0496124_0000012 3300048927 Bacteria 512581
507 Ga0496125_0000003 3300048928 Bacteria 1189767
508 Ga0496125_0206677 3300048928 Bacteria 1279
509 Ga0496126_0000001 3300048929 Bacteria 1139011
510 Ga0496126_0002790 3300048929 Bacteria 22991
511 Ga0496126_0004142 3300048929 Bacteria 17532
512 Ga0501032_0001365 3300049569 Bacteria 19363
513 Ga0501034_0017857 3300049571 Bacteria 7276
514 Ga0501034_0133539 3300049571 Bacteria 2464
515 Ga0501036_0023916 3300049572 Bacteria 5150
516 Ga0501037_0003197 3300049573 Bacteria 11878
517 Ga0501038_0001906 3300049574 Bacteria 19293
518 Ga0501038_0016884 3300049574 Bacteria 6607
519 Ga0501039_0000721 3300049575 Bacteria 23840
520 Ga0501039_0107204 3300049575 Bacteria 2182
521 Ga0501043_0002906 3300049579 Bacteria 14306
522 Ga0501043_0194919 3300049579 Bacteria 1574
523 Ga0501043_0531802 3300049579 Bacteria 875
524 Ga0501070_0003828 3300049586 Bacteria 12988
525 Ga0501070_0301154 3300049586 Bacteria 1306
526 Ga0501072_0502089 3300049588 Bacteria 959
527 Ga0501075_0029505 3300049591 Bacteria 4057
528 Ga0501076_0110731 3300049592 Bacteria 2219
529 Ga0501081_0138857 3300049743 Bacteria 1741
530 Ga0501044_0010115 3300049823 Bacteria 10250
531 nmdc:mga03683_33277_c1 3300050489 Bacteria 2078
532 nmdc:mga03683_4251_c1 3300050489 Bacteria 4722
533 nmdc:mga03n38_115857_c1 3300050490 Bacteria 1311
534 nmdc:mga03n38_50159_c1 3300050490 Bacteria 1859
535 nmdc:mga00v17_12589_c1 3300050491 Bacteria 4671
536 nmdc:mga00v17_2925_c1 3300050491 Bacteria 8758
537 nmdc:mga00v17_55382_c1 3300050491 Bacteria 2422
538 nmdc:mga00v17_78557_c1 3300050491 Bacteria 2056
539 nmdc:mga00v17_9318_c1 3300050491 Bacteria 5310
540 nmdc:mga0yw44_70174_c1 3300050492 Bacteria 2172
541 nmdc:mga0yw44_87514_c1 3300050492 Bacteria 1964
542 nmdc:mga06z11_53831_c1 3300050494 Bacteria 2071
543 nmdc:mga06z11_87878_c1 3300050494 Bacteria 1682
544 nmdc:mga04h51_12549_c1 3300050495 Bacteria 2380
545 nmdc:mga07m45_19707_c1 3300050496 Bacteria 3656
546 nmdc:mga07m45_27300_c1 3300050496 Bacteria 3144
547 nmdc:mga07m45_83489_c1 3300050496 Bacteria 1826
548 nmdc:mga05p37_70519_c1 3300050507 Bacteria 4298
549 nmdc:mga06r32_126560_c1 3300050510 Bacteria 2524
550 nmdc:mga08y16_818358_c1 3300050511 Unclassified 923
551 nmdc:mga0sz30_66895_c1 3300050516 Bacteria 1542
552 nmdc:mga0sz30_76174_c1 3300050516 Bacteria 1448
553 nmdc:mga0sz30_951_c1 3300050516 Bacteria 10377
554 Ga0495595_0106341 3300053084 Bacteria 1358
555 Ga0500643_004498 3300053087 Bacteria 6281
556 Ga0500568_0000024 3300053139 Bacteria 170368
557 Ga0501084_0131127 3300054114 Bacteria 2110
558 Ga0466962_0016665 3300061719 Bacteria 3544
559 Ga0530510_0159763 3300061734 Unclassified 1667
560 2566996269 2565956761 Bacteria 6601618
561 2738667202 2738541264 Bacteria 5935393
562 2738890644 2738541308 Bacteria 7020677
563 2739146046 2738541356 Bacteria 5935017
564 2739239134 2738543011 Bacteria 5731169
565 2867348583 2867346516 Bacteria 7608576
566 2870785078 2870782633 Bacteria 9624083
567 2889304088 2889300758 Bacteria 5690814
568 2893685625 2893684298 Bacteria 2897960
569 2902797454 2902792274 Bacteria 7270173
570 2902814727 2902810491 Bacteria 6794147
571 2904540907 2904535858 Bacteria 6308016
572 2922554999 2922554459 Bacteria 6683962
573 2939584915 2939582691 Bacteria 7088898
574 2939745518 2939743619 Bacteria 5762299
575 2964329038 2964326757 Bacteria 3290868
576 Ga0157369_10325931
577 JGI24745J21846_1014115
578 JGI24738J21930_10001978
579 JGI24744J21845_10004456
580 Ga0055540_1000022
581 Ga0070658_10006927
582 Ga0070676_10003893
583 Ga0070683_100003345
584 Ga0070683_100082483
585 Ga0070683_100207092
586 Ga0070690_100173701
587 Ga0068869_100021870
588 Ga0068869_100040836
589 Ga0070666_10038435
590 Ga0070680_100095168
591 Ga0070680_100142561
592 Ga0070680_100235880
593 Ga0070682_100001201
594 Ga0070682_100004022
595 Ga0070682_100022270
596 Ga0070682_100094712
597 Ga0070682_100330851
598 Ga0068868_100001850
599 Ga0068868_100016196
600 Ga0068868_100282542
601 Ga0070660_100002237
602 Ga0070689_100013389
603 Ga0070689_100605530
604 Ga0070661_100001567
605 Ga0070661_100043867
606 Ga0070692_10006330
607 Ga0070692_10028101
608 Ga0070668_100000260
609 Ga0070669_100100220
610 Ga0070669_100399849
611 Ga0070675_100011594
612 Ga0070675_100284816
613 Ga0070671_100404637
614 Ga0070671_100514674
615 Ga0070674_100015264
616 Ga0070674_100053095
617 Ga0070673_100138546
618 Ga0070688_100021257
619 Ga0070659_100007076
620 Ga0070659_100262650
621 Ga0070659_100422548
622 Ga0070667_100000443
623 Ga0070667_100003272
624 Ga0070667_100039509
625 Ga0070667_100756972
626 Ga0070714_100152182
627 Ga0070714_100363476
628 Ga0070713_100585189
629 Ga0070710_10000303
630 Ga0070701_10009942
631 Ga0070701_10038643
632 Ga0070711_100001503
633 Ga0070705_100009744
634 Ga0070705_100024467
635 Ga0070705_100053395
636 Ga0070700_100004307
637 Ga0070700_100009499
638 Ga0070700_100195816
639 Ga0070694_100032942
640 Ga0070663_100027714
641 Ga0070663_100403006
642 Ga0070678_100005572
643 Ga0070678_100037263
644 Ga0070678_100111836
645 Ga0070678_100406112
646 Ga0070678_100480013
647 Ga0070662_100022478
648 Ga0070681_10003519
649 Ga0070681_10433402
650 Ga0068867_100002967
651 Ga0068867_100031300
652 Ga0068867_100036566
653 Ga0070685_10079316
654 Ga0070685_10283053
655 Ga0070698_100423346
656 Ga0070684_100053699
657 Ga0068853_100001940
658 Ga0068853_100017613
659 Ga0068853_100047955
660 Ga0070672_100135636
661 Ga0070686_100059888
662 Ga0070686_100063337
663 Ga0070695_100029691
664 Ga0070695_100122202
665 Ga0070696_100061922
666 Ga0070693_100004312
667 Ga0070693_100080759
668 Ga0070665_100132393
669 Ga0070665_100370651
670 Ga0070704_100000340
671 Ga0070704_100046295
672 Ga0068855_100036371
673 Ga0070664_100097682
674 Ga0070664_100363840
675 Ga0068857_100382307
676 Ga0068854_100001782
677 Ga0068854_100008668
678 Ga0068854_100171193
679 Ga0068854_100420201
680 Ga0068854_100448092
681 Ga0068856_100002165
682 Ga0068856_100038896
683 Ga0070702_100000276
684 Ga0070702_100011005
685 Ga0070702_100035020
686 Ga0070702_100160563
687 Ga0068852_100007205
688 Ga0068859_100002195
689 Ga0068864_100535225
690 Ga0068866_10043357
691 Ga0068866_10175428
692 Ga0068861_100000790
693 Ga0068861_100116861
694 Ga0068851_10029511
695 Ga0068870_10180559
696 Ga0068863_100055545
697 Ga0068858_100090737
698 Ga0068858_100130138
699 Ga0068860_100000694
700 Ga0068860_100144826
701 Ga0068860_100468163
702 Ga0068862_100051254
703 Ga0081455_10005711
704 Ga0081455_10057208
705 Ga0081455_10060600
706 Ga0081455_10071615
707 Ga0081539_10024439
708 Ga0075365_10024792
709 Ga0075368_10033147
710 Ga0075363_100016120
711 Ga0075363_100239795
712 Ga0075363_100275434
713 Ga0075364_10001722
714 Ga0075364_10002641
715 Ga0075364_10005849
716 Ga0075364_10011861
717 Ga0075364_10012906
718 Ga0075364_10041331
719 Ga0075432_10006127
720 Ga0070715_10005040
721 Ga0070716_100000551
722 Ga0070712_100004121
723 Ga0075362_10023061
724 Ga0075362_10057985
725 Ga0075362_10262629
726 Ga0075367_10057643
727 Ga0075369_10000746
728 Ga0097621_100014529
729 Ga0097621_100097410
730 Ga0075370_10000407
731 Ga0075370_10022616
732 Ga0075370_10138584
733 Ga0068871_100365016
734 Ga0075428_100012405
735 Ga0075430_100023423
736 Ga0075430_100186426
737 Ga0075431_100028346
738 Ga0075434_100482316
739 Ga0068865_100003268
740 Ga0068865_100011368
741 Ga0068865_100041658
742 Ga0068865_100077013
743 Ga0097620_100002195
744 Ga0105240_10023696
745 Ga0111539_10131871
746 Ga0105245_10002064
747 Ga0105245_10004378
748 Ga0105245_10036594
749 Ga0105245_10640642
750 Ga0105247_10000541
751 Ga0105247_10089022
752 Ga0105247_10299553
753 Ga0114129_10035682
754 Ga0105243_10000560
755 Ga0105243_10006491
756 Ga0105243_10009669
757 Ga0105243_10026375
758 Ga0105243_10061798
759 Ga0105243_10117784
760 Ga0105241_10081552
761 Ga0105241_10246142
762 Ga0105241_10290346
763 Ga0105242_10000572
764 Ga0105242_10008599
765 Ga0105242_10064604
766 Ga0105242_10164564
767 Ga0105242_10169056
768 Ga0105248_10108657
769 Ga0105248_10400329
770 Ga0105237_10016374
771 Ga0105237_10021850
772 Ga0105237_10060013
773 Ga0105237_10419759
774 Ga0105238_10022558
775 Ga0105238_10289403
776 Ga0105249_10008808
777 Ga0105249_10108473
778 Ga0105249_10145329
779 Ga0105249_11024881
780 Ga0105239_10028063
781 Ga0105239_10049459
782 Ga0105239_10055409
783 Ga0105239_10059405
784 Ga0105239_10207442
785 Ga0105246_10076991
786 Ga0105246_10136538
787 Ga0157371_10018110
788 Ga0157371_10071809
789 Ga0157370_10020554
790 Ga0157369_10023750
791 Ga0157369_10347663
792 Ga0157374_10039682
793 Ga0157374_10099207
794 Ga0157374_10217066
795 Ga0157378_10008464
796 Ga0157378_10088862
797 Ga0157378_10537685
798 Ga0163162_10018447
799 Ga0163162_10030423
800 Ga0163162_10050782
801 Ga0163162_10564791
802 Ga0157372_10009160
803 Ga0157372_10015340
804 Ga0157372_10062650
805 Ga0157372_10422254
806 Ga0157375_10036572
807 Ga0157375_10072512
808 Ga0157375_10324569
809 Ga0163163_10069880
810 Ga0163163_10133819
811 Ga0157380_10002342
812 Ga0157380_10122463
813 Ga0157377_10002507
814 Ga0157379_10015398
815 Ga0157379_10041599
816 Ga0157379_10610712
817 Ga0157376_10073981
818 Ga0157376_10084438
819 Ga0157376_10150740
820 Ga0163161_10001874
821 Ga0163161_10038693
822 Ga0163161_10049696
823 Ga0163161_10267912
824 Ga0163161_10331045
825 Ga0197907_10500900
826 Ga0197907_11076189
827 Ga0206356_11120987
828 Ga0206356_11345446
829 Ga0206356_11785785
830 Ga0206349_1863168
831 Ga0206352_11221409
832 Ga0206354_11478218
833 Ga0206353_10308750
834 Ga0213876_10012943
835 Ga0213875_10000218
836 Ga0213875_10017388
837 Ga0209051_1000033
838 Ga0207692_10003016
839 Ga0207642_10023875
840 Ga0207642_10174288
841 Ga0207710_10012078
842 Ga0207710_10116335
843 Ga0207688_10000299
844 Ga0207688_10061531
845 Ga0207680_10030705
846 Ga0207699_10083335
847 Ga0207645_10005579
848 Ga0207643_10047857
849 Ga0207705_10061585
850 Ga0207705_10652342
851 Ga0207654_10064310
852 Ga0207707_10802107
853 Ga0207695_10152010
854 Ga0207671_10012298
855 Ga0207671_10048250
856 Ga0207693_10000174
857 Ga0207660_10055501
858 Ga0207660_10267319
859 Ga0207662_10032807
860 Ga0207657_10006358
861 Ga0207649_10111959
862 Ga0207652_10352845
863 Ga0207681_10123524
864 Ga0207694_10206297
865 Ga0207650_10161760
866 Ga0207659_10021076
867 Ga0207687_10001202
868 Ga0207687_10030805
869 Ga0207687_10045428
870 Ga0207700_10105498
871 Ga0207700_10514721
872 Ga0207664_10252015
873 Ga0207690_10355532
874 Ga0207706_10006296
875 Ga0207706_10409126
876 Ga0207709_10000770
877 Ga0207709_10006674
878 Ga0207709_10067202
879 Ga0207669_10005973
880 Ga0207669_10158229
881 Ga0207704_10000200
882 Ga0207704_10011649
883 Ga0207704_10097943
884 Ga0207691_10076010
885 Ga0207711_10185380
886 Ga0207689_10054309
887 Ga0207661_10046423
888 Ga0207661_10061167
889 Ga0207679_10098262
890 Ga0207679_10109534
891 Ga0207651_10033221
892 Ga0207651_10044837
893 Ga0207712_10032726
894 Ga0207712_10220290
895 Ga0207668_10837648
896 Ga0207640_10014693
897 Ga0207640_10020555
898 Ga0207640_10138506
899 Ga0207658_10020989
900 Ga0207658_10184184
901 Ga0207677_10019275
902 Ga0207677_10435003
903 Ga0207677_10469173
904 Ga0207703_10003338
905 Ga0207703_10252461
906 Ga0207703_10330193
907 Ga0207639_10020609
908 Ga0207639_10038908
909 Ga0207639_10128455
910 Ga0207639_10286312
911 Ga0207678_10064053
912 Ga0207678_10132716
913 Ga0207708_10000934
914 Ga0207708_10066149
915 Ga0207708_10079879
916 Ga0207702_10001872
917 Ga0207702_10106040
918 Ga0207702_10604168
919 Ga0207641_10029672
920 Ga0207641_10666118
921 Ga0207648_10000562
922 Ga0207648_10197135
923 Ga0207676_10073629
924 Ga0207674_10829890
925 Ga0207675_100000185
926 Ga0207675_100188455
927 Ga0207675_100723256
928 Ga0207683_10000357
929 Ga0207683_10013181
930 Ga0207683_10029235
931 Ga0207683_10034421
932 Ga0207698_10028747
933 Ga0207698_10040062
934 Ga0209813_10016019
935 Ga0207428_10043915
936 Ga0268266_10016779
937 Ga0268266_10122965
938 Ga0268265_10007009
939 Ga0268265_10335401
940 Ga0268264_10255636
941 Ga0265327_10000119
942 Ga0265327_10003407
943 Ga0265327_10020829
944 Ga0265327_10161389
945 Ga0307408_100762715
946 Ga0307416_100045277
947 Ga0307416_101109260
948 Ga0307415_100196811
949 Ga0373950_0047893
950 Ga0373958_0012498
951 Ga0373959_0016976
952 Ga0373949_0050267
953 Ga0373951_0020286
954 Ga0373941_0023290
955 Ga0373931_0012154
956 Ga0373937_0034288
957 Ga0373937_0271838
958 Ga0436364_0538624
959 Ga0436364_1301844
960 Ga0436365_1293907
961 Ga0439461_0007045
962 Ga0439466_0011724
963 Ga0439466_0027320
964 Ga0439465_0010502
965 Ga0451802_1690304
966 Ga0451835_0652942
967 Ga0439445_0001240
968 Ga0439445_0021033
969 Ga0466972_0014461
970 Ga0466972_0078685
971 Ga0466972_0189043
972 Ga0466965_0010471
973 Ga0466965_0033310
974 Ga0466965_0075818
975 Ga0466966_0006770
976 Ga0466961_0025522
977 Ga0466971_0009733
978 Ga0466968_0091104
979 Ga0466970_0025566
980 Ga0466960_0000873
981 Ga0466959_0039495
982 Ga0466959_0055739
983 Ga0466958_0001358
984 Ga0466967_0032137
985 Ga0466967_0066682
986 Ga0466967_0084081
987 Ga0495603_0028111
988 Ga0495582_0101438
989 Ga0495605_0052488
990 Ga0495596_0049234
991 Ga0495606_0073469
992 Ga0495644_0054620
993 Ga0495654_0039308
994 Ga0495665_0124515
995 Ga0495668_0000204
996 Ga0495588_0027509
997 Ga0495669_0044552
998 Ga0495624_0239737
999 Ga0495581_0021455
1000 Ga0495672_0019952
1001 Ga0495672_0213017
1002 Ga0495673_0002322
1003 Ga0496100_0000103
1004 Ga0496100_0000851
1005 Ga0496100_0004104
1006 Ga0496100_0028070
1007 Ga0496100_0111908
1008 Ga0496100_0152893
1009 Ga0496100_0531862
1010 Ga0496100_0532746
1011 Ga0496101_0000032
1012 Ga0496101_0000049
1013 Ga0496101_0006628
1014 Ga0496101_0022781
1015 Ga0496101_0093843
1016 Ga0496102_0000011
1017 Ga0496102_0014660
1018 Ga0496102_0059645
1019 Ga0496102_0278430
1020 Ga0496103_0000032
1021 Ga0496103_0000225
1022 Ga0496103_0000570
1023 Ga0496103_0107007
1024 Ga0496104_0373397
1025 Ga0496104_0388958
1026 Ga0496105_0047024
1027 Ga0496105_0615817
1028 Ga0496106_0000351
1029 Ga0496106_0001136
1030 Ga0496106_0043232
1031 Ga0496106_0126522
1032 Ga0496107_0000393
1033 Ga0496107_0000415
1034 Ga0496107_0040489
1035 Ga0496108_0000571
1036 Ga0496108_0029135
1037 Ga0496108_0051507
1038 Ga0496108_0260519
1039 Ga0496108_0395621
1040 Ga0496109_0000030
1041 Ga0496109_0009394
1042 Ga0496109_0143573
1043 Ga0496109_0180159
1044 Ga0496109_0318054
1045 Ga0496109_0366197
1046 Ga0496109_0806423
1047 Ga0496110_0011001
1048 Ga0496110_0016950
1049 Ga0496110_0064930
1050 Ga0496110_0733117
1051 Ga0496111_0006235
1052 Ga0496111_0020792
1053 Ga0496111_0294944
1054 Ga0496112_0081142
1055 Ga0496112_0505395
1056 Ga0496113_0018150
1057 Ga0496113_0028075
1058 Ga0496113_0243277
1059 Ga0496114_0002555
1060 Ga0496114_0022438
1061 Ga0496114_0032306
1062 Ga0496114_0124105
1063 Ga0496114_0323384
1064 Ga0496115_0016536
1065 Ga0496116_0000072
1066 Ga0496116_0004860
1067 Ga0496117_0000039
1068 Ga0496117_0017921
1069 Ga0496117_0140426
1070 Ga0496118_0000035
1071 Ga0496118_0009238
1072 Ga0496119_0001807
1073 Ga0496119_0002482
1074 Ga0496119_0097077
1075 Ga0496120_0000190
1076 Ga0496120_0034871
1077 Ga0496121_0000004
1078 Ga0496121_0000351
1079 Ga0496122_0000173
1080 Ga0496123_0003309
1081 Ga0496124_0000012
1082 Ga0496125_0000003
1083 Ga0496125_0206677
1084 Ga0496126_0000001
1085 Ga0496126_0002790
1086 Ga0496126_0004142
1087 Ga0501032_0001365
1088 Ga0501034_0017857
1089 Ga0501034_0133539
1090 Ga0501036_0023916
1091 Ga0501037_0003197
1092 Ga0501038_0001906
1093 Ga0501038_0016884
1094 Ga0501039_0000721
1095 Ga0501039_0107204
1096 Ga0501043_0002906
1097 Ga0501043_0194919
1098 Ga0501043_0531802
1099 Ga0501070_0003828
1100 Ga0501070_0301154
1101 Ga0501072_0502089
1102 Ga0501075_0029505
1103 Ga0501076_0110731
1104 Ga0501081_0138857
1105 Ga0501044_0010115
1106 nmdc:mga03683_33277_c1
1107 nmdc:mga03683_4251_c1
1108 nmdc:mga03n38_115857_c1
1109 nmdc:mga03n38_50159_c1
1110 nmdc:mga00v17_12589_c1
1111 nmdc:mga00v17_2925_c1
1112 nmdc:mga00v17_55382_c1
1113 nmdc:mga00v17_78557_c1
1114 nmdc:mga00v17_9318_c1
1115 nmdc:mga0yw44_70174_c1
1116 nmdc:mga0yw44_87514_c1
1117 nmdc:mga06z11_53831_c1
1118 nmdc:mga06z11_87878_c1
1119 nmdc:mga04h51_12549_c1
1120 nmdc:mga07m45_19707_c1
1121 nmdc:mga07m45_27300_c1
1122 nmdc:mga07m45_83489_c1
1123 nmdc:mga05p37_70519_c1
1124 nmdc:mga06r32_126560_c1
1125 nmdc:mga08y16_818358_c1
1126 nmdc:mga0sz30_66895_c1
1127 nmdc:mga0sz30_76174_c1
1128 nmdc:mga0sz30_951_c1
1129 Ga0495595_0106341
1130 Ga0500643_004498
1131 Ga0500568_0000024
1132 Ga0501084_0131127
1133 Ga0466962_0016665
1134 Ga0530510_0159763
1135 2566996269
1136 2738667202
1137 2738890644
1138 2739146046
1139 2739239134
1140 2867348583
1141 2870785078
1142 2889304088
1143 2893685625
1144 2902797454
1145 2902814727
1146 2904540907
1147 2922554999
1148 2939584915
1149 2939745518
1150 2964329038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

176

289

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

49

159

0.88

PF18029

Glyoxalase_6

Glyoxalase-like domain

50

159

0.8

PF18029

Glyoxalase_6

Glyoxalase-like domain

179

290

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9353 1 254
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9028 1 254
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8274 7 124
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8093 7 124
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7724 7 124
ID Description Score Start End Superfamily
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9737 8 126 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9502 8 126 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9499 135 251 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9194 135 254 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.909 1 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A062WU49-F1-model_v4 Lactoylglutathione lyase family protein 0.9786 8 255 GO:0016829
AF-A0A2S9E1L2-F1-model_v4 Glyoxalase 0.9763 1 255
AF-A0A4T0V7M9-F1-model_v4 VOC family protein 0.9745 5 255
AF-A0A1H9NEP8-F1-model_v4 VOC domain-containing protein 0.9736 7 253
AF-A0A2S9E1L2-F1-model_v4 Glyoxalase 0.9725 1 255

Map