F465417

General Info

Members Datasets Scaffolds Average Seq Length
575 404 487 230

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0059557|Ga0373936_0059557_374_1141
Length 255
Sequence LRASNVVPTVDQEGPPMPSKNAYTAVSAAVVVAALAAAFWTLPGRSAERATLVPAPAVDAPAATGDETQTAVLAGGCFWGVQAVFQHVNGVTRVVSGYSGGSKETAQYQVVSSGRTGHAEAVEIKFDPKQISYGRILQIYFSVAHDPTQLNRQGPDDGTQYRSAIFYSDAAQQKVAQAYIAQLDKAGVFKSPVVTQVGQLAAFYPAEAYHQDYATIHPNNPYIVYNDAPKVENLKQLFPDVYRDKPVLVTAAKGS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
9 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
10 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
11 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
12 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
13 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
14 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
15 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
16 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
17 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
18 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
19 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
20 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
21 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
22 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
23 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
24 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
25 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
26 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
27 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
28 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
29 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
30 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
31 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
32 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
33 2838048938 Rhizobium pisi 27/80 Isolate Nodule
34 2838061910 Rhizobium phaseoli L15 Isolate Nodule
35 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
36 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
37 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
38 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
39 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
40 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
41 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
42 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
43 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
44 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
45 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
46 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
47 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
48 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
49 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
50 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
51 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
52 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
53 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
54 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
55 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
56 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
57 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
58 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
59 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
60 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
61 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
62 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
63 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
64 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
65 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
66 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
67 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
68 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
69 2909042592 Labrys sp. LIt4 Isolate Nodule
70 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
71 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
72 2933599457 Rhizobium phaseoli M3 Isolate Nodule
73 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
74 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
75 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
76 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
77 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
78 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
81 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
82 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
83 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
86 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
87 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
88 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
89 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
90 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
91 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
92 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
93 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
94 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
95 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
96 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
97 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
104 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
109 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
131 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
167 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
231 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
263 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
264 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
265 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
266 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
267 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
268 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
269 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
270 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
275 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
366 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
379 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
380 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
391 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
392 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
393 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
394 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
395 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
396 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
397 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
398 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
399 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
400 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
401 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
402 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
403 8024501048 Rhizobium sp. H4 Isolate Nodule
404 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.96
Metatranscriptomes 1.74
Isolates 15.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.96
Nodule 13.91
Rhizoplane 2.61
Rhizosphere 70.78
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
2 MRS1b_contig_1777220 2162886011 Bacteria 821
3 JGI24739J22299_10013673 3300001989 Bacteria 2958
4 JGI24737J22298_10010536 3300001990 Bacteria 3049
5 JGI24735J21928_10018499 3300002067 Bacteria 2147
6 JGI25156J39149_1011524 3300002705 Bacteria 1993
7 JGI25157J39369_1002286 3300002741 Bacteria 5070
8 rootL2_10084468 3300003322 Bacteria 3921
9 Ga0055525_1000242 3300003759 Bacteria 55608
10 Ga0055527_1000063 3300003760 Bacteria 89044
11 Ga0055535_1000406 3300003761 Bacteria 40592
12 Ga0055542_1000146 3300003762 Bacteria 88772
13 Ga0055542_1003953 3300003762 Bacteria 3783
14 Ga0055529_1000597 3300003763 Bacteria 28068
15 Ga0065704_10070205 3300005289 Bacteria 83747
16 Ga0070683_100280050 3300005329 Unclassified 1586
17 Ga0070690_100002154 3300005330 Bacteria 10509
18 Ga0070670_100012748 3300005331 Bacteria 7195
19 Ga0070666_10002154 3300005335 Bacteria 11964
20 Ga0068868_100006389 3300005338 Bacteria 8338
21 Ga0070661_100001122 3300005344 Bacteria 18807
22 Ga0070661_100054868 3300005344 Bacteria 2919
23 Ga0070661_100325400 3300005344 Bacteria 1201
24 Ga0070669_100057936 3300005353 Bacteria 2843
25 Ga0070675_100061708 3300005354 Bacteria 3096
26 Ga0070674_100330084 3300005356 Bacteria 1226
27 Ga0070673_100048139 3300005364 Bacteria 3322
28 Ga0070667_100004657 3300005367 Bacteria 11509
29 Ga0070667_100006083 3300005367 Bacteria 10020
30 Ga0070714_100007079 3300005435 Bacteria 8699
31 Ga0070711_100549780 3300005439 Bacteria 958
32 Ga0070663_100225720 3300005455 Bacteria 1472
33 Ga0070681_10052179 3300005458 Bacteria 4078
34 Ga0070681_10521562 3300005458 Bacteria 1101
35 Ga0070685_10111453 3300005466 Bacteria 1686
36 Ga0070685_10186175 3300005466 Bacteria 1340
37 Ga0070679_100060786 3300005530 Bacteria 3765
38 Ga0070684_100108465 3300005535 Unclassified 2487
39 Ga0070684_100246867 3300005535 Bacteria 1631
40 Ga0068853_100001404 3300005539 Bacteria 17389
41 Ga0068853_100128191 3300005539 Bacteria 2268
42 Ga0070672_100000725 3300005543 Bacteria 19533
43 Ga0070672_100642132 3300005543 Bacteria 927
44 Ga0070686_100118636 3300005544 Unclassified 1813
45 Ga0070696_100166275 3300005546 Bacteria 1628
46 Ga0070693_100303887 3300005547 Unclassified 1076
47 Ga0070665_100315654 3300005548 Bacteria 1567
48 Ga0068855_100001490 3300005563 Bacteria 29300
49 Ga0068855_100029771 3300005563 Bacteria 6528
50 Ga0070664_100000389 3300005564 Bacteria 32754
51 Ga0070664_100353441 3300005564 Unclassified 1337
52 Ga0068857_100025418 3300005577 Bacteria 5214
53 Ga0068857_100063398 3300005577 Bacteria 3285
54 Ga0068854_100020296 3300005578 Bacteria 4493
55 Ga0068856_100000065 3300005614 Bacteria 98683
56 Ga0068856_100044653 3300005614 Bacteria 4362
57 Ga0068852_100005382 3300005616 Bacteria 9151
58 Ga0068859_100574357 3300005617 Unclassified 1221
59 Ga0068864_100011436 3300005618 Bacteria 7331
60 Ga0068851_10001310 3300005834 Bacteria 10842
61 Ga0068863_100010409 3300005841 Bacteria 9040
62 Ga0068858_100057939 3300005842 Bacteria 3580
63 Ga0068858_100229374 3300005842 Bacteria 1760
64 Ga0068860_100099908 3300005843 Bacteria 2768
65 Ga0068862_100059198 3300005844 Bacteria 3289
66 Ga0081455_10094677 3300005937 Bacteria 2412
67 Ga0075363_100004002 3300006048 Bacteria 6374
68 Ga0075363_100013704 3300006048 Bacteria 3942
69 Ga0075364_10015693 3300006051 Bacteria 4701
70 Ga0075362_10004567 3300006177 Bacteria 4989
71 Ga0075367_10007643 3300006178 Bacteria 5552
72 Ga0075369_10011734 3300006186 Bacteria 3451
73 Ga0097621_100000908 3300006237 Bacteria 20694
74 Ga0097621_100475251 3300006237 Bacteria 1129
75 Ga0097621_100887635 3300006237 Bacteria 830
76 Ga0068871_100978791 3300006358 Bacteria 787
77 Ga0075431_100313322 3300006847 Bacteria 1583
78 Ga0075431_100375018 3300006847 Bacteria 1427
79 Ga0075434_100661159 3300006871 Bacteria 1063
80 Ga0097620_100574356 3300006931 Unclassified 1221
81 Ga0099794_10205016 3300007265 Bacteria 1010
82 Ga0105240_10007943 3300009093 Bacteria 15308
83 Ga0105240_10068422 3300009093 Bacteria 4397
84 Ga0105240_10072658 3300009093 Bacteria 4251
85 Ga0105245_10081796 3300009098 Bacteria 2953
86 Ga0105241_10072294 3300009174 Unclassified 2680
87 Ga0105241_10120372 3300009174 Bacteria 2113
88 Ga0105241_10255371 3300009174 Unclassified 1488
89 Ga0105242_10220099 3300009176 Bacteria 1696
90 Ga0105248_10474009 3300009177 Unclassified 1411
91 Ga0105237_10169818 3300009545 Bacteria 2181
92 Ga0105238_10001064 3300009551 Bacteria 27700
93 Ga0105238_10009489 3300009551 Bacteria 9738
94 Ga0105238_10046958 3300009551 Bacteria 4355
95 Ga0105238_11035137 3300009551 Bacteria 842
96 Ga0105249_10835679 3300009553 Bacteria 986
97 Ga0099796_10021181 3300010159 Bacteria 1998
98 Ga0105239_10010423 3300010375 Bacteria 10394
99 Ga0105239_10047705 3300010375 Bacteria 4694
100 Ga0105239_10342656 3300010375 Bacteria 1687
101 Ga0105246_10182725 3300011119 Bacteria 1616
102 Ga0157371_10097588 3300013102 Bacteria 2083
103 Ga0157370_10139839 3300013104 Bacteria 2256
104 Ga0157369_10000264 3300013105 Bacteria 70855
105 Ga0157374_10000496 3300013296 Bacteria 35685
106 Ga0157374_10114159 3300013296 Bacteria 2600
107 Ga0157378_10011036 3300013297 Bacteria 7907
108 Ga0157378_11049154 3300013297 Bacteria 851
109 Ga0163162_10097868 3300013306 Bacteria 3023
110 Ga0163162_10269401 3300013306 Bacteria 1834
111 Ga0157372_10001696 3300013307 Bacteria 23852
112 Ga0157372_10223501 3300013307 Bacteria 2183
113 Ga0157375_10000631 3300013308 Bacteria 31289
114 Ga0157375_10126084 3300013308 Bacteria 2675
115 Ga0163163_10005157 3300014325 Bacteria 11266
116 Ga0163163_10069266 3300014325 Bacteria 3512
117 Ga0157380_10373996 3300014326 Bacteria 1342
118 Ga0157377_10234060 3300014745 Unclassified 1183
119 Ga0157379_10446658 3300014968 Bacteria 1193
120 Ga0157376_10066812 3300014969 Unclassified 3040
121 Ga0157376_10291159 3300014969 Bacteria 1542
122 Ga0183363_1151 3300015690 Bacteria 17315
123 Ga0163161_10116256 3300017792 Bacteria 2005
124 Ga0197907_10371358 3300020069 Bacteria 810
125 Ga0197907_11490845 3300020069 Bacteria 1068
126 Ga0206356_11908769 3300020070 Bacteria 890
127 Ga0206349_1819953 3300020075 Bacteria 1116
128 Ga0206355_1330646 3300020076 Bacteria 1225
129 Ga0206352_10323814 3300020078 Bacteria 771
130 Ga0206350_10769023 3300020080 Bacteria 972
131 Ga0206353_10866523 3300020082 Bacteria 1292
132 Ga0206353_11323159 3300020082 Bacteria 966
133 Ga0213872_10148801 3300021361 Bacteria 1024
134 Ga0213874_10035085 3300021377 Bacteria 1472
135 Ga0224712_10015693 3300022467 Unclassified 2470
136 Ga0209672_100007 3300025228 Bacteria 959482
137 Ga0209672_102534 3300025228 Bacteria 4398
138 Ga0209563_100071 3300025230 Bacteria 232653
139 Ga0209258_100017 3300025242 Bacteria 590785
140 Ga0209258_100758 3300025242 Bacteria 20275
141 Ga0209148_1000044 3300025254 Bacteria 458417
142 Ga0209148_1003930 3300025254 Bacteria 3835
143 Ga0209759_1000166 3300025256 Bacteria 113080
144 Ga0209455_1000010 3300025272 Bacteria 959482
145 Ga0209758_1002527 3300025297 Bacteria 18490
146 Ga0207656_10005726 3300025321 Bacteria 4417
147 Ga0207692_10242719 3300025898 Bacteria 1076
148 Ga0207647_10020459 3300025904 Bacteria 4438
149 Ga0207705_10359277 3300025909 Bacteria 1123
150 Ga0207684_10222483 3300025910 Bacteria 1629
151 Ga0207654_10000806 3300025911 Bacteria 17257
152 Ga0207654_10041276 3300025911 Unclassified 2604
153 Ga0207707_10301952 3300025912 Bacteria 1384
154 Ga0207707_10475934 3300025912 Bacteria 1067
155 Ga0207695_10003805 3300025913 Bacteria 20923
156 Ga0207695_10058711 3300025913 Bacteria 3993
157 Ga0207671_10108228 3300025914 Bacteria 2112
158 Ga0207671_10194907 3300025914 Bacteria 1581
159 Ga0207663_10364322 3300025916 Bacteria 1097
160 Ga0207660_10268303 3300025917 Unclassified 1351
161 Ga0207649_10000284 3300025920 Bacteria 39562
162 Ga0207652_10016468 3300025921 Bacteria 6037
163 Ga0207652_10139955 3300025921 Bacteria 2163
164 Ga0207694_10000273 3300025924 Bacteria 49024
165 Ga0207650_10002280 3300025925 Bacteria 13385
166 Ga0207659_10211222 3300025926 Bacteria 1555
167 Ga0207687_10100122 3300025927 Bacteria 2131
168 Ga0207687_10101557 3300025927 Bacteria 2117
169 Ga0207706_10049972 3300025933 Bacteria 3695
170 Ga0207686_10252160 3300025934 Bacteria 1290
171 Ga0207709_10244619 3300025935 Bacteria 1307
172 Ga0207669_10299773 3300025937 Bacteria 1221
173 Ga0207665_10070163 3300025939 Bacteria 2390
174 Ga0207691_10003915 3300025940 Bacteria 14465
175 Ga0207691_10125097 3300025940 Bacteria 2275
176 Ga0207711_10257141 3300025941 Unclassified 1604
177 Ga0207661_10413688 3300025944 Bacteria 1224
178 Ga0207667_10000413 3300025949 Bacteria 57875
179 Ga0207667_10010297 3300025949 Bacteria 10943
180 Ga0207667_10230187 3300025949 Bacteria 1898
181 Ga0207651_10029706 3300025960 Bacteria 3468
182 Ga0207668_10086882 3300025972 Bacteria 2286
183 Ga0207640_10044828 3300025981 Bacteria 2836
184 Ga0207640_10107714 3300025981 Bacteria 1968
185 Ga0207658_10020977 3300025986 Bacteria 4529
186 Ga0207658_10034454 3300025986 Bacteria 3619
187 Ga0207677_10020674 3300026023 Bacteria 4002
188 Ga0207703_10013371 3300026035 Bacteria 6396
189 Ga0207703_10072398 3300026035 Bacteria 2849
190 Ga0207703_10089031 3300026035 Bacteria 2592
191 Ga0207639_10005178 3300026041 Bacteria 8797
192 Ga0207639_10024836 3300026041 Bacteria 4342
193 Ga0207678_10406388 3300026067 Bacteria 1179
194 Ga0207702_10000003 3300026078 Bacteria 434196
195 Ga0207702_10000209 3300026078 Bacteria 69358
196 Ga0207702_10067303 3300026078 Bacteria 3074
197 Ga0207702_10716038 3300026078 Bacteria 987
198 Ga0207641_10015952 3300026088 Bacteria 6151
199 Ga0207641_10039799 3300026088 Bacteria 3933
200 Ga0207641_10102875 3300026088 Bacteria 2519
201 Ga0207676_10005705 3300026095 Bacteria 8810
202 Ga0207676_10257604 3300026095 Bacteria 1573
203 Ga0207674_10007519 3300026116 Bacteria 12702
204 Ga0207674_10073263 3300026116 Bacteria 3438
205 Ga0207675_100235392 3300026118 Bacteria 1768
206 Ga0207675_100644600 3300026118 Bacteria 1065
207 Ga0207698_10097751 3300026142 Unclassified 2424
208 Ga0207698_10137713 3300026142 Bacteria 2097
209 Ga0209179_1013762 3300027512 Bacteria 1475
210 Ga0268265_10044953 3300028380 Bacteria 3292
211 Ga0268264_10117934 3300028381 Bacteria 2335
212 Ga0268264_10260651 3300028381 Bacteria 1615
213 Ga0265334_10000033 3300028573 Bacteria 106132
214 Ga0265330_10028027 3300031235 Bacteria 2541
215 Ga0265332_10008046 3300031238 Bacteria 4746
216 Ga0265325_10001741 3300031241 Bacteria 15096
217 Ga0265329_10010776 3300031242 Bacteria 3345
218 Ga0265340_10006067 3300031247 Bacteria 6663
219 Ga0265340_10044431 3300031247 Bacteria 2173
220 Ga0265339_10001424 3300031249 Bacteria 17734
221 Ga0265331_10000002 3300031250 Bacteria 511481
222 Ga0265331_10028117 3300031250 Bacteria 2813
223 Ga0265331_10047000 3300031250 Bacteria 2079
224 Ga0265331_10068403 3300031250 Bacteria 1665
225 Ga0265331_10128618 3300031250 Bacteria 1156
226 Ga0265327_10000074 3300031251 Bacteria 214435
227 Ga0265316_10010203 3300031344 Bacteria 8577
228 Ga0265314_10001465 3300031711 Bacteria 26322
229 Ga0265314_10008922 3300031711 Bacteria 8543
230 Ga0265314_10015545 3300031711 Bacteria 6038
231 Ga0265314_10055700 3300031711 Bacteria 2727
232 Ga0265314_10063383 3300031711 Bacteria 2508
233 Ga0265314_10065678 3300031711 Bacteria 2450
234 Ga0265314_10156494 3300031711 Bacteria 1391
235 Ga0265314_10234126 3300031711 Bacteria 1063
236 Ga0265342_10004642 3300031712 Bacteria 10696
237 Ga0265342_10023159 3300031712 Bacteria 3935
238 Ga0307516_10004445 3300031730 Bacteria 17289
239 Ga0373934_0025045 3300035086 Bacteria 2309
240 Ga0373923_0005091 3300035111 Bacteria 4435
241 Ga0373936_0059557 3300035113 Bacteria 1557
242 Ga0373945_0013035 3300035116 Bacteria 2769
243 Ga0373953_0001606 3300035117 Bacteria 6611
244 Ga0373954_0039304 3300035118 Bacteria 2202
245 Ga0373956_0007284 3300035119 Bacteria 4455
246 Ga0373957_0103545 3300035120 Bacteria 1141
247 Ga0373943_0003490 3300035170 Bacteria 7160
248 Ga0373946_0004458 3300035171 Bacteria 5016
249 Ga0373955_0000346 3300035172 Bacteria 19457
250 Ga0373955_0275809 3300035172 Bacteria 1011
251 Ga0373924_0001455 3300035410 Bacteria 7697
252 Ga0373935_0000056 3300035692 Bacteria 46025
253 Ga0373927_0033737 3300035695 Bacteria 3331
254 Ga0373933_0004205 3300035724 Bacteria 7938
255 Ga0373947_0004488 3300035725 Bacteria 8191
256 Ga0373937_0000075 3300036401 Bacteria 89727
257 Ga0373937_0351196 3300036401 Bacteria 1397
258 Ga0373925_0000159 3300037068 Bacteria 72851
259 Ga0395899_0008203 3300037312 Bacteria 8049
260 Ga0395900_0162295 3300037418 Bacteria 2279
261 Ga0395898_0000460 3300037466 Bacteria 81440
262 Ga0436364_0596856 3300037853 Bacteria 1269
263 Ga0237819_00130 3300038705 Bacteria 28324
264 Ga0436360_0064513 3300039438 Bacteria 1763
265 Ga0436361_0709744 3300039447 Bacteria 2515
266 Ga0436363_0268886 3300039450 Bacteria 1233
267 Ga0436363_1116204 3300039450 Bacteria 1422
268 Ga0436363_1546557 3300039450 Bacteria 3434
269 Ga0439461_0006955 3300041410 Bacteria 1987
270 Ga0451833_0552563 3300041491 Bacteria 1206
271 Ga0451835_0259487 3300041492 Bacteria 3322
272 Ga0451837_0291003 3300041494 Bacteria 1120
273 Ga0451839_1037019 3300041496 Bacteria 991
274 Ga0451845_0815701 3300041501 Bacteria 1170
275 Ga0451849_0008212 3300041505 Bacteria 1757
276 Ga0451843_0322861 3300041509 Bacteria 2485
277 Ga0451855_0762862 3300041511 Bacteria 2452
278 Ga0451853_0670545 3300041512 Bacteria 820
279 Ga0466969_0004995 3300044656 Bacteria 7063
280 Ga0466966_0005052 3300044684 Bacteria 8671
281 Ga0466961_0001260 3300044693 Bacteria 15613
282 Ga0466961_0024959 3300044693 Bacteria 3846
283 Ga0466961_0202667 3300044693 Bacteria 1226
284 Ga0466970_0002513 3300044765 Bacteria 8841
285 Ga0466970_0045572 3300044765 Bacteria 2335
286 Ga0466957_0042584 3300044842 Bacteria 2748
287 Ga0466959_0210400 3300045049 Bacteria 1351
288 Ga0451576_0011229 3300045051 Bacteria 10202
289 Ga0466958_0421763 3300045836 Bacteria 862
290 Ga0495592_0000102 3300046454 Bacteria 75767
291 Ga0495629_0146456 3300046459 Bacteria 1642
292 Ga0495651_0001236 3300046462 Bacteria 19760
293 Ga0495653_0000036 3300046463 Bacteria 129776
294 Ga0495580_0325332 3300046472 Bacteria 1045
295 Ga0495662_0006322 3300046476 Bacteria 5923
296 Ga0495662_0094223 3300046476 Bacteria 1462
297 Ga0495664_0000107 3300046477 Bacteria 41420
298 Ga0495607_0053093 3300046501 Bacteria 2344
299 Ga0495606_0010004 3300046507 Bacteria 7931
300 Ga0495608_0000006 3300046511 Bacteria 324334
301 Ga0495608_0080799 3300046511 Bacteria 2113
302 Ga0495610_0020204 3300046512 Bacteria 3703
303 Ga0495618_0000057 3300046514 Bacteria 80298
304 Ga0495618_0191810 3300046514 Bacteria 1295
305 Ga0495620_0027483 3300046515 Bacteria 2661
306 Ga0495628_0000077 3300046516 Bacteria 77338
307 Ga0495630_0001707 3300046517 Bacteria 15337
308 Ga0495643_0010530 3300046522 Bacteria 5686
309 Ga0495648_0074512 3300046524 Bacteria 1955
310 Ga0495652_0000005 3300046529 Bacteria 524368
311 Ga0495640_0000007 3300046533 Bacteria 265481
312 Ga0495586_0034542 3300046535 Bacteria 2716
313 Ga0495587_0000043 3300046536 Bacteria 109717
314 Ga0495597_0018607 3300046542 Bacteria 3258
315 Ga0495645_0000275 3300046543 Bacteria 37777
316 Ga0495667_0000023 3300046559 Bacteria 169343
317 Ga0495667_0000235 3300046559 Bacteria 36357
318 Ga0495634_0000049 3300046642 Bacteria 95428
319 Ga0495634_0166062 3300046642 Bacteria 1389
320 Ga0495635_0000021 3300046663 Bacteria 164643
321 Ga0495657_0000063 3300046675 Bacteria 94380
322 Ga0495657_0001655 3300046675 Bacteria 19148
323 Ga0495599_0000001 3300046678 Bacteria 537563
324 Ga0495599_0167828 3300046678 Bacteria 1355
325 Ga0495623_0000056 3300046679 Bacteria 69307
326 Ga0495646_0000007 3300046680 Bacteria 236764
327 Ga0495658_0010076 3300046683 Bacteria 4721
328 Ga0495613_0056629 3300046689 Bacteria 2879
329 Ga0495613_0414465 3300046689 Unclassified 917
330 Ga0495600_0000047 3300046809 Bacteria 71546
331 Ga0495600_0566138 3300046809 Bacteria 693
332 Ga0495604_0000014 3300047317 Bacteria 205481
333 Ga0495674_0000014 3300047319 Bacteria 241211
334 Ga0495674_0004659 3300047319 Bacteria 13185
335 Ga0495680_0000744 3300047322 Bacteria 36481
336 Ga0495675_0000940 3300047444 Bacteria 17639
337 Ga0495684_0000272 3300047471 Bacteria 41522
338 Ga0495686_0009589 3300047472 Bacteria 6959
339 Ga0495593_0103367 3300047673 Bacteria 1459
340 Ga0495602_0000017 3300048088 Bacteria 184180
341 Ga0495626_0079418 3300048091 Bacteria 1460
342 Ga0496104_0156832 3300048907 Bacteria 2184
343 Ga0496105_0405953 3300048908 Bacteria 1081
344 Ga0496108_0022862 3300048911 Bacteria 5145
345 Ga0496108_0055537 3300048911 Bacteria 3325
346 Ga0496109_0020142 3300048912 Bacteria 5893
347 Ga0496109_0052104 3300048912 Bacteria 3729
348 Ga0496110_0038590 3300048913 Bacteria 4156
349 Ga0496110_0048100 3300048913 Bacteria 3738
350 Ga0496111_0058755 3300048914 Bacteria 2785
351 Ga0496112_0006460 3300048915 Bacteria 10292
352 Ga0496112_0014728 3300048915 Bacteria 7272
353 Ga0496112_0082646 3300048915 Bacteria 3176
354 Ga0496113_0034460 3300048916 Bacteria 3694
355 Ga0496113_0034858 3300048916 Bacteria 3676
356 Ga0496115_0159555 3300048918 Bacteria 1864
357 Ga0496119_0089775 3300048922 Bacteria 1749
358 Ga0496121_0012588 3300048924 Bacteria 9196
359 Ga0496121_0013808 3300048924 Bacteria 8645
360 Ga0496125_0000237 3300048928 Bacteria 113322
361 Ga0496126_0191204 3300048929 Bacteria 1733
362 Ga0496126_0282062 3300048929 Bacteria 1376
363 Ga0501031_0017115 3300049568 Bacteria 4709
364 Ga0501031_0038407 3300049568 Bacteria 3124
365 Ga0501032_0008783 3300049569 Bacteria 7356
366 Ga0501032_0048959 3300049569 Bacteria 2852
367 Ga0501033_0001474 3300049570 Bacteria 20818
368 Ga0501033_0004101 3300049570 Bacteria 11740
369 Ga0501033_0053052 3300049570 Bacteria 3003
370 Ga0501033_0157684 3300049570 Bacteria 1635
371 Ga0501033_0250107 3300049570 Unclassified 1256
372 Ga0501033_0282691 3300049570 Bacteria 1171
373 Ga0501034_0011186 3300049571 Bacteria 9315
374 Ga0501034_0027091 3300049571 Bacteria 5830
375 Ga0501034_0036050 3300049571 Bacteria 5014
376 Ga0501034_0050255 3300049571 Bacteria 4205
377 Ga0501034_0437366 3300049571 Bacteria 1227
378 Ga0501036_0011010 3300049572 Bacteria 7481
379 Ga0501036_0030209 3300049572 Bacteria 4579
380 Ga0501036_0056776 3300049572 Bacteria 3317
381 Ga0501036_0116011 3300049572 Bacteria 2262
382 Ga0501037_0024080 3300049573 Bacteria 4501
383 Ga0501037_0052454 3300049573 Bacteria 2983
384 Ga0501037_0148839 3300049573 Unclassified 1674
385 Ga0501037_0151751 3300049573 Bacteria 1655
386 Ga0501038_0006326 3300049574 Bacteria 10955
387 Ga0501038_0031567 3300049574 Bacteria 4680
388 Ga0501038_0053727 3300049574 Unclassified 3467
389 Ga0501038_0081585 3300049574 Bacteria 2724
390 Ga0501039_0004711 3300049575 Bacteria 10326
391 Ga0501039_0107609 3300049575 Bacteria 2178
392 Ga0501039_0315619 3300049575 Unclassified 1229
393 Ga0501040_0003148 3300049576 Bacteria 10705
394 Ga0501040_0006328 3300049576 Bacteria 7687
395 Ga0501041_0002832 3300049577 Bacteria 9915
396 Ga0501042_0007786 3300049578 Bacteria 7040
397 Ga0501043_0010736 3300049579 Bacteria 7172
398 Ga0501046_0000115 3300049580 Bacteria 84375
399 Ga0501046_0000433 3300049580 Bacteria 41959
400 Ga0501046_0035056 3300049580 Bacteria 4045
401 Ga0501046_0041778 3300049580 Bacteria 3657
402 Ga0501046_0106012 3300049580 Bacteria 2151
403 Ga0501046_0191071 3300049580 Bacteria 1527
404 Ga0501047_0004044 3300049581 Bacteria 13788
405 Ga0501047_0014218 3300049581 Bacteria 7564
406 Ga0501047_0058799 3300049581 Bacteria 3713
407 Ga0501047_0091100 3300049581 Bacteria 2927
408 Ga0501047_0104900 3300049581 Bacteria 2707
409 Ga0501047_0165685 3300049581 Bacteria 2080
410 Ga0501048_0019363 3300049582 Bacteria 4994
411 Ga0501048_0086834 3300049582 Bacteria 2206
412 Ga0501048_0781921 3300049582 Bacteria 686
413 Ga0501067_0040472 3300049583 Bacteria 2588
414 Ga0501067_0062371 3300049583 Bacteria 2063
415 Ga0501068_0024536 3300049584 Bacteria 3542
416 Ga0501068_0374182 3300049584 Bacteria 917
417 Ga0501070_0003773 3300049586 Bacteria 13088
418 Ga0501070_0021689 3300049586 Bacteria 5385
419 Ga0501070_0062243 3300049586 Bacteria 3092
420 Ga0501070_0573833 3300049586 Unclassified 901
421 Ga0501072_0185970 3300049588 Bacteria 1657
422 Ga0501072_0479235 3300049588 Bacteria 984
423 Ga0501073_0006172 3300049589 Bacteria 8945
424 Ga0501073_0008282 3300049589 Bacteria 7710
425 Ga0501073_0041233 3300049589 Bacteria 3262
426 Ga0501073_0076247 3300049589 Unclassified 2333
427 Ga0501073_0179107 3300049589 Bacteria 1467
428 Ga0501074_0007305 3300049590 Bacteria 7988
429 Ga0501074_0008596 3300049590 Bacteria 7395
430 Ga0501074_0260120 3300049590 Bacteria 1234
431 Ga0501076_0002219 3300049592 Bacteria 13304
432 Ga0501076_0257747 3300049592 Bacteria 1428
433 Ga0501077_0016658 3300049593 Bacteria 4633
434 Ga0501079_0005199 3300049741 Bacteria 9673
435 Ga0501080_0005552 3300049742 Bacteria 11263
436 Ga0501080_0012585 3300049742 Bacteria 7757
437 Ga0501080_0020036 3300049742 Bacteria 6189
438 Ga0501081_0006281 3300049743 Bacteria 7703
439 Ga0501083_0006332 3300049744 Bacteria 8389
440 Ga0501083_0018840 3300049744 Bacteria 4806
441 Ga0501083_0045918 3300049744 Bacteria 2954
442 Ga0501083_0219670 3300049744 Bacteria 1238
443 Ga0501035_0001607 3300049822 Bacteria 22855
444 Ga0501035_0002718 3300049822 Bacteria 17190
445 Ga0501035_0010537 3300049822 Bacteria 8566
446 Ga0501035_0059364 3300049822 Bacteria 3406
447 Ga0501044_0001279 3300049823 Bacteria 29728
448 Ga0501044_0008771 3300049823 Bacteria 11060
449 Ga0501044_0013927 3300049823 Bacteria 8689
450 Ga0501044_0014482 3300049823 Bacteria 8510
451 Ga0501044_0240000 3300049823 Unclassified 1756
452 Ga0501044_0328555 3300049823 Bacteria 1452
453 Ga0501044_0860456 3300049823 Bacteria 783
454 Ga0501045_0013884 3300049824 Bacteria 5697
455 Ga0501045_0069875 3300049824 Bacteria 2583
456 nmdc:mga03683_38150_c1 3300050489 Bacteria 1961
457 nmdc:mga03n38_38757_c1 3300050490 Bacteria 2063
458 nmdc:mga00v17_6527_c1 3300050491 Bacteria 6192
459 nmdc:mga0yw44_54033_c1 3300050492 Bacteria 2440
460 nmdc:mga06z11_10355_c1 3300050494 Bacteria 3970
461 nmdc:mga06z11_285571_c1 3300050494 Bacteria 978
462 nmdc:mga06r32_205309_c1 3300050510 Bacteria 1958
463 nmdc:mga06r32_718631_c1 3300050510 Bacteria 964
464 nmdc:mga0n895_138483_c1 3300050512 Bacteria 2461
465 Ga0495601_0000016 3300053077 Bacteria 207486
466 Ga0495612_0000035 3300053078 Bacteria 69194
467 Ga0495595_0000032 3300053084 Bacteria 87066
468 Ga0495619_0000033 3300053085 Bacteria 138925
469 Ga0495619_0123350 3300053085 Bacteria 1777
470 Ga0500643_006600 3300053087 Bacteria 4824
471 Ga0500643_015216 3300053087 Bacteria 2644
472 Ga0500651_0004195 3300053093 Bacteria 8043
473 Ga0500556_0106315 3300053104 Bacteria 1085
474 Ga0500562_017035 3300053108 Bacteria 1871
475 Ga0500569_000647 3300053109 Bacteria 5964
476 Ga0500642_0134604 3300053130 Bacteria 1158
477 Ga0500658_0000491 3300053134 Bacteria 16931
478 Ga0500568_0016163 3300053139 Bacteria 3324
479 Ga0500603_012189 3300053150 Bacteria 1969
480 Ga0500616_0030741 3300053153 Bacteria 2946
481 Ga0500622_0048460 3300053156 Bacteria 2192
482 Ga0500645_000006 3300053730 Bacteria 276677
483 Ga0501084_0022328 3300054114 Bacteria 5281
484 Ga0501084_0839377 3300054114 Bacteria 773
485 Ga0501082_0012565 3300060353 Bacteria 7275
486 Ga0501082_0658814 3300060353 Unclassified 916
487 Ga0530510_0170358 3300061734 Bacteria 1613

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10011734 Ga0075369_100117343 178
2 3300010375 Ga0105239_10342656 Ga0105239_103426561 178
3 3300048928 Ga0496125_0000237 Ga0496125_0000237_111292_112005 185
4 3300009176 Ga0105242_10220099 Ga0105242_102200991 186
5 3300048924 Ga0496121_0012588 Ga0496121_0012588_688_1404 186
6 3300049823 Ga0501044_0860456 Ga0501044_0860456_123_746 187
7 3300005367 Ga0070667_100006083 Ga0070667_1000060834 188
8 3300013308 Ga0157375_10126084 Ga0157375_101260843 188
9 3300015690 Ga0183363_1151 Ga0183363_11514 188
10 3300025927 Ga0207687_10100122 Ga0207687_101001222 188
11 3300025986 Ga0207658_10020977 Ga0207658_100209774 188
12 3300028381 Ga0268264_10260651 Ga0268264_102606512 188
13 3300048922 Ga0496119_0089775 Ga0496119_0089775_970_1689 188
14 3300049823 Ga0501044_0328555 Ga0501044_0328555_809_1414 188
15 3300053093 Ga0500651_0004195 Ga0500651_0004195_5195_5914 188
16 3300053104 Ga0500556_0106315 Ga0500556_0106315_309_1028 188
17 3300053130 Ga0500642_0134604 Ga0500642_0134604_393_1112 188
18 3300026118 Ga0207675_100235392 Ga0207675_1002353922 190
19 3300031250 Ga0265331_10047000 Ga0265331_100470003 190
20 3300053087 Ga0500643_015216 Ga0500643_015216_735_1406 190
21 3300053150 Ga0500603_012189 Ga0500603_012189_1035_1754 190
22 3300031238 Ga0265332_10008046 Ga0265332_100080465 191
23 3300031242 Ga0265329_10010776 Ga0265329_100107763 191
24 3300031247 Ga0265340_10006067 Ga0265340_100060673 191
25 3300031711 Ga0265314_10063383 Ga0265314_100633832 191
26 3300031711 Ga0265314_10234126 Ga0265314_102341262 191
27 3300031712 Ga0265342_10004642 Ga0265342_100046429 191
28 3300031712 Ga0265342_10023159 Ga0265342_100231592 191
29 3300026067 Ga0207678_10406388 Ga0207678_104063883 192
30 3300049582 Ga0501048_0781921 Ga0501048_0781921_33_668 193
31 3300049822 Ga0501035_0059364 Ga0501035_0059364_1420_2166 193
32 3300031250 Ga0265331_10128618 Ga0265331_101286182 195
33 3300031344 Ga0265316_10010203 Ga0265316_100102037 195
34 3300053156 Ga0500622_0048460 Ga0500622_0048460_693_1397 195
35 3300013297 Ga0157378_11049154 Ga0157378_110491542 196
36 3300041505 Ga0451849_0008212 Ga0451849_0008212_946_1650 196
37 3300041509 Ga0451843_0322861 Ga0451843_0322861_1329_2033 196
38 3300041511 Ga0451855_0762862 Ga0451855_0762862_1310_2014 196
39 3300046511 Ga0495608_0080799 Ga0495608_0080799_1446_2093 196
40 3300046559 Ga0495667_0000235 Ga0495667_0000235_20969_21616 196
41 3300046675 Ga0495657_0001655 Ga0495657_0001655_7704_8351 196
42 3300046809 Ga0495600_0566138 Ga0495600_0566138_25_672 196
43 3300049589 Ga0501073_0041233 Ga0501073_0041233_1617_2357 196
44 3300006048 Ga0075363_100013704 Ga0075363_1000137044 197
45 3300021377 Ga0213874_10035085 Ga0213874_100350852 197
46 3300039438 Ga0436360_0064513 Ga0436360_0064513_169_783 197
47 3300049568 Ga0501031_0038407 Ga0501031_0038407_1103_1840 197
48 3300049569 Ga0501032_0048959 Ga0501032_0048959_952_1689 197
49 3300049570 Ga0501033_0053052 Ga0501033_0053052_1164_1901 197
50 3300049571 Ga0501034_0036050 Ga0501034_0036050_2601_3338 197
51 3300049573 Ga0501037_0024080 Ga0501037_0024080_2601_3338 197
52 3300049574 Ga0501038_0031567 Ga0501038_0031567_1343_2080 197
53 3300049575 Ga0501039_0107609 Ga0501039_0107609_1262_1999 197
54 3300049576 Ga0501040_0003148 Ga0501040_0003148_404_1141 197
55 3300049580 Ga0501046_0041778 Ga0501046_0041778_1103_1840 197
56 3300049581 Ga0501047_0165685 Ga0501047_0165685_180_917 197
57 3300049582 Ga0501048_0086834 Ga0501048_0086834_1382_2119 197
58 3300049586 Ga0501070_0062243 Ga0501070_0062243_1005_1742 197
59 3300049590 Ga0501074_0260120 Ga0501074_0260120_247_984 197
60 3300049824 Ga0501045_0069875 Ga0501045_0069875_609_1346 197
61 3300005548 Ga0070665_100315654 Ga0070665_1003156542 198
62 3300025910 Ga0207684_10222483 Ga0207684_102224832 198
63 3300026118 Ga0207675_100644600 Ga0207675_1006446002 198
64 3300046472 Ga0495580_0325332 Ga0495580_0325332_203_892 198
65 3300049568 Ga0501031_0017115 Ga0501031_0017115_1671_2414 198
66 3300049569 Ga0501032_0008783 Ga0501032_0008783_5662_6405 198
67 3300049570 Ga0501033_0001474 Ga0501033_0001474_13331_14074 198
68 3300049570 Ga0501033_0282691 Ga0501033_0282691_89_715 198
69 3300049571 Ga0501034_0027091 Ga0501034_0027091_952_1695 198
70 3300049572 Ga0501036_0011010 Ga0501036_0011010_5967_6710 198
71 3300049573 Ga0501037_0151751 Ga0501037_0151751_834_1577 198
72 3300049574 Ga0501038_0006326 Ga0501038_0006326_7020_7763 198
73 3300049575 Ga0501039_0004711 Ga0501039_0004711_6342_7085 198
74 3300049579 Ga0501043_0010736 Ga0501043_0010736_3954_4697 198
75 3300049580 Ga0501046_0000433 Ga0501046_0000433_6005_6748 198
76 3300049580 Ga0501046_0191071 Ga0501046_0191071_282_908 198
77 3300049581 Ga0501047_0014218 Ga0501047_0014218_1749_2492 198
78 3300049584 Ga0501068_0024536 Ga0501068_0024536_2320_3063 198
79 3300049584 Ga0501068_0374182 Ga0501068_0374182_227_841 198
80 3300049586 Ga0501070_0021689 Ga0501070_0021689_2613_3356 198
81 3300049588 Ga0501072_0479235 Ga0501072_0479235_277_972 198
82 3300049589 Ga0501073_0006172 Ga0501073_0006172_1183_1926 198
83 3300049590 Ga0501074_0008596 Ga0501074_0008596_789_1532 198
84 3300049742 Ga0501080_0005552 Ga0501080_0005552_3954_4697 198
85 3300049744 Ga0501083_0219670 Ga0501083_0219670_312_1055 198
86 3300049822 Ga0501035_0010537 Ga0501035_0010537_1079_1822 198
87 3300049823 Ga0501044_0008771 Ga0501044_0008771_6745_7488 198
88 3300050512 nmdc:mga0n895_138483_c1 nmdc:mga0n895_138483_c1_1025_1738 198
89 3300053108 Ga0500562_017035 Ga0500562_017035_897_1556 198
90 3300061734 Ga0530510_0170358 Ga0530510_0170358_306_920 198
91 3300009174 Ga0105241_10072294 Ga0105241_100722942 199
92 3300009551 Ga0105238_10009489 Ga0105238_100094894 199
93 3300013296 Ga0157374_10000496 Ga0157374_100004965 199
94 3300013297 Ga0157378_10011036 Ga0157378_100110364 199
95 3300013307 Ga0157372_10001696 Ga0157372_1000169621 199
96 3300014969 Ga0157376_10066812 Ga0157376_100668123 199
97 3300041410 Ga0439461_0006955 Ga0439461_0006955_214_831 199
98 3300041491 Ga0451833_0552563 Ga0451833_0552563_340_1044 199
99 3300041494 Ga0451837_0291003 Ga0451837_0291003_276_980 199
100 3300041496 Ga0451839_1037019 Ga0451839_1037019_273_977 199
101 3300041501 Ga0451845_0815701 Ga0451845_0815701_163_867 199
102 3300041512 Ga0451853_0670545 Ga0451853_0670545_96_800 199
103 3300046501 Ga0495607_0053093 Ga0495607_0053093_399_1103 199
104 3300046524 Ga0495648_0074512 Ga0495648_0074512_1176_1880 199
105 3300053087 Ga0500643_006600 Ga0500643_006600_1541_2212 199
106 3300028573 Ga0265334_10000033 Ga0265334_1000003353 200
107 3300041492 Ga0451835_0259487 Ga0451835_0259487_1311_2015 200
108 3300049571 Ga0501034_0437366 Ga0501034_0437366_68_700 200
109 3300050510 nmdc:mga06r32_205309_c1 nmdc:mga06r32_205309_c1_167_787 200
110 3300053730 Ga0500645_000006 Ga0500645_000006_253357_254079 200
111 iso_pu_bacteria 2920822456 2920825318 201
112 3300005546 Ga0070696_100166275 Ga0070696_1001662753 202
113 3300005937 Ga0081455_10094677 Ga0081455_100946771 202
114 3300009551 Ga0105238_11035137 Ga0105238_110351372 202
115 3300031241 Ga0265325_10001741 Ga0265325_1000174111 202
116 3300031249 Ga0265339_10001424 Ga0265339_1000142411 202
117 3300045051 Ga0451576_0011229 Ga0451576_0011229_2878_3570 202
118 3300046522 Ga0495643_0010530 Ga0495643_0010530_2475_3176 202
119 3300009174 Ga0105241_10255371 Ga0105241_102553711 204
120 iso_pu_bacteria 2909042592 2909046438 204
121 3300048929 Ga0496126_0191204 Ga0496126_0191204_967_1707 205
122 3300026078 Ga0207702_10716038 Ga0207702_107160381 206
123 3300049581 Ga0501047_0091100 Ga0501047_0091100_318_995 206
124 3300049822 Ga0501035_0001607 Ga0501035_0001607_870_1547 206
125 3300049823 Ga0501044_0001279 Ga0501044_0001279_461_1138 206
126 3300005458 Ga0070681_10052179 Ga0070681_100521794 207
127 3300005530 Ga0070679_100060786 Ga0070679_1000607862 207
128 3300009093 Ga0105240_10007943 Ga0105240_1000794314 207
129 3300013102 Ga0157371_10097588 Ga0157371_100975882 207
130 3300013104 Ga0157370_10139839 Ga0157370_101398392 207
131 3300013307 Ga0157372_10223501 Ga0157372_102235012 207
132 3300020069 Ga0197907_10371358 Ga0197907_103713581 207
133 3300020070 Ga0206356_11908769 Ga0206356_119087691 207
134 3300020075 Ga0206349_1819953 Ga0206349_18199532 207
135 3300020076 Ga0206355_1330646 Ga0206355_13306462 207
136 3300020080 Ga0206350_10769023 Ga0206350_107690231 207
137 3300020082 Ga0206353_11323159 Ga0206353_113231592 207
138 3300022467 Ga0224712_10015693 Ga0224712_100156932 207
139 3300025912 Ga0207707_10475934 Ga0207707_104759341 207
140 3300025917 Ga0207660_10268303 Ga0207660_102683032 207
141 3300025921 Ga0207652_10139955 Ga0207652_101399552 207
142 3300025944 Ga0207661_10413688 Ga0207661_104136882 207
143 3300031711 Ga0265314_10156494 Ga0265314_101564942 207
144 3300037418 Ga0395900_0162295 Ga0395900_0162295_310_990 207
145 3300046515 Ga0495620_0027483 Ga0495620_0027483_229_930 207
146 3300049577 Ga0501041_0002832 Ga0501041_0002832_5773_6510 207
147 3300049580 Ga0501046_0000115 Ga0501046_0000115_76267_77004 207
148 3300049582 Ga0501048_0019363 Ga0501048_0019363_259_996 207
149 3300049592 Ga0501076_0002219 Ga0501076_0002219_1881_2618 207
150 3300049743 Ga0501081_0006281 Ga0501081_0006281_534_1271 207
151 3300049744 Ga0501083_0018840 Ga0501083_0018840_49_786 207
152 3300053109 Ga0500569_000647 Ga0500569_000647_1175_1876 207
153 3300031247 Ga0265340_10044431 Ga0265340_100444312 208
154 3300031711 Ga0265314_10065678 Ga0265314_100656783 208
155 3300037853 Ga0436364_0596856 Ga0436364_0596856_429_1082 208
156 3300039450 Ga0436363_0268886 Ga0436363_0268886_86_772 208
157 3300039450 Ga0436363_1116204 Ga0436363_1116204_155_808 208
158 3300002705 JGI25156J39149_1011524 JGI25156J39149_10115241 209
159 3300002741 JGI25157J39369_1002286 JGI25157J39369_10022865 209
160 3300003759 Ga0055525_1000242 Ga0055525_100024228 209
161 3300003760 Ga0055527_1000063 Ga0055527_100006363 209
162 3300003761 Ga0055535_1000406 Ga0055535_100040621 209
163 3300003762 Ga0055542_1000146 Ga0055542_100014663 209
164 3300003762 Ga0055542_1003953 Ga0055542_10039531 209
165 3300003763 Ga0055529_1000597 Ga0055529_10005977 209
166 3300005458 Ga0070681_10521562 Ga0070681_105215621 209
167 3300020069 Ga0197907_11490845 Ga0197907_114908451 209
168 3300025228 Ga0209672_100007 Ga0209672_100007522 209
169 3300025228 Ga0209672_102534 Ga0209672_1025341 209
170 3300025230 Ga0209563_100071 Ga0209563_100071191 209
171 3300025242 Ga0209258_100017 Ga0209258_100017296 209
172 3300025242 Ga0209258_100758 Ga0209258_10075816 209
173 3300025254 Ga0209148_1000044 Ga0209148_1000044297 209
174 3300025254 Ga0209148_1003930 Ga0209148_10039305 209
175 3300025256 Ga0209759_1000166 Ga0209759_1000166105 209
176 3300025272 Ga0209455_1000010 Ga0209455_1000010522 209
177 3300025916 Ga0207663_10364322 Ga0207663_103643221 209
178 3300031235 Ga0265330_10028027 Ga0265330_100280273 209
179 3300031250 Ga0265331_10068403 Ga0265331_100684032 209
180 3300037312 Ga0395899_0008203 Ga0395899_0008203_4268_4951 209
181 3300037466 Ga0395898_0000460 Ga0395898_0000460_64085_64768 209
182 3300039450 Ga0436363_1546557 Ga0436363_1546557_1265_2011 209
183 3300044656 Ga0466969_0004995 Ga0466969_0004995_6124_6807 209
184 3300044684 Ga0466966_0005052 Ga0466966_0005052_7313_7996 209
185 3300044693 Ga0466961_0001260 Ga0466961_0001260_162_845 209
186 3300044693 Ga0466961_0024959 Ga0466961_0024959_2943_3626 209
187 3300044693 Ga0466961_0202667 Ga0466961_0202667_214_897 209
188 3300044765 Ga0466970_0002513 Ga0466970_0002513_7604_8287 209
189 3300044765 Ga0466970_0045572 Ga0466970_0045572_302_985 209
190 3300044842 Ga0466957_0042584 Ga0466957_0042584_1862_2545 209
191 3300045049 Ga0466959_0210400 Ga0466959_0210400_418_1101 209
192 3300045836 Ga0466958_0421763 Ga0466958_0421763_56_739 209
193 3300049571 Ga0501034_0011186 Ga0501034_0011186_3064_3747 209
194 3300049572 Ga0501036_0030209 Ga0501036_0030209_3096_3779 209
195 3300049573 Ga0501037_0052454 Ga0501037_0052454_155_838 209
196 3300049581 Ga0501047_0004044 Ga0501047_0004044_11485_12168 209
197 3300049583 Ga0501067_0040472 Ga0501067_0040472_1117_1800 209
198 3300049586 Ga0501070_0003773 Ga0501070_0003773_3349_4032 209
199 3300049589 Ga0501073_0008282 Ga0501073_0008282_1621_2304 209
200 3300049590 Ga0501074_0007305 Ga0501074_0007305_5207_5890 209
201 3300049741 Ga0501079_0005199 Ga0501079_0005199_5006_5689 209
202 3300049742 Ga0501080_0012585 Ga0501080_0012585_5279_5962 209
203 3300049822 Ga0501035_0002718 Ga0501035_0002718_13629_14312 209
204 3300049823 Ga0501044_0014482 Ga0501044_0014482_6207_6890 209
205 3300054114 Ga0501084_0022328 Ga0501084_0022328_2903_3586 209
206 3300020078 Ga0206352_10323814 Ga0206352_103238141 210
207 3300020082 Ga0206353_10866523 Ga0206353_108665232 210
208 3300025912 Ga0207707_10301952 Ga0207707_103019521 210
209 3300031711 Ga0265314_10001465 Ga0265314_100014652 210
210 3300031711 Ga0265314_10015545 Ga0265314_100155456 210
211 3300049570 Ga0501033_0157684 Ga0501033_0157684_128_817 210
212 3300005455 Ga0070663_100225720 Ga0070663_1002257201 211
213 3300005539 Ga0068853_100001404 Ga0068853_1000014048 211
214 3300005577 Ga0068857_100025418 Ga0068857_1000254186 211
215 3300005616 Ga0068852_100005382 Ga0068852_10000538211 211
216 3300005834 Ga0068851_10001310 Ga0068851_1000131010 211
217 3300009093 Ga0105240_10072658 Ga0105240_100726582 211
218 3300009551 Ga0105238_10001064 Ga0105238_1000106428 211
219 3300010375 Ga0105239_10010423 Ga0105239_100104238 211
220 3300025297 Ga0209758_1002527 Ga0209758_100252716 211
221 3300025321 Ga0207656_10005726 Ga0207656_100057266 211
222 3300025911 Ga0207654_10000806 Ga0207654_1000080610 211
223 3300025913 Ga0207695_10003805 Ga0207695_1000380522 211
224 3300025914 Ga0207671_10194907 Ga0207671_101949072 211
225 3300025924 Ga0207694_10000273 Ga0207694_100002739 211
226 3300025949 Ga0207667_10010297 Ga0207667_100102975 211
227 3300025981 Ga0207640_10107714 Ga0207640_101077142 211
228 3300026041 Ga0207639_10005178 Ga0207639_100051782 211
229 3300026078 Ga0207702_10000003 Ga0207702_10000003231 211
230 3300026116 Ga0207674_10073263 Ga0207674_100732634 211
231 3300026142 Ga0207698_10137713 Ga0207698_101377133 211
232 3300046507 Ga0495606_0010004 Ga0495606_0010004_5837_6538 211
233 3300046512 Ga0495610_0020204 Ga0495610_0020204_888_1589 211
234 3300046542 Ga0495597_0018607 Ga0495597_0018607_1717_2418 211
235 3300047472 Ga0495686_0009589 Ga0495686_0009589_5783_6484 211
236 3300048091 Ga0495626_0079418 Ga0495626_0079418_258_959 211
237 3300050494 nmdc:mga06z11_285571_c1 nmdc:mga06z11_285571_c1_258_959 211
238 3300053134 Ga0500658_0000491 Ga0500658_0000491_14116_14817 211
239 3300053153 Ga0500616_0030741 Ga0500616_0030741_1063_1764 211
240 iso_pu_bacteria 2510065019 2510136779 211
241 iso_pu_bacteria 2510461076 2510899956 211
242 iso_pu_bacteria 2510461076 2510900552 211
243 iso_pu_bacteria 2513237085 2513576667 211
244 iso_pu_bacteria 2513237103 2513710068 211
245 iso_pu_bacteria 2513237162 2514021415 211
246 iso_pu_bacteria 2515075009 2515115354 211
247 iso_pu_bacteria 2515154113 2515636083 211
248 iso_pu_bacteria 2515154114 2515644761 211
249 iso_pu_bacteria 2515154116 2515658060 211
250 iso_pu_bacteria 2515154134 2515742215 211
251 iso_pu_bacteria 2516653077 2517041651 211
252 iso_pu_bacteria 2516653085 2517080766 211
253 iso_pu_bacteria 2517287029 2517411063 211
254 iso_pu_bacteria 2529292951 2530644861 211
255 iso_pu_bacteria 2585427526 2585524448 211
256 iso_pu_bacteria 2718217997 2719667880 211
257 iso_pu_bacteria 2718218199 2720494643 211
258 iso_pu_bacteria 2718218232 2720610978 211
259 iso_pu_bacteria 2718218235 2720629227 211
260 iso_pu_bacteria 2718218269 2720771799 211
261 iso_pu_bacteria 2721755556 2723029201 211
262 iso_pu_bacteria 2721755684 2723562836 211
263 iso_pu_bacteria 2721755685 2723570826 211
264 iso_pu_bacteria 2721755819 2724086619 211
265 iso_pu_bacteria 2721755822 2724106777 211
266 iso_pu_bacteria 2721755823 2724107578 211
267 iso_pu_bacteria 2728369352 2730105515 211
268 iso_pu_bacteria 2802429605 2805927891 211
269 iso_pu_bacteria 2802429606 2805933738 211
270 iso_pu_bacteria 2838016132 2838019296 211
271 iso_pu_bacteria 2838048938 2838050361 211
272 iso_pu_bacteria 2838061910 2838063065 211
273 iso_pu_bacteria 2838068647 2838071630 211
274 iso_pu_bacteria 2838668709 2838673696 211
275 iso_pu_bacteria 2838686498 2838692265 211
276 iso_pu_bacteria 2838701080 2838705271 211
277 iso_pu_bacteria 2838729681 2838734317 211
278 iso_pu_bacteria 2838742623 2838746769 211
279 iso_pu_bacteria 2841851746 2841853460 211
280 iso_pu_bacteria 2842146304 2842150239 211
281 iso_pu_bacteria 2842156927 2842161455 211
282 iso_pu_bacteria 2842163707 2842167340 211
283 iso_pu_bacteria 2842180545 2842185744 211
284 iso_pu_bacteria 2842192696 2842195482 211
285 iso_pu_bacteria 2842217011 2842223108 211
286 iso_pu_bacteria 2842229732 2842234085 211
287 iso_pu_bacteria 2842243621 2842246386 211
288 iso_pu_bacteria 2842250916 2842254925 211
289 iso_pu_bacteria 2842257432 2842260754 211
290 iso_pu_bacteria 2842264693 2842269348 211
291 iso_pu_bacteria 2842271015 2842276043 211
292 iso_pu_bacteria 2842304105 2842308638 211
293 iso_pu_bacteria 2842311132 2842311968 211
294 iso_pu_bacteria 2842317721 2842319244 211
295 iso_pu_bacteria 2842395702 2842396694 211
296 iso_pu_bacteria 2842422224 2842425263 211
297 iso_pu_bacteria 2842428310 2842432695 211
298 iso_pu_bacteria 2842434925 2842438857 211
299 iso_pu_bacteria 2842441272 2842445487 211
300 iso_pu_bacteria 2842447887 2842449941 211
301 iso_pu_bacteria 2842462802 2842467732 211
302 iso_pu_bacteria 2842469257 2842473472 211
303 iso_pu_bacteria 2842489311 2842491690 211
304 iso_pu_bacteria 2842495871 2842499761 211
305 iso_pu_bacteria 2844454524 2844460818 211
306 iso_pu_bacteria 2933570622 2933575231 211
307 iso_pu_bacteria 2933599457 2933602429 211
308 iso_pu_bacteria 2935901341 2935906876 211
309 iso_pu_bacteria 2936367885 2936370458 211
310 iso_pu_bacteria 2936375103 2936378123 211
311 iso_pu_bacteria 8005282627 8005288010 211
312 iso_pu_bacteria 8005307578 8005313333 211
313 iso_pu_bacteria 8005376324 8005382132 211
314 iso_pu_bacteria 8005430974 8005431293 211
315 iso_pu_bacteria 8005460587 8005466579 211
316 iso_pu_bacteria 8005497431 8005503291 211
317 iso_pu_bacteria 8005619151 8005625431 211
318 iso_pu_bacteria 8005626139 8005630413 211
319 iso_pu_bacteria 8005668836 8005674809 211
320 iso_pu_bacteria 8005695170 8005696881 211
321 iso_pu_bacteria 8018163183 8018166183 211
322 iso_pu_bacteria 8023680758 8023688347 211
323 iso_pu_bacteria 8024501048 8024503982 211
324 iso_pu_bacteria 8057874678 8057880812 211
325 3300001989 JGI24739J22299_10013673 JGI24739J22299_100136733 212
326 3300001990 JGI24737J22298_10010536 JGI24737J22298_100105363 212
327 3300002067 JGI24735J21928_10018499 JGI24735J21928_100184992 212
328 3300005539 Ga0068853_100128191 Ga0068853_1001281913 212
329 3300005563 Ga0068855_100029771 Ga0068855_1000297714 212
330 3300005577 Ga0068857_100063398 Ga0068857_1000633984 212
331 3300005578 Ga0068854_100020296 Ga0068854_1000202962 212
332 3300005614 Ga0068856_100044653 Ga0068856_1000446532 212
333 3300009093 Ga0105240_10068422 Ga0105240_100684222 212
334 3300009545 Ga0105237_10169818 Ga0105237_101698182 212
335 3300009551 Ga0105238_10046958 Ga0105238_100469582 212
336 3300010375 Ga0105239_10047705 Ga0105239_100477052 212
337 3300025904 Ga0207647_10020459 Ga0207647_100204592 212
338 3300025913 Ga0207695_10058711 Ga0207695_100587112 212
339 3300025914 Ga0207671_10108228 Ga0207671_101082282 212
340 3300025949 Ga0207667_10230187 Ga0207667_102301871 212
341 3300025981 Ga0207640_10044828 Ga0207640_100448285 212
342 3300026041 Ga0207639_10024836 Ga0207639_100248367 212
343 3300026078 Ga0207702_10067303 Ga0207702_100673032 212
344 3300026116 Ga0207674_10007519 Ga0207674_100075197 212
345 3300048907 Ga0496104_0156832 Ga0496104_0156832_264_995 212
346 3300048911 Ga0496108_0055537 Ga0496108_0055537_1346_2077 212
347 3300048912 Ga0496109_0020142 Ga0496109_0020142_5086_5817 212
348 3300048913 Ga0496110_0038590 Ga0496110_0038590_1233_1964 212
349 3300048914 Ga0496111_0058755 Ga0496111_0058755_823_1554 212
350 3300048915 Ga0496112_0082646 Ga0496112_0082646_1317_2048 212
351 3300048916 Ga0496113_0034460 Ga0496113_0034460_135_866 212
352 3300048918 Ga0496115_0159555 Ga0496115_0159555_346_1059 212
353 3300048929 Ga0496126_0282062 Ga0496126_0282062_506_1219 212
354 3300021361 Ga0213872_10148801 Ga0213872_101488012 213
355 3300031730 Ga0307516_10004445 Ga0307516_100044453 213
356 3300039447 Ga0436361_0709744 Ga0436361_0709744_1594_2307 213
357 3300049570 Ga0501033_0004101 Ga0501033_0004101_4677_5396 213
358 3300049571 Ga0501034_0050255 Ga0501034_0050255_453_1172 213
359 3300049572 Ga0501036_0116011 Ga0501036_0116011_454_1173 213
360 3300049574 Ga0501038_0081585 Ga0501038_0081585_561_1280 213
361 3300049576 Ga0501040_0006328 Ga0501040_0006328_5703_6422 213
362 3300049578 Ga0501042_0007786 Ga0501042_0007786_727_1446 213
363 3300049583 Ga0501067_0062371 Ga0501067_0062371_883_1602 213
364 3300049588 Ga0501072_0185970 Ga0501072_0185970_504_1223 213
365 3300049592 Ga0501076_0257747 Ga0501076_0257747_265_984 213
366 3300049593 Ga0501077_0016658 Ga0501077_0016658_461_1180 213
367 3300049744 Ga0501083_0006332 Ga0501083_0006332_3873_4592 213
368 3300049823 Ga0501044_0013927 Ga0501044_0013927_7278_7997 213
369 3300049824 Ga0501045_0013884 Ga0501045_0013884_175_894 213
370 3300060353 Ga0501082_0012565 Ga0501082_0012565_1529_2248 213
371 3300005344 Ga0070661_100325400 Ga0070661_1003254001 214
372 3300005466 Ga0070685_10186175 Ga0070685_101861752 214
373 3300005535 Ga0070684_100108465 Ga0070684_1001084653 214
374 3300005547 Ga0070693_100303887 Ga0070693_1003038871 214
375 3300005563 Ga0068855_100001490 Ga0068855_1000014907 214
376 3300005564 Ga0070664_100353441 Ga0070664_1003534413 214
377 3300005614 Ga0068856_100000065 Ga0068856_1000000652 214
378 3300006048 Ga0075363_100004002 Ga0075363_1000040024 214
379 3300006237 Ga0097621_100000908 Ga0097621_10000090824 214
380 3300009098 Ga0105245_10081796 Ga0105245_100817964 214
381 3300009553 Ga0105249_10835679 Ga0105249_108356792 214
382 3300011119 Ga0105246_10182725 Ga0105246_101827252 214
383 3300013105 Ga0157369_10000264 Ga0157369_100002644 214
384 3300025911 Ga0207654_10041276 Ga0207654_100412762 214
385 3300025921 Ga0207652_10016468 Ga0207652_100164688 214
386 3300025927 Ga0207687_10101557 Ga0207687_101015572 214
387 3300025949 Ga0207667_10000413 Ga0207667_1000041322 214
388 3300026078 Ga0207702_10000209 Ga0207702_100002094 214
389 3300026142 Ga0207698_10097751 Ga0207698_100977512 214
390 3300048908 Ga0496105_0405953 Ga0496105_0405953_101_805 214
391 3300048911 Ga0496108_0022862 Ga0496108_0022862_3769_4473 214
392 3300048912 Ga0496109_0052104 Ga0496109_0052104_1052_1756 214
393 3300048913 Ga0496110_0048100 Ga0496110_0048100_286_990 214
394 3300048915 Ga0496112_0006460 Ga0496112_0006460_6492_7196 214
395 3300048915 Ga0496112_0014728 Ga0496112_0014728_2893_3567 214
396 3300048916 Ga0496113_0034858 Ga0496113_0034858_436_1140 214
397 3300050490 nmdc:mga03n38_38757_c1 nmdc:mga03n38_38757_c1_938_1642 214
398 3300005439 Ga0070711_100549780 Ga0070711_1005497801 215
399 3300005842 Ga0068858_100229374 Ga0068858_1002293743 215
400 3300005844 Ga0068862_100059198 Ga0068862_1000591983 215
401 3300006051 Ga0075364_10015693 Ga0075364_100156932 215
402 3300006177 Ga0075362_10004567 Ga0075362_100045672 215
403 3300006178 Ga0075367_10007643 Ga0075367_100076433 215
404 3300007265 Ga0099794_10205016 Ga0099794_102050161 215
405 3300010159 Ga0099796_10021181 Ga0099796_100211812 215
406 3300014326 Ga0157380_10373996 Ga0157380_103739962 215
407 3300025898 Ga0207692_10242719 Ga0207692_102427192 215
408 3300025939 Ga0207665_10070163 Ga0207665_100701632 215
409 3300026035 Ga0207703_10089031 Ga0207703_100890312 215
410 3300027512 Ga0209179_1013762 Ga0209179_10137622 215
411 3300028380 Ga0268265_10044953 Ga0268265_100449533 215
412 3300035086 Ga0373934_0025045 Ga0373934_0025045_1235_1954 215
413 3300035111 Ga0373923_0005091 Ga0373923_0005091_3274_3993 215
414 3300035116 Ga0373945_0013035 Ga0373945_0013035_1454_2173 215
415 3300035117 Ga0373953_0001606 Ga0373953_0001606_1133_1852 215
416 3300035118 Ga0373954_0039304 Ga0373954_0039304_1344_2063 215
417 3300035119 Ga0373956_0007284 Ga0373956_0007284_1745_2464 215
418 3300035120 Ga0373957_0103545 Ga0373957_0103545_359_1078 215
419 3300035170 Ga0373943_0003490 Ga0373943_0003490_4736_5455 215
420 3300035171 Ga0373946_0004458 Ga0373946_0004458_1647_2366 215
421 3300035172 Ga0373955_0000346 Ga0373955_0000346_10555_11274 215
422 3300035410 Ga0373924_0001455 Ga0373924_0001455_6827_7546 215
423 3300035692 Ga0373935_0000056 Ga0373935_0000056_35743_36462 215
424 3300035695 Ga0373927_0033737 Ga0373927_0033737_1932_2651 215
425 3300035724 Ga0373933_0004205 Ga0373933_0004205_5501_6220 215
426 3300035725 Ga0373947_0004488 Ga0373947_0004488_1990_2709 215
427 3300036401 Ga0373937_0000075 Ga0373937_0000075_68912_69631 215
428 3300036401 Ga0373937_0351196 Ga0373937_0351196_444_1163 215
429 3300037068 Ga0373925_0000159 Ga0373925_0000159_35603_36322 215
430 3300046454 Ga0495592_0000102 Ga0495592_0000102_68881_69600 215
431 3300046462 Ga0495651_0001236 Ga0495651_0001236_14107_14826 215
432 3300046463 Ga0495653_0000036 Ga0495653_0000036_53221_53940 215
433 3300046476 Ga0495662_0006322 Ga0495662_0006322_1283_2002 215
434 3300046477 Ga0495664_0000107 Ga0495664_0000107_40159_40878 215
435 3300046511 Ga0495608_0000006 Ga0495608_0000006_254730_255449 215
436 3300046514 Ga0495618_0000057 Ga0495618_0000057_20305_21024 215
437 3300046516 Ga0495628_0000077 Ga0495628_0000077_543_1262 215
438 3300046517 Ga0495630_0001707 Ga0495630_0001707_11124_11843 215
439 3300046529 Ga0495652_0000005 Ga0495652_0000005_483485_484204 215
440 3300046533 Ga0495640_0000007 Ga0495640_0000007_202447_203166 215
441 3300046536 Ga0495587_0000043 Ga0495587_0000043_40088_40807 215
442 3300046543 Ga0495645_0000275 Ga0495645_0000275_543_1262 215
443 3300046559 Ga0495667_0000023 Ga0495667_0000023_21755_22474 215
444 3300046642 Ga0495634_0000049 Ga0495634_0000049_35421_36140 215
445 3300046663 Ga0495635_0000021 Ga0495635_0000021_68891_69610 215
446 3300046675 Ga0495657_0000063 Ga0495657_0000063_53510_54229 215
447 3300046678 Ga0495599_0000001 Ga0495599_0000001_62075_62794 215
448 3300046679 Ga0495623_0000056 Ga0495623_0000056_6394_7113 215
449 3300046680 Ga0495646_0000007 Ga0495646_0000007_173926_174645 215
450 3300046683 Ga0495658_0010076 Ga0495658_0010076_2039_2758 215
451 3300046689 Ga0495613_0056629 Ga0495613_0056629_1272_1991 215
452 3300046809 Ga0495600_0000047 Ga0495600_0000047_64464_65183 215
453 3300047317 Ga0495604_0000014 Ga0495604_0000014_164596_165315 215
454 3300047319 Ga0495674_0000014 Ga0495674_0000014_75925_76644 215
455 3300047322 Ga0495680_0000744 Ga0495680_0000744_11690_12409 215
456 3300047444 Ga0495675_0000940 Ga0495675_0000940_10512_11231 215
457 3300047471 Ga0495684_0000272 Ga0495684_0000272_40133_40852 215
458 3300047673 Ga0495593_0103367 Ga0495593_0103367_522_1241 215
459 3300048088 Ga0495602_0000017 Ga0495602_0000017_36531_37250 215
460 3300048924 Ga0496121_0013808 Ga0496121_0013808_5451_6152 215
461 3300049580 Ga0501046_0106012 Ga0501046_0106012_544_1245 215
462 3300049581 Ga0501047_0104900 Ga0501047_0104900_1099_1800 215
463 3300049589 Ga0501073_0179107 Ga0501073_0179107_300_1001 215
464 3300049744 Ga0501083_0045918 Ga0501083_0045918_1393_2094 215
465 3300050489 nmdc:mga03683_38150_c1 nmdc:mga03683_38150_c1_212_919 215
466 3300050491 nmdc:mga00v17_6527_c1 nmdc:mga00v17_6527_c1_2275_2982 215
467 3300050492 nmdc:mga0yw44_54033_c1 nmdc:mga0yw44_54033_c1_1368_2075 215
468 3300050494 nmdc:mga06z11_10355_c1 nmdc:mga06z11_10355_c1_1368_2075 215
469 3300053077 Ga0495601_0000016 Ga0495601_0000016_36531_37250 215
470 3300053078 Ga0495612_0000035 Ga0495612_0000035_6376_7095 215
471 3300053084 Ga0495595_0000032 Ga0495595_0000032_30775_31494 215
472 3300053085 Ga0495619_0000033 Ga0495619_0000033_62253_62972 215
473 3300053139 Ga0500568_0016163 Ga0500568_0016163_85_786 215
474 3300054114 Ga0501084_0839377 Ga0501084_0839377_32_733 215
475 2162886011 MRS1b_contig_1777220 MRS1b_0330.00002430 216
476 3300005329 Ga0070683_100280050 Ga0070683_1002800501 216
477 3300005330 Ga0070690_100002154 Ga0070690_1000021542 216
478 3300005331 Ga0070670_100012748 Ga0070670_1000127483 216
479 3300005335 Ga0070666_10002154 Ga0070666_100021544 216
480 3300005338 Ga0068868_100006389 Ga0068868_1000063893 216
481 3300005344 Ga0070661_100001122 Ga0070661_1000011229 216
482 3300005344 Ga0070661_100054868 Ga0070661_1000548683 216
483 3300005353 Ga0070669_100057936 Ga0070669_1000579363 216
484 3300005354 Ga0070675_100061708 Ga0070675_1000617083 216
485 3300005364 Ga0070673_100048139 Ga0070673_1000481393 216
486 3300005367 Ga0070667_100004657 Ga0070667_1000046573 216
487 3300005466 Ga0070685_10111453 Ga0070685_101114532 216
488 3300005535 Ga0070684_100246867 Ga0070684_1002468672 216
489 3300005543 Ga0070672_100000725 Ga0070672_1000007252 216
490 3300005543 Ga0070672_100642132 Ga0070672_1006421321 216
491 3300005544 Ga0070686_100118636 Ga0070686_1001186361 216
492 3300005564 Ga0070664_100000389 Ga0070664_1000003893 216
493 3300005617 Ga0068859_100574357 Ga0068859_1005743572 216
494 3300005618 Ga0068864_100011436 Ga0068864_1000114367 216
495 3300005841 Ga0068863_100010409 Ga0068863_1000104095 216
496 3300005842 Ga0068858_100057939 Ga0068858_1000579392 216
497 3300005843 Ga0068860_100099908 Ga0068860_1000999082 216
498 3300006237 Ga0097621_100475251 Ga0097621_1004752511 216
499 3300006237 Ga0097621_100887635 Ga0097621_1008876351 216
500 3300006358 Ga0068871_100978791 Ga0068871_1009787911 216
501 3300006931 Ga0097620_100574356 Ga0097620_1005743562 216
502 3300009174 Ga0105241_10120372 Ga0105241_101203722 216
503 3300009177 Ga0105248_10474009 Ga0105248_104740091 216
504 3300013296 Ga0157374_10114159 Ga0157374_101141592 216
505 3300013306 Ga0163162_10097868 Ga0163162_100978683 216
506 3300013306 Ga0163162_10269401 Ga0163162_102694012 216
507 3300013308 Ga0157375_10000631 Ga0157375_1000063116 216
508 3300014325 Ga0163163_10005157 Ga0163163_100051578 216
509 3300014325 Ga0163163_10069266 Ga0163163_100692662 216
510 3300014745 Ga0157377_10234060 Ga0157377_102340602 216
511 3300014968 Ga0157379_10446658 Ga0157379_104466582 216
512 3300014969 Ga0157376_10291159 Ga0157376_102911592 216
513 3300017792 Ga0163161_10116256 Ga0163161_101162562 216
514 3300025909 Ga0207705_10359277 Ga0207705_103592772 216
515 3300025920 Ga0207649_10000284 Ga0207649_1000028427 216
516 3300025925 Ga0207650_10002280 Ga0207650_100022807 216
517 3300025926 Ga0207659_10211222 Ga0207659_102112222 216
518 3300025933 Ga0207706_10049972 Ga0207706_100499724 216
519 3300025934 Ga0207686_10252160 Ga0207686_102521602 216
520 3300025935 Ga0207709_10244619 Ga0207709_102446192 216
521 3300025940 Ga0207691_10003915 Ga0207691_1000391510 216
522 3300025940 Ga0207691_10125097 Ga0207691_101250973 216
523 3300025941 Ga0207711_10257141 Ga0207711_102571412 216
524 3300025960 Ga0207651_10029706 Ga0207651_100297062 216
525 3300025972 Ga0207668_10086882 Ga0207668_100868822 216
526 3300025986 Ga0207658_10034454 Ga0207658_100344543 216
527 3300026023 Ga0207677_10020674 Ga0207677_100206743 216
528 3300026035 Ga0207703_10013371 Ga0207703_100133716 216
529 3300026035 Ga0207703_10072398 Ga0207703_100723982 216
530 3300026088 Ga0207641_10015952 Ga0207641_100159524 216
531 3300026088 Ga0207641_10039799 Ga0207641_100397993 216
532 3300026088 Ga0207641_10102875 Ga0207641_101028752 216
533 3300026095 Ga0207676_10005705 Ga0207676_100057053 216
534 3300026095 Ga0207676_10257604 Ga0207676_102576042 216
535 3300028381 Ga0268264_10117934 Ga0268264_101179343 216
536 3300031250 Ga0265331_10000002 Ga0265331_10000002464 216
537 3300031250 Ga0265331_10028117 Ga0265331_100281173 216
538 3300031251 Ga0265327_10000074 Ga0265327_100000743 216
539 3300031711 Ga0265314_10008922 Ga0265314_100089229 216
540 3300031711 Ga0265314_10055700 Ga0265314_100557003 216
541 3300035113 Ga0373936_0059557 Ga0373936_0059557_374_1141 216
542 3300035172 Ga0373955_0275809 Ga0373955_0275809_43_750 216
543 3300046459 Ga0495629_0146456 Ga0495629_0146456_919_1626 216
544 3300046476 Ga0495662_0094223 Ga0495662_0094223_302_1009 216
545 3300046514 Ga0495618_0191810 Ga0495618_0191810_129_836 216
546 3300046535 Ga0495586_0034542 Ga0495586_0034542_1487_2194 216
547 3300046642 Ga0495634_0166062 Ga0495634_0166062_55_762 216
548 3300046678 Ga0495599_0167828 Ga0495599_0167828_209_916 216
549 3300046689 Ga0495613_0414465 Ga0495613_0414465_196_903 216
550 3300047319 Ga0495674_0004659 Ga0495674_0004659_10346_11053 216
551 3300049570 Ga0501033_0250107 Ga0501033_0250107_52_771 216
552 3300049572 Ga0501036_0056776 Ga0501036_0056776_516_1235 216
553 3300049573 Ga0501037_0148839 Ga0501037_0148839_393_1112 216
554 3300049574 Ga0501038_0053727 Ga0501038_0053727_409_1128 216
555 3300049575 Ga0501039_0315619 Ga0501039_0315619_306_1025 216
556 3300049580 Ga0501046_0035056 Ga0501046_0035056_1753_2490 216
557 3300049581 Ga0501047_0058799 Ga0501047_0058799_2479_3198 216
558 3300049586 Ga0501070_0573833 Ga0501070_0573833_29_742 216
559 3300049589 Ga0501073_0076247 Ga0501073_0076247_947_1666 216
560 3300049742 Ga0501080_0020036 Ga0501080_0020036_3178_3897 216
561 3300049823 Ga0501044_0240000 Ga0501044_0240000_955_1674 216
562 3300053085 Ga0495619_0123350 Ga0495619_0123350_249_956 216
563 3300060353 Ga0501082_0658814 Ga0501082_0658814_37_756 216
564 iso_pu_bacteria 2842922631 2842924198 216
565 3300005435 Ga0070714_100007079 Ga0070714_1000070792 218
566 3300005356 Ga0070674_100330084 Ga0070674_1003300841 219
567 3300006847 Ga0075431_100313322 Ga0075431_1003133221 219
568 3300006847 Ga0075431_100375018 Ga0075431_1003750182 219
569 3300006871 Ga0075434_100661159 Ga0075434_1006611592 219
570 3300025937 Ga0207669_10299773 Ga0207669_102997732 219
571 3300050510 nmdc:mga06r32_718631_c1 nmdc:mga06r32_718631_c1_217_936 219
572 3300003322 rootL2_10084468 rootL2_100844682 220
573 3300038705 Ga0237819_00130 Ga0237819_00130_16621_17307 223
574 2162886007 SwRhRL2b_contig_3207873 SwRhRL2b_0996.00002370 224
575 3300005289 Ga0065704_10070205 Ga0065704_1007020538 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

70

224

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9504 50 203
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9481 48 198
7e43-assembly1.cif.gz_B structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9431 48 198
5fa9-assembly1.cif.gz_A bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola 0.9413 48 200
3bqf-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) 0.9394 47 200
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9426 50 196 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9378 46 200 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.924 50 196 3.30.1060.10
af_A4HTE0_2_175_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.917 47 200 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9164 38 196 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A4Q5W4M2-F1-model_v4 deleted 0.9951 52 224
AF-A0A0Q6KCK6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9943 37 223 GO:0008113
GO:0033744
GO:0036211
AF-A0A529Y1Q5-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9907 74 224 GO:0008113
GO:0033744
AF-A0A531KWY7-F1-model_v4 deleted 0.9903 42 224
AF-A0A2R7T6Q3-F1-model_v4 deleted 0.9901 107 224

Feature Viewer

pLDDT pTM Quality
88.02 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map