F465417
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 575 | 404 | 487 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0059557|Ga0373936_0059557_374_1141 |
| Length | 255 |
| Sequence | LRASNVVPTVDQEGPPMPSKNAYTAVSAAVVVAALAAAFWTLPGRSAERATLVPAPAVDAPAATGDETQTAVLAGGCFWGVQAVFQHVNGVTRVVSGYSGGSKETAQYQVVSSGRTGHAEAVEIKFDPKQISYGRILQIYFSVAHDPTQLNRQGPDDGTQYRSAIFYSDAAQQKVAQAYIAQLDKAGVFKSPVVTQVGQLAAFYPAEAYHQDYATIHPNNPYIVYNDAPKVENLKQLFPDVYRDKPVLVTAAKGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 4 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 5 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 6 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 7 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 8 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 9 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 10 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 11 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 12 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 13 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 14 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 15 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 16 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 17 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 18 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 19 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 20 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 21 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 22 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 23 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 24 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 25 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 26 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 27 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 28 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 29 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 30 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 31 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 32 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 33 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 34 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 35 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 36 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 37 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 38 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 39 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 40 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 41 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 42 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 43 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 44 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 45 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 46 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 47 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 48 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 49 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 50 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 51 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 52 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 53 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 54 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 55 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 56 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 57 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 58 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 59 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 60 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 61 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 62 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 63 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 64 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 65 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 66 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 67 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 68 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 69 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 70 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 71 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 72 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 73 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 74 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 75 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 76 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 77 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 78 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 79 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 80 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 81 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 82 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 83 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 90 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 93 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 116 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 131 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 133 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 134 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 167 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 172 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 263 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 264 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 265 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 266 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 267 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 268 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 269 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 270 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 323 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 380 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 381 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 382 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 391 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 392 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 393 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 394 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 395 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 396 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 397 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 398 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 399 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 400 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 401 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 402 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 403 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 404 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.96 |
| Metatranscriptomes | 1.74 |
| Isolates | 15.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.96 |
| Nodule | 13.91 |
| Rhizoplane | 2.61 |
| Rhizosphere | 70.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3207873 | 2162886007 | Bacteria | 73231 |
| 2 | MRS1b_contig_1777220 | 2162886011 | Bacteria | 821 |
| 3 | JGI24739J22299_10013673 | 3300001989 | Bacteria | 2958 |
| 4 | JGI24737J22298_10010536 | 3300001990 | Bacteria | 3049 |
| 5 | JGI24735J21928_10018499 | 3300002067 | Bacteria | 2147 |
| 6 | JGI25156J39149_1011524 | 3300002705 | Bacteria | 1993 |
| 7 | JGI25157J39369_1002286 | 3300002741 | Bacteria | 5070 |
| 8 | rootL2_10084468 | 3300003322 | Bacteria | 3921 |
| 9 | Ga0055525_1000242 | 3300003759 | Bacteria | 55608 |
| 10 | Ga0055527_1000063 | 3300003760 | Bacteria | 89044 |
| 11 | Ga0055535_1000406 | 3300003761 | Bacteria | 40592 |
| 12 | Ga0055542_1000146 | 3300003762 | Bacteria | 88772 |
| 13 | Ga0055542_1003953 | 3300003762 | Bacteria | 3783 |
| 14 | Ga0055529_1000597 | 3300003763 | Bacteria | 28068 |
| 15 | Ga0065704_10070205 | 3300005289 | Bacteria | 83747 |
| 16 | Ga0070683_100280050 | 3300005329 | Unclassified | 1586 |
| 17 | Ga0070690_100002154 | 3300005330 | Bacteria | 10509 |
| 18 | Ga0070670_100012748 | 3300005331 | Bacteria | 7195 |
| 19 | Ga0070666_10002154 | 3300005335 | Bacteria | 11964 |
| 20 | Ga0068868_100006389 | 3300005338 | Bacteria | 8338 |
| 21 | Ga0070661_100001122 | 3300005344 | Bacteria | 18807 |
| 22 | Ga0070661_100054868 | 3300005344 | Bacteria | 2919 |
| 23 | Ga0070661_100325400 | 3300005344 | Bacteria | 1201 |
| 24 | Ga0070669_100057936 | 3300005353 | Bacteria | 2843 |
| 25 | Ga0070675_100061708 | 3300005354 | Bacteria | 3096 |
| 26 | Ga0070674_100330084 | 3300005356 | Bacteria | 1226 |
| 27 | Ga0070673_100048139 | 3300005364 | Bacteria | 3322 |
| 28 | Ga0070667_100004657 | 3300005367 | Bacteria | 11509 |
| 29 | Ga0070667_100006083 | 3300005367 | Bacteria | 10020 |
| 30 | Ga0070714_100007079 | 3300005435 | Bacteria | 8699 |
| 31 | Ga0070711_100549780 | 3300005439 | Bacteria | 958 |
| 32 | Ga0070663_100225720 | 3300005455 | Bacteria | 1472 |
| 33 | Ga0070681_10052179 | 3300005458 | Bacteria | 4078 |
| 34 | Ga0070681_10521562 | 3300005458 | Bacteria | 1101 |
| 35 | Ga0070685_10111453 | 3300005466 | Bacteria | 1686 |
| 36 | Ga0070685_10186175 | 3300005466 | Bacteria | 1340 |
| 37 | Ga0070679_100060786 | 3300005530 | Bacteria | 3765 |
| 38 | Ga0070684_100108465 | 3300005535 | Unclassified | 2487 |
| 39 | Ga0070684_100246867 | 3300005535 | Bacteria | 1631 |
| 40 | Ga0068853_100001404 | 3300005539 | Bacteria | 17389 |
| 41 | Ga0068853_100128191 | 3300005539 | Bacteria | 2268 |
| 42 | Ga0070672_100000725 | 3300005543 | Bacteria | 19533 |
| 43 | Ga0070672_100642132 | 3300005543 | Bacteria | 927 |
| 44 | Ga0070686_100118636 | 3300005544 | Unclassified | 1813 |
| 45 | Ga0070696_100166275 | 3300005546 | Bacteria | 1628 |
| 46 | Ga0070693_100303887 | 3300005547 | Unclassified | 1076 |
| 47 | Ga0070665_100315654 | 3300005548 | Bacteria | 1567 |
| 48 | Ga0068855_100001490 | 3300005563 | Bacteria | 29300 |
| 49 | Ga0068855_100029771 | 3300005563 | Bacteria | 6528 |
| 50 | Ga0070664_100000389 | 3300005564 | Bacteria | 32754 |
| 51 | Ga0070664_100353441 | 3300005564 | Unclassified | 1337 |
| 52 | Ga0068857_100025418 | 3300005577 | Bacteria | 5214 |
| 53 | Ga0068857_100063398 | 3300005577 | Bacteria | 3285 |
| 54 | Ga0068854_100020296 | 3300005578 | Bacteria | 4493 |
| 55 | Ga0068856_100000065 | 3300005614 | Bacteria | 98683 |
| 56 | Ga0068856_100044653 | 3300005614 | Bacteria | 4362 |
| 57 | Ga0068852_100005382 | 3300005616 | Bacteria | 9151 |
| 58 | Ga0068859_100574357 | 3300005617 | Unclassified | 1221 |
| 59 | Ga0068864_100011436 | 3300005618 | Bacteria | 7331 |
| 60 | Ga0068851_10001310 | 3300005834 | Bacteria | 10842 |
| 61 | Ga0068863_100010409 | 3300005841 | Bacteria | 9040 |
| 62 | Ga0068858_100057939 | 3300005842 | Bacteria | 3580 |
| 63 | Ga0068858_100229374 | 3300005842 | Bacteria | 1760 |
| 64 | Ga0068860_100099908 | 3300005843 | Bacteria | 2768 |
| 65 | Ga0068862_100059198 | 3300005844 | Bacteria | 3289 |
| 66 | Ga0081455_10094677 | 3300005937 | Bacteria | 2412 |
| 67 | Ga0075363_100004002 | 3300006048 | Bacteria | 6374 |
| 68 | Ga0075363_100013704 | 3300006048 | Bacteria | 3942 |
| 69 | Ga0075364_10015693 | 3300006051 | Bacteria | 4701 |
| 70 | Ga0075362_10004567 | 3300006177 | Bacteria | 4989 |
| 71 | Ga0075367_10007643 | 3300006178 | Bacteria | 5552 |
| 72 | Ga0075369_10011734 | 3300006186 | Bacteria | 3451 |
| 73 | Ga0097621_100000908 | 3300006237 | Bacteria | 20694 |
| 74 | Ga0097621_100475251 | 3300006237 | Bacteria | 1129 |
| 75 | Ga0097621_100887635 | 3300006237 | Bacteria | 830 |
| 76 | Ga0068871_100978791 | 3300006358 | Bacteria | 787 |
| 77 | Ga0075431_100313322 | 3300006847 | Bacteria | 1583 |
| 78 | Ga0075431_100375018 | 3300006847 | Bacteria | 1427 |
| 79 | Ga0075434_100661159 | 3300006871 | Bacteria | 1063 |
| 80 | Ga0097620_100574356 | 3300006931 | Unclassified | 1221 |
| 81 | Ga0099794_10205016 | 3300007265 | Bacteria | 1010 |
| 82 | Ga0105240_10007943 | 3300009093 | Bacteria | 15308 |
| 83 | Ga0105240_10068422 | 3300009093 | Bacteria | 4397 |
| 84 | Ga0105240_10072658 | 3300009093 | Bacteria | 4251 |
| 85 | Ga0105245_10081796 | 3300009098 | Bacteria | 2953 |
| 86 | Ga0105241_10072294 | 3300009174 | Unclassified | 2680 |
| 87 | Ga0105241_10120372 | 3300009174 | Bacteria | 2113 |
| 88 | Ga0105241_10255371 | 3300009174 | Unclassified | 1488 |
| 89 | Ga0105242_10220099 | 3300009176 | Bacteria | 1696 |
| 90 | Ga0105248_10474009 | 3300009177 | Unclassified | 1411 |
| 91 | Ga0105237_10169818 | 3300009545 | Bacteria | 2181 |
| 92 | Ga0105238_10001064 | 3300009551 | Bacteria | 27700 |
| 93 | Ga0105238_10009489 | 3300009551 | Bacteria | 9738 |
| 94 | Ga0105238_10046958 | 3300009551 | Bacteria | 4355 |
| 95 | Ga0105238_11035137 | 3300009551 | Bacteria | 842 |
| 96 | Ga0105249_10835679 | 3300009553 | Bacteria | 986 |
| 97 | Ga0099796_10021181 | 3300010159 | Bacteria | 1998 |
| 98 | Ga0105239_10010423 | 3300010375 | Bacteria | 10394 |
| 99 | Ga0105239_10047705 | 3300010375 | Bacteria | 4694 |
| 100 | Ga0105239_10342656 | 3300010375 | Bacteria | 1687 |
| 101 | Ga0105246_10182725 | 3300011119 | Bacteria | 1616 |
| 102 | Ga0157371_10097588 | 3300013102 | Bacteria | 2083 |
| 103 | Ga0157370_10139839 | 3300013104 | Bacteria | 2256 |
| 104 | Ga0157369_10000264 | 3300013105 | Bacteria | 70855 |
| 105 | Ga0157374_10000496 | 3300013296 | Bacteria | 35685 |
| 106 | Ga0157374_10114159 | 3300013296 | Bacteria | 2600 |
| 107 | Ga0157378_10011036 | 3300013297 | Bacteria | 7907 |
| 108 | Ga0157378_11049154 | 3300013297 | Bacteria | 851 |
| 109 | Ga0163162_10097868 | 3300013306 | Bacteria | 3023 |
| 110 | Ga0163162_10269401 | 3300013306 | Bacteria | 1834 |
| 111 | Ga0157372_10001696 | 3300013307 | Bacteria | 23852 |
| 112 | Ga0157372_10223501 | 3300013307 | Bacteria | 2183 |
| 113 | Ga0157375_10000631 | 3300013308 | Bacteria | 31289 |
| 114 | Ga0157375_10126084 | 3300013308 | Bacteria | 2675 |
| 115 | Ga0163163_10005157 | 3300014325 | Bacteria | 11266 |
| 116 | Ga0163163_10069266 | 3300014325 | Bacteria | 3512 |
| 117 | Ga0157380_10373996 | 3300014326 | Bacteria | 1342 |
| 118 | Ga0157377_10234060 | 3300014745 | Unclassified | 1183 |
| 119 | Ga0157379_10446658 | 3300014968 | Bacteria | 1193 |
| 120 | Ga0157376_10066812 | 3300014969 | Unclassified | 3040 |
| 121 | Ga0157376_10291159 | 3300014969 | Bacteria | 1542 |
| 122 | Ga0183363_1151 | 3300015690 | Bacteria | 17315 |
| 123 | Ga0163161_10116256 | 3300017792 | Bacteria | 2005 |
| 124 | Ga0197907_10371358 | 3300020069 | Bacteria | 810 |
| 125 | Ga0197907_11490845 | 3300020069 | Bacteria | 1068 |
| 126 | Ga0206356_11908769 | 3300020070 | Bacteria | 890 |
| 127 | Ga0206349_1819953 | 3300020075 | Bacteria | 1116 |
| 128 | Ga0206355_1330646 | 3300020076 | Bacteria | 1225 |
| 129 | Ga0206352_10323814 | 3300020078 | Bacteria | 771 |
| 130 | Ga0206350_10769023 | 3300020080 | Bacteria | 972 |
| 131 | Ga0206353_10866523 | 3300020082 | Bacteria | 1292 |
| 132 | Ga0206353_11323159 | 3300020082 | Bacteria | 966 |
| 133 | Ga0213872_10148801 | 3300021361 | Bacteria | 1024 |
| 134 | Ga0213874_10035085 | 3300021377 | Bacteria | 1472 |
| 135 | Ga0224712_10015693 | 3300022467 | Unclassified | 2470 |
| 136 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 137 | Ga0209672_102534 | 3300025228 | Bacteria | 4398 |
| 138 | Ga0209563_100071 | 3300025230 | Bacteria | 232653 |
| 139 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 140 | Ga0209258_100758 | 3300025242 | Bacteria | 20275 |
| 141 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 142 | Ga0209148_1003930 | 3300025254 | Bacteria | 3835 |
| 143 | Ga0209759_1000166 | 3300025256 | Bacteria | 113080 |
| 144 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 145 | Ga0209758_1002527 | 3300025297 | Bacteria | 18490 |
| 146 | Ga0207656_10005726 | 3300025321 | Bacteria | 4417 |
| 147 | Ga0207692_10242719 | 3300025898 | Bacteria | 1076 |
| 148 | Ga0207647_10020459 | 3300025904 | Bacteria | 4438 |
| 149 | Ga0207705_10359277 | 3300025909 | Bacteria | 1123 |
| 150 | Ga0207684_10222483 | 3300025910 | Bacteria | 1629 |
| 151 | Ga0207654_10000806 | 3300025911 | Bacteria | 17257 |
| 152 | Ga0207654_10041276 | 3300025911 | Unclassified | 2604 |
| 153 | Ga0207707_10301952 | 3300025912 | Bacteria | 1384 |
| 154 | Ga0207707_10475934 | 3300025912 | Bacteria | 1067 |
| 155 | Ga0207695_10003805 | 3300025913 | Bacteria | 20923 |
| 156 | Ga0207695_10058711 | 3300025913 | Bacteria | 3993 |
| 157 | Ga0207671_10108228 | 3300025914 | Bacteria | 2112 |
| 158 | Ga0207671_10194907 | 3300025914 | Bacteria | 1581 |
| 159 | Ga0207663_10364322 | 3300025916 | Bacteria | 1097 |
| 160 | Ga0207660_10268303 | 3300025917 | Unclassified | 1351 |
| 161 | Ga0207649_10000284 | 3300025920 | Bacteria | 39562 |
| 162 | Ga0207652_10016468 | 3300025921 | Bacteria | 6037 |
| 163 | Ga0207652_10139955 | 3300025921 | Bacteria | 2163 |
| 164 | Ga0207694_10000273 | 3300025924 | Bacteria | 49024 |
| 165 | Ga0207650_10002280 | 3300025925 | Bacteria | 13385 |
| 166 | Ga0207659_10211222 | 3300025926 | Bacteria | 1555 |
| 167 | Ga0207687_10100122 | 3300025927 | Bacteria | 2131 |
| 168 | Ga0207687_10101557 | 3300025927 | Bacteria | 2117 |
| 169 | Ga0207706_10049972 | 3300025933 | Bacteria | 3695 |
| 170 | Ga0207686_10252160 | 3300025934 | Bacteria | 1290 |
| 171 | Ga0207709_10244619 | 3300025935 | Bacteria | 1307 |
| 172 | Ga0207669_10299773 | 3300025937 | Bacteria | 1221 |
| 173 | Ga0207665_10070163 | 3300025939 | Bacteria | 2390 |
| 174 | Ga0207691_10003915 | 3300025940 | Bacteria | 14465 |
| 175 | Ga0207691_10125097 | 3300025940 | Bacteria | 2275 |
| 176 | Ga0207711_10257141 | 3300025941 | Unclassified | 1604 |
| 177 | Ga0207661_10413688 | 3300025944 | Bacteria | 1224 |
| 178 | Ga0207667_10000413 | 3300025949 | Bacteria | 57875 |
| 179 | Ga0207667_10010297 | 3300025949 | Bacteria | 10943 |
| 180 | Ga0207667_10230187 | 3300025949 | Bacteria | 1898 |
| 181 | Ga0207651_10029706 | 3300025960 | Bacteria | 3468 |
| 182 | Ga0207668_10086882 | 3300025972 | Bacteria | 2286 |
| 183 | Ga0207640_10044828 | 3300025981 | Bacteria | 2836 |
| 184 | Ga0207640_10107714 | 3300025981 | Bacteria | 1968 |
| 185 | Ga0207658_10020977 | 3300025986 | Bacteria | 4529 |
| 186 | Ga0207658_10034454 | 3300025986 | Bacteria | 3619 |
| 187 | Ga0207677_10020674 | 3300026023 | Bacteria | 4002 |
| 188 | Ga0207703_10013371 | 3300026035 | Bacteria | 6396 |
| 189 | Ga0207703_10072398 | 3300026035 | Bacteria | 2849 |
| 190 | Ga0207703_10089031 | 3300026035 | Bacteria | 2592 |
| 191 | Ga0207639_10005178 | 3300026041 | Bacteria | 8797 |
| 192 | Ga0207639_10024836 | 3300026041 | Bacteria | 4342 |
| 193 | Ga0207678_10406388 | 3300026067 | Bacteria | 1179 |
| 194 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 195 | Ga0207702_10000209 | 3300026078 | Bacteria | 69358 |
| 196 | Ga0207702_10067303 | 3300026078 | Bacteria | 3074 |
| 197 | Ga0207702_10716038 | 3300026078 | Bacteria | 987 |
| 198 | Ga0207641_10015952 | 3300026088 | Bacteria | 6151 |
| 199 | Ga0207641_10039799 | 3300026088 | Bacteria | 3933 |
| 200 | Ga0207641_10102875 | 3300026088 | Bacteria | 2519 |
| 201 | Ga0207676_10005705 | 3300026095 | Bacteria | 8810 |
| 202 | Ga0207676_10257604 | 3300026095 | Bacteria | 1573 |
| 203 | Ga0207674_10007519 | 3300026116 | Bacteria | 12702 |
| 204 | Ga0207674_10073263 | 3300026116 | Bacteria | 3438 |
| 205 | Ga0207675_100235392 | 3300026118 | Bacteria | 1768 |
| 206 | Ga0207675_100644600 | 3300026118 | Bacteria | 1065 |
| 207 | Ga0207698_10097751 | 3300026142 | Unclassified | 2424 |
| 208 | Ga0207698_10137713 | 3300026142 | Bacteria | 2097 |
| 209 | Ga0209179_1013762 | 3300027512 | Bacteria | 1475 |
| 210 | Ga0268265_10044953 | 3300028380 | Bacteria | 3292 |
| 211 | Ga0268264_10117934 | 3300028381 | Bacteria | 2335 |
| 212 | Ga0268264_10260651 | 3300028381 | Bacteria | 1615 |
| 213 | Ga0265334_10000033 | 3300028573 | Bacteria | 106132 |
| 214 | Ga0265330_10028027 | 3300031235 | Bacteria | 2541 |
| 215 | Ga0265332_10008046 | 3300031238 | Bacteria | 4746 |
| 216 | Ga0265325_10001741 | 3300031241 | Bacteria | 15096 |
| 217 | Ga0265329_10010776 | 3300031242 | Bacteria | 3345 |
| 218 | Ga0265340_10006067 | 3300031247 | Bacteria | 6663 |
| 219 | Ga0265340_10044431 | 3300031247 | Bacteria | 2173 |
| 220 | Ga0265339_10001424 | 3300031249 | Bacteria | 17734 |
| 221 | Ga0265331_10000002 | 3300031250 | Bacteria | 511481 |
| 222 | Ga0265331_10028117 | 3300031250 | Bacteria | 2813 |
| 223 | Ga0265331_10047000 | 3300031250 | Bacteria | 2079 |
| 224 | Ga0265331_10068403 | 3300031250 | Bacteria | 1665 |
| 225 | Ga0265331_10128618 | 3300031250 | Bacteria | 1156 |
| 226 | Ga0265327_10000074 | 3300031251 | Bacteria | 214435 |
| 227 | Ga0265316_10010203 | 3300031344 | Bacteria | 8577 |
| 228 | Ga0265314_10001465 | 3300031711 | Bacteria | 26322 |
| 229 | Ga0265314_10008922 | 3300031711 | Bacteria | 8543 |
| 230 | Ga0265314_10015545 | 3300031711 | Bacteria | 6038 |
| 231 | Ga0265314_10055700 | 3300031711 | Bacteria | 2727 |
| 232 | Ga0265314_10063383 | 3300031711 | Bacteria | 2508 |
| 233 | Ga0265314_10065678 | 3300031711 | Bacteria | 2450 |
| 234 | Ga0265314_10156494 | 3300031711 | Bacteria | 1391 |
| 235 | Ga0265314_10234126 | 3300031711 | Bacteria | 1063 |
| 236 | Ga0265342_10004642 | 3300031712 | Bacteria | 10696 |
| 237 | Ga0265342_10023159 | 3300031712 | Bacteria | 3935 |
| 238 | Ga0307516_10004445 | 3300031730 | Bacteria | 17289 |
| 239 | Ga0373934_0025045 | 3300035086 | Bacteria | 2309 |
| 240 | Ga0373923_0005091 | 3300035111 | Bacteria | 4435 |
| 241 | Ga0373936_0059557 | 3300035113 | Bacteria | 1557 |
| 242 | Ga0373945_0013035 | 3300035116 | Bacteria | 2769 |
| 243 | Ga0373953_0001606 | 3300035117 | Bacteria | 6611 |
| 244 | Ga0373954_0039304 | 3300035118 | Bacteria | 2202 |
| 245 | Ga0373956_0007284 | 3300035119 | Bacteria | 4455 |
| 246 | Ga0373957_0103545 | 3300035120 | Bacteria | 1141 |
| 247 | Ga0373943_0003490 | 3300035170 | Bacteria | 7160 |
| 248 | Ga0373946_0004458 | 3300035171 | Bacteria | 5016 |
| 249 | Ga0373955_0000346 | 3300035172 | Bacteria | 19457 |
| 250 | Ga0373955_0275809 | 3300035172 | Bacteria | 1011 |
| 251 | Ga0373924_0001455 | 3300035410 | Bacteria | 7697 |
| 252 | Ga0373935_0000056 | 3300035692 | Bacteria | 46025 |
| 253 | Ga0373927_0033737 | 3300035695 | Bacteria | 3331 |
| 254 | Ga0373933_0004205 | 3300035724 | Bacteria | 7938 |
| 255 | Ga0373947_0004488 | 3300035725 | Bacteria | 8191 |
| 256 | Ga0373937_0000075 | 3300036401 | Bacteria | 89727 |
| 257 | Ga0373937_0351196 | 3300036401 | Bacteria | 1397 |
| 258 | Ga0373925_0000159 | 3300037068 | Bacteria | 72851 |
| 259 | Ga0395899_0008203 | 3300037312 | Bacteria | 8049 |
| 260 | Ga0395900_0162295 | 3300037418 | Bacteria | 2279 |
| 261 | Ga0395898_0000460 | 3300037466 | Bacteria | 81440 |
| 262 | Ga0436364_0596856 | 3300037853 | Bacteria | 1269 |
| 263 | Ga0237819_00130 | 3300038705 | Bacteria | 28324 |
| 264 | Ga0436360_0064513 | 3300039438 | Bacteria | 1763 |
| 265 | Ga0436361_0709744 | 3300039447 | Bacteria | 2515 |
| 266 | Ga0436363_0268886 | 3300039450 | Bacteria | 1233 |
| 267 | Ga0436363_1116204 | 3300039450 | Bacteria | 1422 |
| 268 | Ga0436363_1546557 | 3300039450 | Bacteria | 3434 |
| 269 | Ga0439461_0006955 | 3300041410 | Bacteria | 1987 |
| 270 | Ga0451833_0552563 | 3300041491 | Bacteria | 1206 |
| 271 | Ga0451835_0259487 | 3300041492 | Bacteria | 3322 |
| 272 | Ga0451837_0291003 | 3300041494 | Bacteria | 1120 |
| 273 | Ga0451839_1037019 | 3300041496 | Bacteria | 991 |
| 274 | Ga0451845_0815701 | 3300041501 | Bacteria | 1170 |
| 275 | Ga0451849_0008212 | 3300041505 | Bacteria | 1757 |
| 276 | Ga0451843_0322861 | 3300041509 | Bacteria | 2485 |
| 277 | Ga0451855_0762862 | 3300041511 | Bacteria | 2452 |
| 278 | Ga0451853_0670545 | 3300041512 | Bacteria | 820 |
| 279 | Ga0466969_0004995 | 3300044656 | Bacteria | 7063 |
| 280 | Ga0466966_0005052 | 3300044684 | Bacteria | 8671 |
| 281 | Ga0466961_0001260 | 3300044693 | Bacteria | 15613 |
| 282 | Ga0466961_0024959 | 3300044693 | Bacteria | 3846 |
| 283 | Ga0466961_0202667 | 3300044693 | Bacteria | 1226 |
| 284 | Ga0466970_0002513 | 3300044765 | Bacteria | 8841 |
| 285 | Ga0466970_0045572 | 3300044765 | Bacteria | 2335 |
| 286 | Ga0466957_0042584 | 3300044842 | Bacteria | 2748 |
| 287 | Ga0466959_0210400 | 3300045049 | Bacteria | 1351 |
| 288 | Ga0451576_0011229 | 3300045051 | Bacteria | 10202 |
| 289 | Ga0466958_0421763 | 3300045836 | Bacteria | 862 |
| 290 | Ga0495592_0000102 | 3300046454 | Bacteria | 75767 |
| 291 | Ga0495629_0146456 | 3300046459 | Bacteria | 1642 |
| 292 | Ga0495651_0001236 | 3300046462 | Bacteria | 19760 |
| 293 | Ga0495653_0000036 | 3300046463 | Bacteria | 129776 |
| 294 | Ga0495580_0325332 | 3300046472 | Bacteria | 1045 |
| 295 | Ga0495662_0006322 | 3300046476 | Bacteria | 5923 |
| 296 | Ga0495662_0094223 | 3300046476 | Bacteria | 1462 |
| 297 | Ga0495664_0000107 | 3300046477 | Bacteria | 41420 |
| 298 | Ga0495607_0053093 | 3300046501 | Bacteria | 2344 |
| 299 | Ga0495606_0010004 | 3300046507 | Bacteria | 7931 |
| 300 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 301 | Ga0495608_0080799 | 3300046511 | Bacteria | 2113 |
| 302 | Ga0495610_0020204 | 3300046512 | Bacteria | 3703 |
| 303 | Ga0495618_0000057 | 3300046514 | Bacteria | 80298 |
| 304 | Ga0495618_0191810 | 3300046514 | Bacteria | 1295 |
| 305 | Ga0495620_0027483 | 3300046515 | Bacteria | 2661 |
| 306 | Ga0495628_0000077 | 3300046516 | Bacteria | 77338 |
| 307 | Ga0495630_0001707 | 3300046517 | Bacteria | 15337 |
| 308 | Ga0495643_0010530 | 3300046522 | Bacteria | 5686 |
| 309 | Ga0495648_0074512 | 3300046524 | Bacteria | 1955 |
| 310 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 311 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 312 | Ga0495586_0034542 | 3300046535 | Bacteria | 2716 |
| 313 | Ga0495587_0000043 | 3300046536 | Bacteria | 109717 |
| 314 | Ga0495597_0018607 | 3300046542 | Bacteria | 3258 |
| 315 | Ga0495645_0000275 | 3300046543 | Bacteria | 37777 |
| 316 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 317 | Ga0495667_0000235 | 3300046559 | Bacteria | 36357 |
| 318 | Ga0495634_0000049 | 3300046642 | Bacteria | 95428 |
| 319 | Ga0495634_0166062 | 3300046642 | Bacteria | 1389 |
| 320 | Ga0495635_0000021 | 3300046663 | Bacteria | 164643 |
| 321 | Ga0495657_0000063 | 3300046675 | Bacteria | 94380 |
| 322 | Ga0495657_0001655 | 3300046675 | Bacteria | 19148 |
| 323 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 324 | Ga0495599_0167828 | 3300046678 | Bacteria | 1355 |
| 325 | Ga0495623_0000056 | 3300046679 | Bacteria | 69307 |
| 326 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 327 | Ga0495658_0010076 | 3300046683 | Bacteria | 4721 |
| 328 | Ga0495613_0056629 | 3300046689 | Bacteria | 2879 |
| 329 | Ga0495613_0414465 | 3300046689 | Unclassified | 917 |
| 330 | Ga0495600_0000047 | 3300046809 | Bacteria | 71546 |
| 331 | Ga0495600_0566138 | 3300046809 | Bacteria | 693 |
| 332 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 333 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 334 | Ga0495674_0004659 | 3300047319 | Bacteria | 13185 |
| 335 | Ga0495680_0000744 | 3300047322 | Bacteria | 36481 |
| 336 | Ga0495675_0000940 | 3300047444 | Bacteria | 17639 |
| 337 | Ga0495684_0000272 | 3300047471 | Bacteria | 41522 |
| 338 | Ga0495686_0009589 | 3300047472 | Bacteria | 6959 |
| 339 | Ga0495593_0103367 | 3300047673 | Bacteria | 1459 |
| 340 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 341 | Ga0495626_0079418 | 3300048091 | Bacteria | 1460 |
| 342 | Ga0496104_0156832 | 3300048907 | Bacteria | 2184 |
| 343 | Ga0496105_0405953 | 3300048908 | Bacteria | 1081 |
| 344 | Ga0496108_0022862 | 3300048911 | Bacteria | 5145 |
| 345 | Ga0496108_0055537 | 3300048911 | Bacteria | 3325 |
| 346 | Ga0496109_0020142 | 3300048912 | Bacteria | 5893 |
| 347 | Ga0496109_0052104 | 3300048912 | Bacteria | 3729 |
| 348 | Ga0496110_0038590 | 3300048913 | Bacteria | 4156 |
| 349 | Ga0496110_0048100 | 3300048913 | Bacteria | 3738 |
| 350 | Ga0496111_0058755 | 3300048914 | Bacteria | 2785 |
| 351 | Ga0496112_0006460 | 3300048915 | Bacteria | 10292 |
| 352 | Ga0496112_0014728 | 3300048915 | Bacteria | 7272 |
| 353 | Ga0496112_0082646 | 3300048915 | Bacteria | 3176 |
| 354 | Ga0496113_0034460 | 3300048916 | Bacteria | 3694 |
| 355 | Ga0496113_0034858 | 3300048916 | Bacteria | 3676 |
| 356 | Ga0496115_0159555 | 3300048918 | Bacteria | 1864 |
| 357 | Ga0496119_0089775 | 3300048922 | Bacteria | 1749 |
| 358 | Ga0496121_0012588 | 3300048924 | Bacteria | 9196 |
| 359 | Ga0496121_0013808 | 3300048924 | Bacteria | 8645 |
| 360 | Ga0496125_0000237 | 3300048928 | Bacteria | 113322 |
| 361 | Ga0496126_0191204 | 3300048929 | Bacteria | 1733 |
| 362 | Ga0496126_0282062 | 3300048929 | Bacteria | 1376 |
| 363 | Ga0501031_0017115 | 3300049568 | Bacteria | 4709 |
| 364 | Ga0501031_0038407 | 3300049568 | Bacteria | 3124 |
| 365 | Ga0501032_0008783 | 3300049569 | Bacteria | 7356 |
| 366 | Ga0501032_0048959 | 3300049569 | Bacteria | 2852 |
| 367 | Ga0501033_0001474 | 3300049570 | Bacteria | 20818 |
| 368 | Ga0501033_0004101 | 3300049570 | Bacteria | 11740 |
| 369 | Ga0501033_0053052 | 3300049570 | Bacteria | 3003 |
| 370 | Ga0501033_0157684 | 3300049570 | Bacteria | 1635 |
| 371 | Ga0501033_0250107 | 3300049570 | Unclassified | 1256 |
| 372 | Ga0501033_0282691 | 3300049570 | Bacteria | 1171 |
| 373 | Ga0501034_0011186 | 3300049571 | Bacteria | 9315 |
| 374 | Ga0501034_0027091 | 3300049571 | Bacteria | 5830 |
| 375 | Ga0501034_0036050 | 3300049571 | Bacteria | 5014 |
| 376 | Ga0501034_0050255 | 3300049571 | Bacteria | 4205 |
| 377 | Ga0501034_0437366 | 3300049571 | Bacteria | 1227 |
| 378 | Ga0501036_0011010 | 3300049572 | Bacteria | 7481 |
| 379 | Ga0501036_0030209 | 3300049572 | Bacteria | 4579 |
| 380 | Ga0501036_0056776 | 3300049572 | Bacteria | 3317 |
| 381 | Ga0501036_0116011 | 3300049572 | Bacteria | 2262 |
| 382 | Ga0501037_0024080 | 3300049573 | Bacteria | 4501 |
| 383 | Ga0501037_0052454 | 3300049573 | Bacteria | 2983 |
| 384 | Ga0501037_0148839 | 3300049573 | Unclassified | 1674 |
| 385 | Ga0501037_0151751 | 3300049573 | Bacteria | 1655 |
| 386 | Ga0501038_0006326 | 3300049574 | Bacteria | 10955 |
| 387 | Ga0501038_0031567 | 3300049574 | Bacteria | 4680 |
| 388 | Ga0501038_0053727 | 3300049574 | Unclassified | 3467 |
| 389 | Ga0501038_0081585 | 3300049574 | Bacteria | 2724 |
| 390 | Ga0501039_0004711 | 3300049575 | Bacteria | 10326 |
| 391 | Ga0501039_0107609 | 3300049575 | Bacteria | 2178 |
| 392 | Ga0501039_0315619 | 3300049575 | Unclassified | 1229 |
| 393 | Ga0501040_0003148 | 3300049576 | Bacteria | 10705 |
| 394 | Ga0501040_0006328 | 3300049576 | Bacteria | 7687 |
| 395 | Ga0501041_0002832 | 3300049577 | Bacteria | 9915 |
| 396 | Ga0501042_0007786 | 3300049578 | Bacteria | 7040 |
| 397 | Ga0501043_0010736 | 3300049579 | Bacteria | 7172 |
| 398 | Ga0501046_0000115 | 3300049580 | Bacteria | 84375 |
| 399 | Ga0501046_0000433 | 3300049580 | Bacteria | 41959 |
| 400 | Ga0501046_0035056 | 3300049580 | Bacteria | 4045 |
| 401 | Ga0501046_0041778 | 3300049580 | Bacteria | 3657 |
| 402 | Ga0501046_0106012 | 3300049580 | Bacteria | 2151 |
| 403 | Ga0501046_0191071 | 3300049580 | Bacteria | 1527 |
| 404 | Ga0501047_0004044 | 3300049581 | Bacteria | 13788 |
| 405 | Ga0501047_0014218 | 3300049581 | Bacteria | 7564 |
| 406 | Ga0501047_0058799 | 3300049581 | Bacteria | 3713 |
| 407 | Ga0501047_0091100 | 3300049581 | Bacteria | 2927 |
| 408 | Ga0501047_0104900 | 3300049581 | Bacteria | 2707 |
| 409 | Ga0501047_0165685 | 3300049581 | Bacteria | 2080 |
| 410 | Ga0501048_0019363 | 3300049582 | Bacteria | 4994 |
| 411 | Ga0501048_0086834 | 3300049582 | Bacteria | 2206 |
| 412 | Ga0501048_0781921 | 3300049582 | Bacteria | 686 |
| 413 | Ga0501067_0040472 | 3300049583 | Bacteria | 2588 |
| 414 | Ga0501067_0062371 | 3300049583 | Bacteria | 2063 |
| 415 | Ga0501068_0024536 | 3300049584 | Bacteria | 3542 |
| 416 | Ga0501068_0374182 | 3300049584 | Bacteria | 917 |
| 417 | Ga0501070_0003773 | 3300049586 | Bacteria | 13088 |
| 418 | Ga0501070_0021689 | 3300049586 | Bacteria | 5385 |
| 419 | Ga0501070_0062243 | 3300049586 | Bacteria | 3092 |
| 420 | Ga0501070_0573833 | 3300049586 | Unclassified | 901 |
| 421 | Ga0501072_0185970 | 3300049588 | Bacteria | 1657 |
| 422 | Ga0501072_0479235 | 3300049588 | Bacteria | 984 |
| 423 | Ga0501073_0006172 | 3300049589 | Bacteria | 8945 |
| 424 | Ga0501073_0008282 | 3300049589 | Bacteria | 7710 |
| 425 | Ga0501073_0041233 | 3300049589 | Bacteria | 3262 |
| 426 | Ga0501073_0076247 | 3300049589 | Unclassified | 2333 |
| 427 | Ga0501073_0179107 | 3300049589 | Bacteria | 1467 |
| 428 | Ga0501074_0007305 | 3300049590 | Bacteria | 7988 |
| 429 | Ga0501074_0008596 | 3300049590 | Bacteria | 7395 |
| 430 | Ga0501074_0260120 | 3300049590 | Bacteria | 1234 |
| 431 | Ga0501076_0002219 | 3300049592 | Bacteria | 13304 |
| 432 | Ga0501076_0257747 | 3300049592 | Bacteria | 1428 |
| 433 | Ga0501077_0016658 | 3300049593 | Bacteria | 4633 |
| 434 | Ga0501079_0005199 | 3300049741 | Bacteria | 9673 |
| 435 | Ga0501080_0005552 | 3300049742 | Bacteria | 11263 |
| 436 | Ga0501080_0012585 | 3300049742 | Bacteria | 7757 |
| 437 | Ga0501080_0020036 | 3300049742 | Bacteria | 6189 |
| 438 | Ga0501081_0006281 | 3300049743 | Bacteria | 7703 |
| 439 | Ga0501083_0006332 | 3300049744 | Bacteria | 8389 |
| 440 | Ga0501083_0018840 | 3300049744 | Bacteria | 4806 |
| 441 | Ga0501083_0045918 | 3300049744 | Bacteria | 2954 |
| 442 | Ga0501083_0219670 | 3300049744 | Bacteria | 1238 |
| 443 | Ga0501035_0001607 | 3300049822 | Bacteria | 22855 |
| 444 | Ga0501035_0002718 | 3300049822 | Bacteria | 17190 |
| 445 | Ga0501035_0010537 | 3300049822 | Bacteria | 8566 |
| 446 | Ga0501035_0059364 | 3300049822 | Bacteria | 3406 |
| 447 | Ga0501044_0001279 | 3300049823 | Bacteria | 29728 |
| 448 | Ga0501044_0008771 | 3300049823 | Bacteria | 11060 |
| 449 | Ga0501044_0013927 | 3300049823 | Bacteria | 8689 |
| 450 | Ga0501044_0014482 | 3300049823 | Bacteria | 8510 |
| 451 | Ga0501044_0240000 | 3300049823 | Unclassified | 1756 |
| 452 | Ga0501044_0328555 | 3300049823 | Bacteria | 1452 |
| 453 | Ga0501044_0860456 | 3300049823 | Bacteria | 783 |
| 454 | Ga0501045_0013884 | 3300049824 | Bacteria | 5697 |
| 455 | Ga0501045_0069875 | 3300049824 | Bacteria | 2583 |
| 456 | nmdc:mga03683_38150_c1 | 3300050489 | Bacteria | 1961 |
| 457 | nmdc:mga03n38_38757_c1 | 3300050490 | Bacteria | 2063 |
| 458 | nmdc:mga00v17_6527_c1 | 3300050491 | Bacteria | 6192 |
| 459 | nmdc:mga0yw44_54033_c1 | 3300050492 | Bacteria | 2440 |
| 460 | nmdc:mga06z11_10355_c1 | 3300050494 | Bacteria | 3970 |
| 461 | nmdc:mga06z11_285571_c1 | 3300050494 | Bacteria | 978 |
| 462 | nmdc:mga06r32_205309_c1 | 3300050510 | Bacteria | 1958 |
| 463 | nmdc:mga06r32_718631_c1 | 3300050510 | Bacteria | 964 |
| 464 | nmdc:mga0n895_138483_c1 | 3300050512 | Bacteria | 2461 |
| 465 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 466 | Ga0495612_0000035 | 3300053078 | Bacteria | 69194 |
| 467 | Ga0495595_0000032 | 3300053084 | Bacteria | 87066 |
| 468 | Ga0495619_0000033 | 3300053085 | Bacteria | 138925 |
| 469 | Ga0495619_0123350 | 3300053085 | Bacteria | 1777 |
| 470 | Ga0500643_006600 | 3300053087 | Bacteria | 4824 |
| 471 | Ga0500643_015216 | 3300053087 | Bacteria | 2644 |
| 472 | Ga0500651_0004195 | 3300053093 | Bacteria | 8043 |
| 473 | Ga0500556_0106315 | 3300053104 | Bacteria | 1085 |
| 474 | Ga0500562_017035 | 3300053108 | Bacteria | 1871 |
| 475 | Ga0500569_000647 | 3300053109 | Bacteria | 5964 |
| 476 | Ga0500642_0134604 | 3300053130 | Bacteria | 1158 |
| 477 | Ga0500658_0000491 | 3300053134 | Bacteria | 16931 |
| 478 | Ga0500568_0016163 | 3300053139 | Bacteria | 3324 |
| 479 | Ga0500603_012189 | 3300053150 | Bacteria | 1969 |
| 480 | Ga0500616_0030741 | 3300053153 | Bacteria | 2946 |
| 481 | Ga0500622_0048460 | 3300053156 | Bacteria | 2192 |
| 482 | Ga0500645_000006 | 3300053730 | Bacteria | 276677 |
| 483 | Ga0501084_0022328 | 3300054114 | Bacteria | 5281 |
| 484 | Ga0501084_0839377 | 3300054114 | Bacteria | 773 |
| 485 | Ga0501082_0012565 | 3300060353 | Bacteria | 7275 |
| 486 | Ga0501082_0658814 | 3300060353 | Unclassified | 916 |
| 487 | Ga0530510_0170358 | 3300061734 | Bacteria | 1613 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006186 | Ga0075369_10011734 | Ga0075369_100117343 | 178 |
| 2 | 3300010375 | Ga0105239_10342656 | Ga0105239_103426561 | 178 |
| 3 | 3300048928 | Ga0496125_0000237 | Ga0496125_0000237_111292_112005 | 185 |
| 4 | 3300009176 | Ga0105242_10220099 | Ga0105242_102200991 | 186 |
| 5 | 3300048924 | Ga0496121_0012588 | Ga0496121_0012588_688_1404 | 186 |
| 6 | 3300049823 | Ga0501044_0860456 | Ga0501044_0860456_123_746 | 187 |
| 7 | 3300005367 | Ga0070667_100006083 | Ga0070667_1000060834 | 188 |
| 8 | 3300013308 | Ga0157375_10126084 | Ga0157375_101260843 | 188 |
| 9 | 3300015690 | Ga0183363_1151 | Ga0183363_11514 | 188 |
| 10 | 3300025927 | Ga0207687_10100122 | Ga0207687_101001222 | 188 |
| 11 | 3300025986 | Ga0207658_10020977 | Ga0207658_100209774 | 188 |
| 12 | 3300028381 | Ga0268264_10260651 | Ga0268264_102606512 | 188 |
| 13 | 3300048922 | Ga0496119_0089775 | Ga0496119_0089775_970_1689 | 188 |
| 14 | 3300049823 | Ga0501044_0328555 | Ga0501044_0328555_809_1414 | 188 |
| 15 | 3300053093 | Ga0500651_0004195 | Ga0500651_0004195_5195_5914 | 188 |
| 16 | 3300053104 | Ga0500556_0106315 | Ga0500556_0106315_309_1028 | 188 |
| 17 | 3300053130 | Ga0500642_0134604 | Ga0500642_0134604_393_1112 | 188 |
| 18 | 3300026118 | Ga0207675_100235392 | Ga0207675_1002353922 | 190 |
| 19 | 3300031250 | Ga0265331_10047000 | Ga0265331_100470003 | 190 |
| 20 | 3300053087 | Ga0500643_015216 | Ga0500643_015216_735_1406 | 190 |
| 21 | 3300053150 | Ga0500603_012189 | Ga0500603_012189_1035_1754 | 190 |
| 22 | 3300031238 | Ga0265332_10008046 | Ga0265332_100080465 | 191 |
| 23 | 3300031242 | Ga0265329_10010776 | Ga0265329_100107763 | 191 |
| 24 | 3300031247 | Ga0265340_10006067 | Ga0265340_100060673 | 191 |
| 25 | 3300031711 | Ga0265314_10063383 | Ga0265314_100633832 | 191 |
| 26 | 3300031711 | Ga0265314_10234126 | Ga0265314_102341262 | 191 |
| 27 | 3300031712 | Ga0265342_10004642 | Ga0265342_100046429 | 191 |
| 28 | 3300031712 | Ga0265342_10023159 | Ga0265342_100231592 | 191 |
| 29 | 3300026067 | Ga0207678_10406388 | Ga0207678_104063883 | 192 |
| 30 | 3300049582 | Ga0501048_0781921 | Ga0501048_0781921_33_668 | 193 |
| 31 | 3300049822 | Ga0501035_0059364 | Ga0501035_0059364_1420_2166 | 193 |
| 32 | 3300031250 | Ga0265331_10128618 | Ga0265331_101286182 | 195 |
| 33 | 3300031344 | Ga0265316_10010203 | Ga0265316_100102037 | 195 |
| 34 | 3300053156 | Ga0500622_0048460 | Ga0500622_0048460_693_1397 | 195 |
| 35 | 3300013297 | Ga0157378_11049154 | Ga0157378_110491542 | 196 |
| 36 | 3300041505 | Ga0451849_0008212 | Ga0451849_0008212_946_1650 | 196 |
| 37 | 3300041509 | Ga0451843_0322861 | Ga0451843_0322861_1329_2033 | 196 |
| 38 | 3300041511 | Ga0451855_0762862 | Ga0451855_0762862_1310_2014 | 196 |
| 39 | 3300046511 | Ga0495608_0080799 | Ga0495608_0080799_1446_2093 | 196 |
| 40 | 3300046559 | Ga0495667_0000235 | Ga0495667_0000235_20969_21616 | 196 |
| 41 | 3300046675 | Ga0495657_0001655 | Ga0495657_0001655_7704_8351 | 196 |
| 42 | 3300046809 | Ga0495600_0566138 | Ga0495600_0566138_25_672 | 196 |
| 43 | 3300049589 | Ga0501073_0041233 | Ga0501073_0041233_1617_2357 | 196 |
| 44 | 3300006048 | Ga0075363_100013704 | Ga0075363_1000137044 | 197 |
| 45 | 3300021377 | Ga0213874_10035085 | Ga0213874_100350852 | 197 |
| 46 | 3300039438 | Ga0436360_0064513 | Ga0436360_0064513_169_783 | 197 |
| 47 | 3300049568 | Ga0501031_0038407 | Ga0501031_0038407_1103_1840 | 197 |
| 48 | 3300049569 | Ga0501032_0048959 | Ga0501032_0048959_952_1689 | 197 |
| 49 | 3300049570 | Ga0501033_0053052 | Ga0501033_0053052_1164_1901 | 197 |
| 50 | 3300049571 | Ga0501034_0036050 | Ga0501034_0036050_2601_3338 | 197 |
| 51 | 3300049573 | Ga0501037_0024080 | Ga0501037_0024080_2601_3338 | 197 |
| 52 | 3300049574 | Ga0501038_0031567 | Ga0501038_0031567_1343_2080 | 197 |
| 53 | 3300049575 | Ga0501039_0107609 | Ga0501039_0107609_1262_1999 | 197 |
| 54 | 3300049576 | Ga0501040_0003148 | Ga0501040_0003148_404_1141 | 197 |
| 55 | 3300049580 | Ga0501046_0041778 | Ga0501046_0041778_1103_1840 | 197 |
| 56 | 3300049581 | Ga0501047_0165685 | Ga0501047_0165685_180_917 | 197 |
| 57 | 3300049582 | Ga0501048_0086834 | Ga0501048_0086834_1382_2119 | 197 |
| 58 | 3300049586 | Ga0501070_0062243 | Ga0501070_0062243_1005_1742 | 197 |
| 59 | 3300049590 | Ga0501074_0260120 | Ga0501074_0260120_247_984 | 197 |
| 60 | 3300049824 | Ga0501045_0069875 | Ga0501045_0069875_609_1346 | 197 |
| 61 | 3300005548 | Ga0070665_100315654 | Ga0070665_1003156542 | 198 |
| 62 | 3300025910 | Ga0207684_10222483 | Ga0207684_102224832 | 198 |
| 63 | 3300026118 | Ga0207675_100644600 | Ga0207675_1006446002 | 198 |
| 64 | 3300046472 | Ga0495580_0325332 | Ga0495580_0325332_203_892 | 198 |
| 65 | 3300049568 | Ga0501031_0017115 | Ga0501031_0017115_1671_2414 | 198 |
| 66 | 3300049569 | Ga0501032_0008783 | Ga0501032_0008783_5662_6405 | 198 |
| 67 | 3300049570 | Ga0501033_0001474 | Ga0501033_0001474_13331_14074 | 198 |
| 68 | 3300049570 | Ga0501033_0282691 | Ga0501033_0282691_89_715 | 198 |
| 69 | 3300049571 | Ga0501034_0027091 | Ga0501034_0027091_952_1695 | 198 |
| 70 | 3300049572 | Ga0501036_0011010 | Ga0501036_0011010_5967_6710 | 198 |
| 71 | 3300049573 | Ga0501037_0151751 | Ga0501037_0151751_834_1577 | 198 |
| 72 | 3300049574 | Ga0501038_0006326 | Ga0501038_0006326_7020_7763 | 198 |
| 73 | 3300049575 | Ga0501039_0004711 | Ga0501039_0004711_6342_7085 | 198 |
| 74 | 3300049579 | Ga0501043_0010736 | Ga0501043_0010736_3954_4697 | 198 |
| 75 | 3300049580 | Ga0501046_0000433 | Ga0501046_0000433_6005_6748 | 198 |
| 76 | 3300049580 | Ga0501046_0191071 | Ga0501046_0191071_282_908 | 198 |
| 77 | 3300049581 | Ga0501047_0014218 | Ga0501047_0014218_1749_2492 | 198 |
| 78 | 3300049584 | Ga0501068_0024536 | Ga0501068_0024536_2320_3063 | 198 |
| 79 | 3300049584 | Ga0501068_0374182 | Ga0501068_0374182_227_841 | 198 |
| 80 | 3300049586 | Ga0501070_0021689 | Ga0501070_0021689_2613_3356 | 198 |
| 81 | 3300049588 | Ga0501072_0479235 | Ga0501072_0479235_277_972 | 198 |
| 82 | 3300049589 | Ga0501073_0006172 | Ga0501073_0006172_1183_1926 | 198 |
| 83 | 3300049590 | Ga0501074_0008596 | Ga0501074_0008596_789_1532 | 198 |
| 84 | 3300049742 | Ga0501080_0005552 | Ga0501080_0005552_3954_4697 | 198 |
| 85 | 3300049744 | Ga0501083_0219670 | Ga0501083_0219670_312_1055 | 198 |
| 86 | 3300049822 | Ga0501035_0010537 | Ga0501035_0010537_1079_1822 | 198 |
| 87 | 3300049823 | Ga0501044_0008771 | Ga0501044_0008771_6745_7488 | 198 |
| 88 | 3300050512 | nmdc:mga0n895_138483_c1 | nmdc:mga0n895_138483_c1_1025_1738 | 198 |
| 89 | 3300053108 | Ga0500562_017035 | Ga0500562_017035_897_1556 | 198 |
| 90 | 3300061734 | Ga0530510_0170358 | Ga0530510_0170358_306_920 | 198 |
| 91 | 3300009174 | Ga0105241_10072294 | Ga0105241_100722942 | 199 |
| 92 | 3300009551 | Ga0105238_10009489 | Ga0105238_100094894 | 199 |
| 93 | 3300013296 | Ga0157374_10000496 | Ga0157374_100004965 | 199 |
| 94 | 3300013297 | Ga0157378_10011036 | Ga0157378_100110364 | 199 |
| 95 | 3300013307 | Ga0157372_10001696 | Ga0157372_1000169621 | 199 |
| 96 | 3300014969 | Ga0157376_10066812 | Ga0157376_100668123 | 199 |
| 97 | 3300041410 | Ga0439461_0006955 | Ga0439461_0006955_214_831 | 199 |
| 98 | 3300041491 | Ga0451833_0552563 | Ga0451833_0552563_340_1044 | 199 |
| 99 | 3300041494 | Ga0451837_0291003 | Ga0451837_0291003_276_980 | 199 |
| 100 | 3300041496 | Ga0451839_1037019 | Ga0451839_1037019_273_977 | 199 |
| 101 | 3300041501 | Ga0451845_0815701 | Ga0451845_0815701_163_867 | 199 |
| 102 | 3300041512 | Ga0451853_0670545 | Ga0451853_0670545_96_800 | 199 |
| 103 | 3300046501 | Ga0495607_0053093 | Ga0495607_0053093_399_1103 | 199 |
| 104 | 3300046524 | Ga0495648_0074512 | Ga0495648_0074512_1176_1880 | 199 |
| 105 | 3300053087 | Ga0500643_006600 | Ga0500643_006600_1541_2212 | 199 |
| 106 | 3300028573 | Ga0265334_10000033 | Ga0265334_1000003353 | 200 |
| 107 | 3300041492 | Ga0451835_0259487 | Ga0451835_0259487_1311_2015 | 200 |
| 108 | 3300049571 | Ga0501034_0437366 | Ga0501034_0437366_68_700 | 200 |
| 109 | 3300050510 | nmdc:mga06r32_205309_c1 | nmdc:mga06r32_205309_c1_167_787 | 200 |
| 110 | 3300053730 | Ga0500645_000006 | Ga0500645_000006_253357_254079 | 200 |
| 111 | iso_pu_bacteria | 2920822456 | 2920825318 | 201 |
| 112 | 3300005546 | Ga0070696_100166275 | Ga0070696_1001662753 | 202 |
| 113 | 3300005937 | Ga0081455_10094677 | Ga0081455_100946771 | 202 |
| 114 | 3300009551 | Ga0105238_11035137 | Ga0105238_110351372 | 202 |
| 115 | 3300031241 | Ga0265325_10001741 | Ga0265325_1000174111 | 202 |
| 116 | 3300031249 | Ga0265339_10001424 | Ga0265339_1000142411 | 202 |
| 117 | 3300045051 | Ga0451576_0011229 | Ga0451576_0011229_2878_3570 | 202 |
| 118 | 3300046522 | Ga0495643_0010530 | Ga0495643_0010530_2475_3176 | 202 |
| 119 | 3300009174 | Ga0105241_10255371 | Ga0105241_102553711 | 204 |
| 120 | iso_pu_bacteria | 2909042592 | 2909046438 | 204 |
| 121 | 3300048929 | Ga0496126_0191204 | Ga0496126_0191204_967_1707 | 205 |
| 122 | 3300026078 | Ga0207702_10716038 | Ga0207702_107160381 | 206 |
| 123 | 3300049581 | Ga0501047_0091100 | Ga0501047_0091100_318_995 | 206 |
| 124 | 3300049822 | Ga0501035_0001607 | Ga0501035_0001607_870_1547 | 206 |
| 125 | 3300049823 | Ga0501044_0001279 | Ga0501044_0001279_461_1138 | 206 |
| 126 | 3300005458 | Ga0070681_10052179 | Ga0070681_100521794 | 207 |
| 127 | 3300005530 | Ga0070679_100060786 | Ga0070679_1000607862 | 207 |
| 128 | 3300009093 | Ga0105240_10007943 | Ga0105240_1000794314 | 207 |
| 129 | 3300013102 | Ga0157371_10097588 | Ga0157371_100975882 | 207 |
| 130 | 3300013104 | Ga0157370_10139839 | Ga0157370_101398392 | 207 |
| 131 | 3300013307 | Ga0157372_10223501 | Ga0157372_102235012 | 207 |
| 132 | 3300020069 | Ga0197907_10371358 | Ga0197907_103713581 | 207 |
| 133 | 3300020070 | Ga0206356_11908769 | Ga0206356_119087691 | 207 |
| 134 | 3300020075 | Ga0206349_1819953 | Ga0206349_18199532 | 207 |
| 135 | 3300020076 | Ga0206355_1330646 | Ga0206355_13306462 | 207 |
| 136 | 3300020080 | Ga0206350_10769023 | Ga0206350_107690231 | 207 |
| 137 | 3300020082 | Ga0206353_11323159 | Ga0206353_113231592 | 207 |
| 138 | 3300022467 | Ga0224712_10015693 | Ga0224712_100156932 | 207 |
| 139 | 3300025912 | Ga0207707_10475934 | Ga0207707_104759341 | 207 |
| 140 | 3300025917 | Ga0207660_10268303 | Ga0207660_102683032 | 207 |
| 141 | 3300025921 | Ga0207652_10139955 | Ga0207652_101399552 | 207 |
| 142 | 3300025944 | Ga0207661_10413688 | Ga0207661_104136882 | 207 |
| 143 | 3300031711 | Ga0265314_10156494 | Ga0265314_101564942 | 207 |
| 144 | 3300037418 | Ga0395900_0162295 | Ga0395900_0162295_310_990 | 207 |
| 145 | 3300046515 | Ga0495620_0027483 | Ga0495620_0027483_229_930 | 207 |
| 146 | 3300049577 | Ga0501041_0002832 | Ga0501041_0002832_5773_6510 | 207 |
| 147 | 3300049580 | Ga0501046_0000115 | Ga0501046_0000115_76267_77004 | 207 |
| 148 | 3300049582 | Ga0501048_0019363 | Ga0501048_0019363_259_996 | 207 |
| 149 | 3300049592 | Ga0501076_0002219 | Ga0501076_0002219_1881_2618 | 207 |
| 150 | 3300049743 | Ga0501081_0006281 | Ga0501081_0006281_534_1271 | 207 |
| 151 | 3300049744 | Ga0501083_0018840 | Ga0501083_0018840_49_786 | 207 |
| 152 | 3300053109 | Ga0500569_000647 | Ga0500569_000647_1175_1876 | 207 |
| 153 | 3300031247 | Ga0265340_10044431 | Ga0265340_100444312 | 208 |
| 154 | 3300031711 | Ga0265314_10065678 | Ga0265314_100656783 | 208 |
| 155 | 3300037853 | Ga0436364_0596856 | Ga0436364_0596856_429_1082 | 208 |
| 156 | 3300039450 | Ga0436363_0268886 | Ga0436363_0268886_86_772 | 208 |
| 157 | 3300039450 | Ga0436363_1116204 | Ga0436363_1116204_155_808 | 208 |
| 158 | 3300002705 | JGI25156J39149_1011524 | JGI25156J39149_10115241 | 209 |
| 159 | 3300002741 | JGI25157J39369_1002286 | JGI25157J39369_10022865 | 209 |
| 160 | 3300003759 | Ga0055525_1000242 | Ga0055525_100024228 | 209 |
| 161 | 3300003760 | Ga0055527_1000063 | Ga0055527_100006363 | 209 |
| 162 | 3300003761 | Ga0055535_1000406 | Ga0055535_100040621 | 209 |
| 163 | 3300003762 | Ga0055542_1000146 | Ga0055542_100014663 | 209 |
| 164 | 3300003762 | Ga0055542_1003953 | Ga0055542_10039531 | 209 |
| 165 | 3300003763 | Ga0055529_1000597 | Ga0055529_10005977 | 209 |
| 166 | 3300005458 | Ga0070681_10521562 | Ga0070681_105215621 | 209 |
| 167 | 3300020069 | Ga0197907_11490845 | Ga0197907_114908451 | 209 |
| 168 | 3300025228 | Ga0209672_100007 | Ga0209672_100007522 | 209 |
| 169 | 3300025228 | Ga0209672_102534 | Ga0209672_1025341 | 209 |
| 170 | 3300025230 | Ga0209563_100071 | Ga0209563_100071191 | 209 |
| 171 | 3300025242 | Ga0209258_100017 | Ga0209258_100017296 | 209 |
| 172 | 3300025242 | Ga0209258_100758 | Ga0209258_10075816 | 209 |
| 173 | 3300025254 | Ga0209148_1000044 | Ga0209148_1000044297 | 209 |
| 174 | 3300025254 | Ga0209148_1003930 | Ga0209148_10039305 | 209 |
| 175 | 3300025256 | Ga0209759_1000166 | Ga0209759_1000166105 | 209 |
| 176 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010522 | 209 |
| 177 | 3300025916 | Ga0207663_10364322 | Ga0207663_103643221 | 209 |
| 178 | 3300031235 | Ga0265330_10028027 | Ga0265330_100280273 | 209 |
| 179 | 3300031250 | Ga0265331_10068403 | Ga0265331_100684032 | 209 |
| 180 | 3300037312 | Ga0395899_0008203 | Ga0395899_0008203_4268_4951 | 209 |
| 181 | 3300037466 | Ga0395898_0000460 | Ga0395898_0000460_64085_64768 | 209 |
| 182 | 3300039450 | Ga0436363_1546557 | Ga0436363_1546557_1265_2011 | 209 |
| 183 | 3300044656 | Ga0466969_0004995 | Ga0466969_0004995_6124_6807 | 209 |
| 184 | 3300044684 | Ga0466966_0005052 | Ga0466966_0005052_7313_7996 | 209 |
| 185 | 3300044693 | Ga0466961_0001260 | Ga0466961_0001260_162_845 | 209 |
| 186 | 3300044693 | Ga0466961_0024959 | Ga0466961_0024959_2943_3626 | 209 |
| 187 | 3300044693 | Ga0466961_0202667 | Ga0466961_0202667_214_897 | 209 |
| 188 | 3300044765 | Ga0466970_0002513 | Ga0466970_0002513_7604_8287 | 209 |
| 189 | 3300044765 | Ga0466970_0045572 | Ga0466970_0045572_302_985 | 209 |
| 190 | 3300044842 | Ga0466957_0042584 | Ga0466957_0042584_1862_2545 | 209 |
| 191 | 3300045049 | Ga0466959_0210400 | Ga0466959_0210400_418_1101 | 209 |
| 192 | 3300045836 | Ga0466958_0421763 | Ga0466958_0421763_56_739 | 209 |
| 193 | 3300049571 | Ga0501034_0011186 | Ga0501034_0011186_3064_3747 | 209 |
| 194 | 3300049572 | Ga0501036_0030209 | Ga0501036_0030209_3096_3779 | 209 |
| 195 | 3300049573 | Ga0501037_0052454 | Ga0501037_0052454_155_838 | 209 |
| 196 | 3300049581 | Ga0501047_0004044 | Ga0501047_0004044_11485_12168 | 209 |
| 197 | 3300049583 | Ga0501067_0040472 | Ga0501067_0040472_1117_1800 | 209 |
| 198 | 3300049586 | Ga0501070_0003773 | Ga0501070_0003773_3349_4032 | 209 |
| 199 | 3300049589 | Ga0501073_0008282 | Ga0501073_0008282_1621_2304 | 209 |
| 200 | 3300049590 | Ga0501074_0007305 | Ga0501074_0007305_5207_5890 | 209 |
| 201 | 3300049741 | Ga0501079_0005199 | Ga0501079_0005199_5006_5689 | 209 |
| 202 | 3300049742 | Ga0501080_0012585 | Ga0501080_0012585_5279_5962 | 209 |
| 203 | 3300049822 | Ga0501035_0002718 | Ga0501035_0002718_13629_14312 | 209 |
| 204 | 3300049823 | Ga0501044_0014482 | Ga0501044_0014482_6207_6890 | 209 |
| 205 | 3300054114 | Ga0501084_0022328 | Ga0501084_0022328_2903_3586 | 209 |
| 206 | 3300020078 | Ga0206352_10323814 | Ga0206352_103238141 | 210 |
| 207 | 3300020082 | Ga0206353_10866523 | Ga0206353_108665232 | 210 |
| 208 | 3300025912 | Ga0207707_10301952 | Ga0207707_103019521 | 210 |
| 209 | 3300031711 | Ga0265314_10001465 | Ga0265314_100014652 | 210 |
| 210 | 3300031711 | Ga0265314_10015545 | Ga0265314_100155456 | 210 |
| 211 | 3300049570 | Ga0501033_0157684 | Ga0501033_0157684_128_817 | 210 |
| 212 | 3300005455 | Ga0070663_100225720 | Ga0070663_1002257201 | 211 |
| 213 | 3300005539 | Ga0068853_100001404 | Ga0068853_1000014048 | 211 |
| 214 | 3300005577 | Ga0068857_100025418 | Ga0068857_1000254186 | 211 |
| 215 | 3300005616 | Ga0068852_100005382 | Ga0068852_10000538211 | 211 |
| 216 | 3300005834 | Ga0068851_10001310 | Ga0068851_1000131010 | 211 |
| 217 | 3300009093 | Ga0105240_10072658 | Ga0105240_100726582 | 211 |
| 218 | 3300009551 | Ga0105238_10001064 | Ga0105238_1000106428 | 211 |
| 219 | 3300010375 | Ga0105239_10010423 | Ga0105239_100104238 | 211 |
| 220 | 3300025297 | Ga0209758_1002527 | Ga0209758_100252716 | 211 |
| 221 | 3300025321 | Ga0207656_10005726 | Ga0207656_100057266 | 211 |
| 222 | 3300025911 | Ga0207654_10000806 | Ga0207654_1000080610 | 211 |
| 223 | 3300025913 | Ga0207695_10003805 | Ga0207695_1000380522 | 211 |
| 224 | 3300025914 | Ga0207671_10194907 | Ga0207671_101949072 | 211 |
| 225 | 3300025924 | Ga0207694_10000273 | Ga0207694_100002739 | 211 |
| 226 | 3300025949 | Ga0207667_10010297 | Ga0207667_100102975 | 211 |
| 227 | 3300025981 | Ga0207640_10107714 | Ga0207640_101077142 | 211 |
| 228 | 3300026041 | Ga0207639_10005178 | Ga0207639_100051782 | 211 |
| 229 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003231 | 211 |
| 230 | 3300026116 | Ga0207674_10073263 | Ga0207674_100732634 | 211 |
| 231 | 3300026142 | Ga0207698_10137713 | Ga0207698_101377133 | 211 |
| 232 | 3300046507 | Ga0495606_0010004 | Ga0495606_0010004_5837_6538 | 211 |
| 233 | 3300046512 | Ga0495610_0020204 | Ga0495610_0020204_888_1589 | 211 |
| 234 | 3300046542 | Ga0495597_0018607 | Ga0495597_0018607_1717_2418 | 211 |
| 235 | 3300047472 | Ga0495686_0009589 | Ga0495686_0009589_5783_6484 | 211 |
| 236 | 3300048091 | Ga0495626_0079418 | Ga0495626_0079418_258_959 | 211 |
| 237 | 3300050494 | nmdc:mga06z11_285571_c1 | nmdc:mga06z11_285571_c1_258_959 | 211 |
| 238 | 3300053134 | Ga0500658_0000491 | Ga0500658_0000491_14116_14817 | 211 |
| 239 | 3300053153 | Ga0500616_0030741 | Ga0500616_0030741_1063_1764 | 211 |
| 240 | iso_pu_bacteria | 2510065019 | 2510136779 | 211 |
| 241 | iso_pu_bacteria | 2510461076 | 2510899956 | 211 |
| 242 | iso_pu_bacteria | 2510461076 | 2510900552 | 211 |
| 243 | iso_pu_bacteria | 2513237085 | 2513576667 | 211 |
| 244 | iso_pu_bacteria | 2513237103 | 2513710068 | 211 |
| 245 | iso_pu_bacteria | 2513237162 | 2514021415 | 211 |
| 246 | iso_pu_bacteria | 2515075009 | 2515115354 | 211 |
| 247 | iso_pu_bacteria | 2515154113 | 2515636083 | 211 |
| 248 | iso_pu_bacteria | 2515154114 | 2515644761 | 211 |
| 249 | iso_pu_bacteria | 2515154116 | 2515658060 | 211 |
| 250 | iso_pu_bacteria | 2515154134 | 2515742215 | 211 |
| 251 | iso_pu_bacteria | 2516653077 | 2517041651 | 211 |
| 252 | iso_pu_bacteria | 2516653085 | 2517080766 | 211 |
| 253 | iso_pu_bacteria | 2517287029 | 2517411063 | 211 |
| 254 | iso_pu_bacteria | 2529292951 | 2530644861 | 211 |
| 255 | iso_pu_bacteria | 2585427526 | 2585524448 | 211 |
| 256 | iso_pu_bacteria | 2718217997 | 2719667880 | 211 |
| 257 | iso_pu_bacteria | 2718218199 | 2720494643 | 211 |
| 258 | iso_pu_bacteria | 2718218232 | 2720610978 | 211 |
| 259 | iso_pu_bacteria | 2718218235 | 2720629227 | 211 |
| 260 | iso_pu_bacteria | 2718218269 | 2720771799 | 211 |
| 261 | iso_pu_bacteria | 2721755556 | 2723029201 | 211 |
| 262 | iso_pu_bacteria | 2721755684 | 2723562836 | 211 |
| 263 | iso_pu_bacteria | 2721755685 | 2723570826 | 211 |
| 264 | iso_pu_bacteria | 2721755819 | 2724086619 | 211 |
| 265 | iso_pu_bacteria | 2721755822 | 2724106777 | 211 |
| 266 | iso_pu_bacteria | 2721755823 | 2724107578 | 211 |
| 267 | iso_pu_bacteria | 2728369352 | 2730105515 | 211 |
| 268 | iso_pu_bacteria | 2802429605 | 2805927891 | 211 |
| 269 | iso_pu_bacteria | 2802429606 | 2805933738 | 211 |
| 270 | iso_pu_bacteria | 2838016132 | 2838019296 | 211 |
| 271 | iso_pu_bacteria | 2838048938 | 2838050361 | 211 |
| 272 | iso_pu_bacteria | 2838061910 | 2838063065 | 211 |
| 273 | iso_pu_bacteria | 2838068647 | 2838071630 | 211 |
| 274 | iso_pu_bacteria | 2838668709 | 2838673696 | 211 |
| 275 | iso_pu_bacteria | 2838686498 | 2838692265 | 211 |
| 276 | iso_pu_bacteria | 2838701080 | 2838705271 | 211 |
| 277 | iso_pu_bacteria | 2838729681 | 2838734317 | 211 |
| 278 | iso_pu_bacteria | 2838742623 | 2838746769 | 211 |
| 279 | iso_pu_bacteria | 2841851746 | 2841853460 | 211 |
| 280 | iso_pu_bacteria | 2842146304 | 2842150239 | 211 |
| 281 | iso_pu_bacteria | 2842156927 | 2842161455 | 211 |
| 282 | iso_pu_bacteria | 2842163707 | 2842167340 | 211 |
| 283 | iso_pu_bacteria | 2842180545 | 2842185744 | 211 |
| 284 | iso_pu_bacteria | 2842192696 | 2842195482 | 211 |
| 285 | iso_pu_bacteria | 2842217011 | 2842223108 | 211 |
| 286 | iso_pu_bacteria | 2842229732 | 2842234085 | 211 |
| 287 | iso_pu_bacteria | 2842243621 | 2842246386 | 211 |
| 288 | iso_pu_bacteria | 2842250916 | 2842254925 | 211 |
| 289 | iso_pu_bacteria | 2842257432 | 2842260754 | 211 |
| 290 | iso_pu_bacteria | 2842264693 | 2842269348 | 211 |
| 291 | iso_pu_bacteria | 2842271015 | 2842276043 | 211 |
| 292 | iso_pu_bacteria | 2842304105 | 2842308638 | 211 |
| 293 | iso_pu_bacteria | 2842311132 | 2842311968 | 211 |
| 294 | iso_pu_bacteria | 2842317721 | 2842319244 | 211 |
| 295 | iso_pu_bacteria | 2842395702 | 2842396694 | 211 |
| 296 | iso_pu_bacteria | 2842422224 | 2842425263 | 211 |
| 297 | iso_pu_bacteria | 2842428310 | 2842432695 | 211 |
| 298 | iso_pu_bacteria | 2842434925 | 2842438857 | 211 |
| 299 | iso_pu_bacteria | 2842441272 | 2842445487 | 211 |
| 300 | iso_pu_bacteria | 2842447887 | 2842449941 | 211 |
| 301 | iso_pu_bacteria | 2842462802 | 2842467732 | 211 |
| 302 | iso_pu_bacteria | 2842469257 | 2842473472 | 211 |
| 303 | iso_pu_bacteria | 2842489311 | 2842491690 | 211 |
| 304 | iso_pu_bacteria | 2842495871 | 2842499761 | 211 |
| 305 | iso_pu_bacteria | 2844454524 | 2844460818 | 211 |
| 306 | iso_pu_bacteria | 2933570622 | 2933575231 | 211 |
| 307 | iso_pu_bacteria | 2933599457 | 2933602429 | 211 |
| 308 | iso_pu_bacteria | 2935901341 | 2935906876 | 211 |
| 309 | iso_pu_bacteria | 2936367885 | 2936370458 | 211 |
| 310 | iso_pu_bacteria | 2936375103 | 2936378123 | 211 |
| 311 | iso_pu_bacteria | 8005282627 | 8005288010 | 211 |
| 312 | iso_pu_bacteria | 8005307578 | 8005313333 | 211 |
| 313 | iso_pu_bacteria | 8005376324 | 8005382132 | 211 |
| 314 | iso_pu_bacteria | 8005430974 | 8005431293 | 211 |
| 315 | iso_pu_bacteria | 8005460587 | 8005466579 | 211 |
| 316 | iso_pu_bacteria | 8005497431 | 8005503291 | 211 |
| 317 | iso_pu_bacteria | 8005619151 | 8005625431 | 211 |
| 318 | iso_pu_bacteria | 8005626139 | 8005630413 | 211 |
| 319 | iso_pu_bacteria | 8005668836 | 8005674809 | 211 |
| 320 | iso_pu_bacteria | 8005695170 | 8005696881 | 211 |
| 321 | iso_pu_bacteria | 8018163183 | 8018166183 | 211 |
| 322 | iso_pu_bacteria | 8023680758 | 8023688347 | 211 |
| 323 | iso_pu_bacteria | 8024501048 | 8024503982 | 211 |
| 324 | iso_pu_bacteria | 8057874678 | 8057880812 | 211 |
| 325 | 3300001989 | JGI24739J22299_10013673 | JGI24739J22299_100136733 | 212 |
| 326 | 3300001990 | JGI24737J22298_10010536 | JGI24737J22298_100105363 | 212 |
| 327 | 3300002067 | JGI24735J21928_10018499 | JGI24735J21928_100184992 | 212 |
| 328 | 3300005539 | Ga0068853_100128191 | Ga0068853_1001281913 | 212 |
| 329 | 3300005563 | Ga0068855_100029771 | Ga0068855_1000297714 | 212 |
| 330 | 3300005577 | Ga0068857_100063398 | Ga0068857_1000633984 | 212 |
| 331 | 3300005578 | Ga0068854_100020296 | Ga0068854_1000202962 | 212 |
| 332 | 3300005614 | Ga0068856_100044653 | Ga0068856_1000446532 | 212 |
| 333 | 3300009093 | Ga0105240_10068422 | Ga0105240_100684222 | 212 |
| 334 | 3300009545 | Ga0105237_10169818 | Ga0105237_101698182 | 212 |
| 335 | 3300009551 | Ga0105238_10046958 | Ga0105238_100469582 | 212 |
| 336 | 3300010375 | Ga0105239_10047705 | Ga0105239_100477052 | 212 |
| 337 | 3300025904 | Ga0207647_10020459 | Ga0207647_100204592 | 212 |
| 338 | 3300025913 | Ga0207695_10058711 | Ga0207695_100587112 | 212 |
| 339 | 3300025914 | Ga0207671_10108228 | Ga0207671_101082282 | 212 |
| 340 | 3300025949 | Ga0207667_10230187 | Ga0207667_102301871 | 212 |
| 341 | 3300025981 | Ga0207640_10044828 | Ga0207640_100448285 | 212 |
| 342 | 3300026041 | Ga0207639_10024836 | Ga0207639_100248367 | 212 |
| 343 | 3300026078 | Ga0207702_10067303 | Ga0207702_100673032 | 212 |
| 344 | 3300026116 | Ga0207674_10007519 | Ga0207674_100075197 | 212 |
| 345 | 3300048907 | Ga0496104_0156832 | Ga0496104_0156832_264_995 | 212 |
| 346 | 3300048911 | Ga0496108_0055537 | Ga0496108_0055537_1346_2077 | 212 |
| 347 | 3300048912 | Ga0496109_0020142 | Ga0496109_0020142_5086_5817 | 212 |
| 348 | 3300048913 | Ga0496110_0038590 | Ga0496110_0038590_1233_1964 | 212 |
| 349 | 3300048914 | Ga0496111_0058755 | Ga0496111_0058755_823_1554 | 212 |
| 350 | 3300048915 | Ga0496112_0082646 | Ga0496112_0082646_1317_2048 | 212 |
| 351 | 3300048916 | Ga0496113_0034460 | Ga0496113_0034460_135_866 | 212 |
| 352 | 3300048918 | Ga0496115_0159555 | Ga0496115_0159555_346_1059 | 212 |
| 353 | 3300048929 | Ga0496126_0282062 | Ga0496126_0282062_506_1219 | 212 |
| 354 | 3300021361 | Ga0213872_10148801 | Ga0213872_101488012 | 213 |
| 355 | 3300031730 | Ga0307516_10004445 | Ga0307516_100044453 | 213 |
| 356 | 3300039447 | Ga0436361_0709744 | Ga0436361_0709744_1594_2307 | 213 |
| 357 | 3300049570 | Ga0501033_0004101 | Ga0501033_0004101_4677_5396 | 213 |
| 358 | 3300049571 | Ga0501034_0050255 | Ga0501034_0050255_453_1172 | 213 |
| 359 | 3300049572 | Ga0501036_0116011 | Ga0501036_0116011_454_1173 | 213 |
| 360 | 3300049574 | Ga0501038_0081585 | Ga0501038_0081585_561_1280 | 213 |
| 361 | 3300049576 | Ga0501040_0006328 | Ga0501040_0006328_5703_6422 | 213 |
| 362 | 3300049578 | Ga0501042_0007786 | Ga0501042_0007786_727_1446 | 213 |
| 363 | 3300049583 | Ga0501067_0062371 | Ga0501067_0062371_883_1602 | 213 |
| 364 | 3300049588 | Ga0501072_0185970 | Ga0501072_0185970_504_1223 | 213 |
| 365 | 3300049592 | Ga0501076_0257747 | Ga0501076_0257747_265_984 | 213 |
| 366 | 3300049593 | Ga0501077_0016658 | Ga0501077_0016658_461_1180 | 213 |
| 367 | 3300049744 | Ga0501083_0006332 | Ga0501083_0006332_3873_4592 | 213 |
| 368 | 3300049823 | Ga0501044_0013927 | Ga0501044_0013927_7278_7997 | 213 |
| 369 | 3300049824 | Ga0501045_0013884 | Ga0501045_0013884_175_894 | 213 |
| 370 | 3300060353 | Ga0501082_0012565 | Ga0501082_0012565_1529_2248 | 213 |
| 371 | 3300005344 | Ga0070661_100325400 | Ga0070661_1003254001 | 214 |
| 372 | 3300005466 | Ga0070685_10186175 | Ga0070685_101861752 | 214 |
| 373 | 3300005535 | Ga0070684_100108465 | Ga0070684_1001084653 | 214 |
| 374 | 3300005547 | Ga0070693_100303887 | Ga0070693_1003038871 | 214 |
| 375 | 3300005563 | Ga0068855_100001490 | Ga0068855_1000014907 | 214 |
| 376 | 3300005564 | Ga0070664_100353441 | Ga0070664_1003534413 | 214 |
| 377 | 3300005614 | Ga0068856_100000065 | Ga0068856_1000000652 | 214 |
| 378 | 3300006048 | Ga0075363_100004002 | Ga0075363_1000040024 | 214 |
| 379 | 3300006237 | Ga0097621_100000908 | Ga0097621_10000090824 | 214 |
| 380 | 3300009098 | Ga0105245_10081796 | Ga0105245_100817964 | 214 |
| 381 | 3300009553 | Ga0105249_10835679 | Ga0105249_108356792 | 214 |
| 382 | 3300011119 | Ga0105246_10182725 | Ga0105246_101827252 | 214 |
| 383 | 3300013105 | Ga0157369_10000264 | Ga0157369_100002644 | 214 |
| 384 | 3300025911 | Ga0207654_10041276 | Ga0207654_100412762 | 214 |
| 385 | 3300025921 | Ga0207652_10016468 | Ga0207652_100164688 | 214 |
| 386 | 3300025927 | Ga0207687_10101557 | Ga0207687_101015572 | 214 |
| 387 | 3300025949 | Ga0207667_10000413 | Ga0207667_1000041322 | 214 |
| 388 | 3300026078 | Ga0207702_10000209 | Ga0207702_100002094 | 214 |
| 389 | 3300026142 | Ga0207698_10097751 | Ga0207698_100977512 | 214 |
| 390 | 3300048908 | Ga0496105_0405953 | Ga0496105_0405953_101_805 | 214 |
| 391 | 3300048911 | Ga0496108_0022862 | Ga0496108_0022862_3769_4473 | 214 |
| 392 | 3300048912 | Ga0496109_0052104 | Ga0496109_0052104_1052_1756 | 214 |
| 393 | 3300048913 | Ga0496110_0048100 | Ga0496110_0048100_286_990 | 214 |
| 394 | 3300048915 | Ga0496112_0006460 | Ga0496112_0006460_6492_7196 | 214 |
| 395 | 3300048915 | Ga0496112_0014728 | Ga0496112_0014728_2893_3567 | 214 |
| 396 | 3300048916 | Ga0496113_0034858 | Ga0496113_0034858_436_1140 | 214 |
| 397 | 3300050490 | nmdc:mga03n38_38757_c1 | nmdc:mga03n38_38757_c1_938_1642 | 214 |
| 398 | 3300005439 | Ga0070711_100549780 | Ga0070711_1005497801 | 215 |
| 399 | 3300005842 | Ga0068858_100229374 | Ga0068858_1002293743 | 215 |
| 400 | 3300005844 | Ga0068862_100059198 | Ga0068862_1000591983 | 215 |
| 401 | 3300006051 | Ga0075364_10015693 | Ga0075364_100156932 | 215 |
| 402 | 3300006177 | Ga0075362_10004567 | Ga0075362_100045672 | 215 |
| 403 | 3300006178 | Ga0075367_10007643 | Ga0075367_100076433 | 215 |
| 404 | 3300007265 | Ga0099794_10205016 | Ga0099794_102050161 | 215 |
| 405 | 3300010159 | Ga0099796_10021181 | Ga0099796_100211812 | 215 |
| 406 | 3300014326 | Ga0157380_10373996 | Ga0157380_103739962 | 215 |
| 407 | 3300025898 | Ga0207692_10242719 | Ga0207692_102427192 | 215 |
| 408 | 3300025939 | Ga0207665_10070163 | Ga0207665_100701632 | 215 |
| 409 | 3300026035 | Ga0207703_10089031 | Ga0207703_100890312 | 215 |
| 410 | 3300027512 | Ga0209179_1013762 | Ga0209179_10137622 | 215 |
| 411 | 3300028380 | Ga0268265_10044953 | Ga0268265_100449533 | 215 |
| 412 | 3300035086 | Ga0373934_0025045 | Ga0373934_0025045_1235_1954 | 215 |
| 413 | 3300035111 | Ga0373923_0005091 | Ga0373923_0005091_3274_3993 | 215 |
| 414 | 3300035116 | Ga0373945_0013035 | Ga0373945_0013035_1454_2173 | 215 |
| 415 | 3300035117 | Ga0373953_0001606 | Ga0373953_0001606_1133_1852 | 215 |
| 416 | 3300035118 | Ga0373954_0039304 | Ga0373954_0039304_1344_2063 | 215 |
| 417 | 3300035119 | Ga0373956_0007284 | Ga0373956_0007284_1745_2464 | 215 |
| 418 | 3300035120 | Ga0373957_0103545 | Ga0373957_0103545_359_1078 | 215 |
| 419 | 3300035170 | Ga0373943_0003490 | Ga0373943_0003490_4736_5455 | 215 |
| 420 | 3300035171 | Ga0373946_0004458 | Ga0373946_0004458_1647_2366 | 215 |
| 421 | 3300035172 | Ga0373955_0000346 | Ga0373955_0000346_10555_11274 | 215 |
| 422 | 3300035410 | Ga0373924_0001455 | Ga0373924_0001455_6827_7546 | 215 |
| 423 | 3300035692 | Ga0373935_0000056 | Ga0373935_0000056_35743_36462 | 215 |
| 424 | 3300035695 | Ga0373927_0033737 | Ga0373927_0033737_1932_2651 | 215 |
| 425 | 3300035724 | Ga0373933_0004205 | Ga0373933_0004205_5501_6220 | 215 |
| 426 | 3300035725 | Ga0373947_0004488 | Ga0373947_0004488_1990_2709 | 215 |
| 427 | 3300036401 | Ga0373937_0000075 | Ga0373937_0000075_68912_69631 | 215 |
| 428 | 3300036401 | Ga0373937_0351196 | Ga0373937_0351196_444_1163 | 215 |
| 429 | 3300037068 | Ga0373925_0000159 | Ga0373925_0000159_35603_36322 | 215 |
| 430 | 3300046454 | Ga0495592_0000102 | Ga0495592_0000102_68881_69600 | 215 |
| 431 | 3300046462 | Ga0495651_0001236 | Ga0495651_0001236_14107_14826 | 215 |
| 432 | 3300046463 | Ga0495653_0000036 | Ga0495653_0000036_53221_53940 | 215 |
| 433 | 3300046476 | Ga0495662_0006322 | Ga0495662_0006322_1283_2002 | 215 |
| 434 | 3300046477 | Ga0495664_0000107 | Ga0495664_0000107_40159_40878 | 215 |
| 435 | 3300046511 | Ga0495608_0000006 | Ga0495608_0000006_254730_255449 | 215 |
| 436 | 3300046514 | Ga0495618_0000057 | Ga0495618_0000057_20305_21024 | 215 |
| 437 | 3300046516 | Ga0495628_0000077 | Ga0495628_0000077_543_1262 | 215 |
| 438 | 3300046517 | Ga0495630_0001707 | Ga0495630_0001707_11124_11843 | 215 |
| 439 | 3300046529 | Ga0495652_0000005 | Ga0495652_0000005_483485_484204 | 215 |
| 440 | 3300046533 | Ga0495640_0000007 | Ga0495640_0000007_202447_203166 | 215 |
| 441 | 3300046536 | Ga0495587_0000043 | Ga0495587_0000043_40088_40807 | 215 |
| 442 | 3300046543 | Ga0495645_0000275 | Ga0495645_0000275_543_1262 | 215 |
| 443 | 3300046559 | Ga0495667_0000023 | Ga0495667_0000023_21755_22474 | 215 |
| 444 | 3300046642 | Ga0495634_0000049 | Ga0495634_0000049_35421_36140 | 215 |
| 445 | 3300046663 | Ga0495635_0000021 | Ga0495635_0000021_68891_69610 | 215 |
| 446 | 3300046675 | Ga0495657_0000063 | Ga0495657_0000063_53510_54229 | 215 |
| 447 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_62075_62794 | 215 |
| 448 | 3300046679 | Ga0495623_0000056 | Ga0495623_0000056_6394_7113 | 215 |
| 449 | 3300046680 | Ga0495646_0000007 | Ga0495646_0000007_173926_174645 | 215 |
| 450 | 3300046683 | Ga0495658_0010076 | Ga0495658_0010076_2039_2758 | 215 |
| 451 | 3300046689 | Ga0495613_0056629 | Ga0495613_0056629_1272_1991 | 215 |
| 452 | 3300046809 | Ga0495600_0000047 | Ga0495600_0000047_64464_65183 | 215 |
| 453 | 3300047317 | Ga0495604_0000014 | Ga0495604_0000014_164596_165315 | 215 |
| 454 | 3300047319 | Ga0495674_0000014 | Ga0495674_0000014_75925_76644 | 215 |
| 455 | 3300047322 | Ga0495680_0000744 | Ga0495680_0000744_11690_12409 | 215 |
| 456 | 3300047444 | Ga0495675_0000940 | Ga0495675_0000940_10512_11231 | 215 |
| 457 | 3300047471 | Ga0495684_0000272 | Ga0495684_0000272_40133_40852 | 215 |
| 458 | 3300047673 | Ga0495593_0103367 | Ga0495593_0103367_522_1241 | 215 |
| 459 | 3300048088 | Ga0495602_0000017 | Ga0495602_0000017_36531_37250 | 215 |
| 460 | 3300048924 | Ga0496121_0013808 | Ga0496121_0013808_5451_6152 | 215 |
| 461 | 3300049580 | Ga0501046_0106012 | Ga0501046_0106012_544_1245 | 215 |
| 462 | 3300049581 | Ga0501047_0104900 | Ga0501047_0104900_1099_1800 | 215 |
| 463 | 3300049589 | Ga0501073_0179107 | Ga0501073_0179107_300_1001 | 215 |
| 464 | 3300049744 | Ga0501083_0045918 | Ga0501083_0045918_1393_2094 | 215 |
| 465 | 3300050489 | nmdc:mga03683_38150_c1 | nmdc:mga03683_38150_c1_212_919 | 215 |
| 466 | 3300050491 | nmdc:mga00v17_6527_c1 | nmdc:mga00v17_6527_c1_2275_2982 | 215 |
| 467 | 3300050492 | nmdc:mga0yw44_54033_c1 | nmdc:mga0yw44_54033_c1_1368_2075 | 215 |
| 468 | 3300050494 | nmdc:mga06z11_10355_c1 | nmdc:mga06z11_10355_c1_1368_2075 | 215 |
| 469 | 3300053077 | Ga0495601_0000016 | Ga0495601_0000016_36531_37250 | 215 |
| 470 | 3300053078 | Ga0495612_0000035 | Ga0495612_0000035_6376_7095 | 215 |
| 471 | 3300053084 | Ga0495595_0000032 | Ga0495595_0000032_30775_31494 | 215 |
| 472 | 3300053085 | Ga0495619_0000033 | Ga0495619_0000033_62253_62972 | 215 |
| 473 | 3300053139 | Ga0500568_0016163 | Ga0500568_0016163_85_786 | 215 |
| 474 | 3300054114 | Ga0501084_0839377 | Ga0501084_0839377_32_733 | 215 |
| 475 | 2162886011 | MRS1b_contig_1777220 | MRS1b_0330.00002430 | 216 |
| 476 | 3300005329 | Ga0070683_100280050 | Ga0070683_1002800501 | 216 |
| 477 | 3300005330 | Ga0070690_100002154 | Ga0070690_1000021542 | 216 |
| 478 | 3300005331 | Ga0070670_100012748 | Ga0070670_1000127483 | 216 |
| 479 | 3300005335 | Ga0070666_10002154 | Ga0070666_100021544 | 216 |
| 480 | 3300005338 | Ga0068868_100006389 | Ga0068868_1000063893 | 216 |
| 481 | 3300005344 | Ga0070661_100001122 | Ga0070661_1000011229 | 216 |
| 482 | 3300005344 | Ga0070661_100054868 | Ga0070661_1000548683 | 216 |
| 483 | 3300005353 | Ga0070669_100057936 | Ga0070669_1000579363 | 216 |
| 484 | 3300005354 | Ga0070675_100061708 | Ga0070675_1000617083 | 216 |
| 485 | 3300005364 | Ga0070673_100048139 | Ga0070673_1000481393 | 216 |
| 486 | 3300005367 | Ga0070667_100004657 | Ga0070667_1000046573 | 216 |
| 487 | 3300005466 | Ga0070685_10111453 | Ga0070685_101114532 | 216 |
| 488 | 3300005535 | Ga0070684_100246867 | Ga0070684_1002468672 | 216 |
| 489 | 3300005543 | Ga0070672_100000725 | Ga0070672_1000007252 | 216 |
| 490 | 3300005543 | Ga0070672_100642132 | Ga0070672_1006421321 | 216 |
| 491 | 3300005544 | Ga0070686_100118636 | Ga0070686_1001186361 | 216 |
| 492 | 3300005564 | Ga0070664_100000389 | Ga0070664_1000003893 | 216 |
| 493 | 3300005617 | Ga0068859_100574357 | Ga0068859_1005743572 | 216 |
| 494 | 3300005618 | Ga0068864_100011436 | Ga0068864_1000114367 | 216 |
| 495 | 3300005841 | Ga0068863_100010409 | Ga0068863_1000104095 | 216 |
| 496 | 3300005842 | Ga0068858_100057939 | Ga0068858_1000579392 | 216 |
| 497 | 3300005843 | Ga0068860_100099908 | Ga0068860_1000999082 | 216 |
| 498 | 3300006237 | Ga0097621_100475251 | Ga0097621_1004752511 | 216 |
| 499 | 3300006237 | Ga0097621_100887635 | Ga0097621_1008876351 | 216 |
| 500 | 3300006358 | Ga0068871_100978791 | Ga0068871_1009787911 | 216 |
| 501 | 3300006931 | Ga0097620_100574356 | Ga0097620_1005743562 | 216 |
| 502 | 3300009174 | Ga0105241_10120372 | Ga0105241_101203722 | 216 |
| 503 | 3300009177 | Ga0105248_10474009 | Ga0105248_104740091 | 216 |
| 504 | 3300013296 | Ga0157374_10114159 | Ga0157374_101141592 | 216 |
| 505 | 3300013306 | Ga0163162_10097868 | Ga0163162_100978683 | 216 |
| 506 | 3300013306 | Ga0163162_10269401 | Ga0163162_102694012 | 216 |
| 507 | 3300013308 | Ga0157375_10000631 | Ga0157375_1000063116 | 216 |
| 508 | 3300014325 | Ga0163163_10005157 | Ga0163163_100051578 | 216 |
| 509 | 3300014325 | Ga0163163_10069266 | Ga0163163_100692662 | 216 |
| 510 | 3300014745 | Ga0157377_10234060 | Ga0157377_102340602 | 216 |
| 511 | 3300014968 | Ga0157379_10446658 | Ga0157379_104466582 | 216 |
| 512 | 3300014969 | Ga0157376_10291159 | Ga0157376_102911592 | 216 |
| 513 | 3300017792 | Ga0163161_10116256 | Ga0163161_101162562 | 216 |
| 514 | 3300025909 | Ga0207705_10359277 | Ga0207705_103592772 | 216 |
| 515 | 3300025920 | Ga0207649_10000284 | Ga0207649_1000028427 | 216 |
| 516 | 3300025925 | Ga0207650_10002280 | Ga0207650_100022807 | 216 |
| 517 | 3300025926 | Ga0207659_10211222 | Ga0207659_102112222 | 216 |
| 518 | 3300025933 | Ga0207706_10049972 | Ga0207706_100499724 | 216 |
| 519 | 3300025934 | Ga0207686_10252160 | Ga0207686_102521602 | 216 |
| 520 | 3300025935 | Ga0207709_10244619 | Ga0207709_102446192 | 216 |
| 521 | 3300025940 | Ga0207691_10003915 | Ga0207691_1000391510 | 216 |
| 522 | 3300025940 | Ga0207691_10125097 | Ga0207691_101250973 | 216 |
| 523 | 3300025941 | Ga0207711_10257141 | Ga0207711_102571412 | 216 |
| 524 | 3300025960 | Ga0207651_10029706 | Ga0207651_100297062 | 216 |
| 525 | 3300025972 | Ga0207668_10086882 | Ga0207668_100868822 | 216 |
| 526 | 3300025986 | Ga0207658_10034454 | Ga0207658_100344543 | 216 |
| 527 | 3300026023 | Ga0207677_10020674 | Ga0207677_100206743 | 216 |
| 528 | 3300026035 | Ga0207703_10013371 | Ga0207703_100133716 | 216 |
| 529 | 3300026035 | Ga0207703_10072398 | Ga0207703_100723982 | 216 |
| 530 | 3300026088 | Ga0207641_10015952 | Ga0207641_100159524 | 216 |
| 531 | 3300026088 | Ga0207641_10039799 | Ga0207641_100397993 | 216 |
| 532 | 3300026088 | Ga0207641_10102875 | Ga0207641_101028752 | 216 |
| 533 | 3300026095 | Ga0207676_10005705 | Ga0207676_100057053 | 216 |
| 534 | 3300026095 | Ga0207676_10257604 | Ga0207676_102576042 | 216 |
| 535 | 3300028381 | Ga0268264_10117934 | Ga0268264_101179343 | 216 |
| 536 | 3300031250 | Ga0265331_10000002 | Ga0265331_10000002464 | 216 |
| 537 | 3300031250 | Ga0265331_10028117 | Ga0265331_100281173 | 216 |
| 538 | 3300031251 | Ga0265327_10000074 | Ga0265327_100000743 | 216 |
| 539 | 3300031711 | Ga0265314_10008922 | Ga0265314_100089229 | 216 |
| 540 | 3300031711 | Ga0265314_10055700 | Ga0265314_100557003 | 216 |
| 541 | 3300035113 | Ga0373936_0059557 | Ga0373936_0059557_374_1141 | 216 |
| 542 | 3300035172 | Ga0373955_0275809 | Ga0373955_0275809_43_750 | 216 |
| 543 | 3300046459 | Ga0495629_0146456 | Ga0495629_0146456_919_1626 | 216 |
| 544 | 3300046476 | Ga0495662_0094223 | Ga0495662_0094223_302_1009 | 216 |
| 545 | 3300046514 | Ga0495618_0191810 | Ga0495618_0191810_129_836 | 216 |
| 546 | 3300046535 | Ga0495586_0034542 | Ga0495586_0034542_1487_2194 | 216 |
| 547 | 3300046642 | Ga0495634_0166062 | Ga0495634_0166062_55_762 | 216 |
| 548 | 3300046678 | Ga0495599_0167828 | Ga0495599_0167828_209_916 | 216 |
| 549 | 3300046689 | Ga0495613_0414465 | Ga0495613_0414465_196_903 | 216 |
| 550 | 3300047319 | Ga0495674_0004659 | Ga0495674_0004659_10346_11053 | 216 |
| 551 | 3300049570 | Ga0501033_0250107 | Ga0501033_0250107_52_771 | 216 |
| 552 | 3300049572 | Ga0501036_0056776 | Ga0501036_0056776_516_1235 | 216 |
| 553 | 3300049573 | Ga0501037_0148839 | Ga0501037_0148839_393_1112 | 216 |
| 554 | 3300049574 | Ga0501038_0053727 | Ga0501038_0053727_409_1128 | 216 |
| 555 | 3300049575 | Ga0501039_0315619 | Ga0501039_0315619_306_1025 | 216 |
| 556 | 3300049580 | Ga0501046_0035056 | Ga0501046_0035056_1753_2490 | 216 |
| 557 | 3300049581 | Ga0501047_0058799 | Ga0501047_0058799_2479_3198 | 216 |
| 558 | 3300049586 | Ga0501070_0573833 | Ga0501070_0573833_29_742 | 216 |
| 559 | 3300049589 | Ga0501073_0076247 | Ga0501073_0076247_947_1666 | 216 |
| 560 | 3300049742 | Ga0501080_0020036 | Ga0501080_0020036_3178_3897 | 216 |
| 561 | 3300049823 | Ga0501044_0240000 | Ga0501044_0240000_955_1674 | 216 |
| 562 | 3300053085 | Ga0495619_0123350 | Ga0495619_0123350_249_956 | 216 |
| 563 | 3300060353 | Ga0501082_0658814 | Ga0501082_0658814_37_756 | 216 |
| 564 | iso_pu_bacteria | 2842922631 | 2842924198 | 216 |
| 565 | 3300005435 | Ga0070714_100007079 | Ga0070714_1000070792 | 218 |
| 566 | 3300005356 | Ga0070674_100330084 | Ga0070674_1003300841 | 219 |
| 567 | 3300006847 | Ga0075431_100313322 | Ga0075431_1003133221 | 219 |
| 568 | 3300006847 | Ga0075431_100375018 | Ga0075431_1003750182 | 219 |
| 569 | 3300006871 | Ga0075434_100661159 | Ga0075434_1006611592 | 219 |
| 570 | 3300025937 | Ga0207669_10299773 | Ga0207669_102997732 | 219 |
| 571 | 3300050510 | nmdc:mga06r32_718631_c1 | nmdc:mga06r32_718631_c1_217_936 | 219 |
| 572 | 3300003322 | rootL2_10084468 | rootL2_100844682 | 220 |
| 573 | 3300038705 | Ga0237819_00130 | Ga0237819_00130_16621_17307 | 223 |
| 574 | 2162886007 | SwRhRL2b_contig_3207873 | SwRhRL2b_0996.00002370 | 224 |
| 575 | 3300005289 | Ga0065704_10070205 | Ga0065704_1007020538 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gwb-assembly1.cif.gz_A-2 | crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 | 0.9504 | 50 | 203 |
| 7e43-assembly2.cif.gz_A | structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori | 0.9481 | 48 | 198 |
| 7e43-assembly1.cif.gz_B | structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori | 0.9431 | 48 | 198 |
| 5fa9-assembly1.cif.gz_A | bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola | 0.9413 | 48 | 200 |
| 3bqf-assembly1.cif.gz_A | structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) | 0.9394 | 47 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9426 | 50 | 196 | 3.30.1060.10 |
| af_P9WJM5_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9378 | 46 | 200 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.924 | 50 | 196 | 3.30.1060.10 |
| af_A4HTE0_2_175_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.917 | 47 | 200 | 3.30.1060.10 |
| af_B6TNT5_14_185_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9164 | 38 | 196 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5W4M2-F1-model_v4 | deleted | 0.9951 | 52 | 224 |
|
| AF-A0A0Q6KCK6-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9943 | 37 | 223 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-A0A529Y1Q5-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9907 | 74 | 224 |
GO:0008113
GO:0033744 |
| AF-A0A531KWY7-F1-model_v4 | deleted | 0.9903 | 42 | 224 |
|
| AF-A0A2R7T6Q3-F1-model_v4 | deleted | 0.9901 | 107 | 224 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar