F465474

General Info

Members Datasets Scaffolds Average Seq Length
576 294 1152 296

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10002353|JGI25405J52794_100023534
Length 347
Sequence MLRAPRAHDGIDMPEGDGRSAMPPGKAEIAMSGSLLETHKAQAQTWFEALRDDICAAFETLEADLPAGAPLADRAPGRFVRTPWSRTNHSGGQPTSDLPEIGNSSARSAKADPGGGGVMSIMKGRVFEKVGVHVSTVFGEFAPEFRKDIPGAEADPHFWASGISLIAHLHNPHVPAVHMNTRLVSTSKSWFGGGADLTPVLDARRRQDDPDTIAFHAAMXQACDAHARVAPYAKYKQWCDEYFYLKHRNEMRGIGGIFYDYLDSGDRAADFAFTQDVGRAFLRVYPELVRRNFATPWSEAEREEQLVRRGRYVEFNLLYDRGTIFGLRTGGNVDAILSSLPPVVKWP

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
272 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
281 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
282 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
283 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
284 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
285 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
286 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
287 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
288 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
289 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
290 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
291 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
292 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
293 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
294 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.21
Nodule 1.39
Rhizoplane 8.33
Rhizosphere 80.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10002353 3300003911 Bacteria 3245
2 JGI24741J21665_1011718 3300001915 Bacteria 1525
3 JGI24739J22299_10000994 3300001989 Bacteria 10559
4 JGI24737J22298_10002808 3300001990 Bacteria 6167
5 JGI25153J46596_10008989 3300003215 Bacteria 4704
6 Ga0070658_10362565 3300005327 Bacteria 1241
7 Ga0070683_100160309 3300005329 Bacteria 2134
8 Ga0070670_100007802 3300005331 Bacteria 9106
9 Ga0070660_100056216 3300005339 Bacteria 3044
10 Ga0070659_100032517 3300005366 Bacteria 4047
11 Ga0070709_10002579 3300005434 Bacteria 9800
12 Ga0070709_10005804 3300005434 Bacteria 6688
13 Ga0070714_100008494 3300005435 Bacteria 8025
14 Ga0070714_100058980 3300005435 Bacteria 3290
15 Ga0070714_100071409 3300005435 Bacteria 3001
16 Ga0070713_100017576 3300005436 Bacteria 5412
17 Ga0070713_100023787 3300005436 Bacteria 4761
18 Ga0070713_100247239 3300005436 Bacteria 1626
19 Ga0070710_10000243 3300005437 Bacteria 25537
20 Ga0070711_100005828 3300005439 Bacteria 7394
21 Ga0070711_100039692 3300005439 Bacteria 3172
22 Ga0070711_100138558 3300005439 Bacteria 1821
23 Ga0070705_100039351 3300005440 Bacteria 2682
24 Ga0070662_100246732 3300005457 Bacteria 1434
25 Ga0070681_10039210 3300005458 Bacteria 4749
26 Ga0070706_100144696 3300005467 Bacteria 2220
27 Ga0070699_100010972 3300005518 Bacteria 7834
28 Ga0070699_100203202 3300005518 Bacteria 1762
29 Ga0070684_100010118 3300005535 Bacteria 7458
30 Ga0070684_100593075 3300005535 Bacteria 1030
31 Ga0068853_100280940 3300005539 Bacteria 1535
32 Ga0070695_100223666 3300005545 Bacteria 1357
33 Ga0070696_100016750 3300005546 Bacteria 4943
34 Ga0070696_100042295 3300005546 Bacteria 3151
35 Ga0070696_100129063 3300005546 Bacteria 1838
36 Ga0070704_100007997 3300005549 Bacteria 6315
37 Ga0068855_100020255 3300005563 Bacteria 7984
38 Ga0068855_100093688 3300005563 Bacteria 3464
39 Ga0068855_100120346 3300005563 Bacteria 3005
40 Ga0068857_100010911 3300005577 Bacteria 7909
41 Ga0068856_100000477 3300005614 Bacteria 44284
42 Ga0068856_100013826 3300005614 Bacteria 7803
43 Ga0068856_100112772 3300005614 Bacteria 2717
44 Ga0068856_100283985 3300005614 Bacteria 1672
45 Ga0068852_100124265 3300005616 Bacteria 2367
46 Ga0068858_100178235 3300005842 Bacteria 2006
47 Ga0081455_10001871 3300005937 Bacteria 25308
48 Ga0081455_10003729 3300005937 Bacteria 17413
49 Ga0081455_10011253 3300005937 Bacteria 9002
50 Ga0081455_10016554 3300005937 Bacteria 7113
51 Ga0081455_10034433 3300005937 Bacteria 4537
52 Ga0081455_10049916 3300005937 Bacteria 3603
53 Ga0081455_10053665 3300005937 Bacteria 3442
54 Ga0081455_10058158 3300005937 Bacteria 3273
55 Ga0081455_10140953 3300005937 Bacteria 1872
56 Ga0081540_1003265 3300005983 Bacteria 12889
57 Ga0081540_1003527 3300005983 Bacteria 12331
58 Ga0081539_10021209 3300005985 Bacteria 4351
59 Ga0070717_10000485 3300006028 Bacteria 25249
60 Ga0070717_10019455 3300006028 Bacteria 5324
61 Ga0070717_10066017 3300006028 Bacteria 3009
62 Ga0075365_10019686 3300006038 Bacteria 4172
63 Ga0075365_10203565 3300006038 Bacteria 1387
64 Ga0075368_10014502 3300006042 Bacteria 2913
65 Ga0070715_10001137 3300006163 Bacteria 7597
66 Ga0070715_10034945 3300006163 Bacteria 2064
67 Ga0070716_100016960 3300006173 Bacteria 3768
68 Ga0070716_100034233 3300006173 Bacteria 2784
69 Ga0070712_100197660 3300006175 Bacteria 1577
70 Ga0075367_10077723 3300006178 Bacteria 2004
71 Ga0075369_10028272 3300006186 Bacteria 2349
72 Ga0075428_100015591 3300006844 Bacteria 8426
73 Ga0075428_100805365 3300006844 Bacteria 998
74 Ga0075431_100000105 3300006847 Bacteria 53256
75 Ga0075431_100015573 3300006847 Bacteria 7706
76 Ga0075431_100464292 3300006847 Bacteria 1260
77 Ga0075434_100031153 3300006871 Bacteria 5256
78 Ga0075434_100035379 3300006871 Bacteria 4938
79 Ga0075434_100076481 3300006871 Bacteria 3343
80 Ga0075434_100112512 3300006871 Bacteria 2734
81 Ga0075434_100221889 3300006871 Bacteria 1910
82 Ga0075429_100002470 3300006880 Bacteria 15552
83 Ga0075435_100014832 3300007076 Bacteria 5841
84 Ga0075435_100031407 3300007076 Bacteria 4184
85 Ga0099794_10078031 3300007265 Bacteria 1630
86 Ga0105240_10031140 3300009093 Bacteria 6922
87 Ga0105240_10056305 3300009093 Bacteria 4921
88 Ga0105240_10238864 3300009093 Bacteria 2107
89 Ga0105240_10302561 3300009093 Bacteria 1829
90 Ga0111539_10011548 3300009094 Bacteria 11084
91 Ga0111539_10089968 3300009094 Bacteria 3607
92 Ga0111539_10103829 3300009094 Bacteria 3335
93 Ga0111539_10621501 3300009094 Bacteria 1258
94 Ga0105247_10046504 3300009101 Bacteria 2664
95 Ga0105247_10247070 3300009101 Bacteria 1218
96 Ga0114129_10002163 3300009147 Bacteria 27081
97 Ga0114129_10024067 3300009147 Bacteria 8629
98 Ga0114129_10026177 3300009147 Bacteria 8259
99 Ga0114129_10539122 3300009147 Bacteria 1519
100 Ga0105241_10422157 3300009174 Bacteria 1174
101 Ga0105248_10086403 3300009177 Bacteria 3529
102 Ga0105237_10029563 3300009545 Bacteria 5568
103 Ga0105237_10061989 3300009545 Bacteria 3739
104 Ga0105238_10017548 3300009551 Bacteria 7278
105 Ga0105238_10031279 3300009551 Bacteria 5418
106 Ga0105238_10041663 3300009551 Bacteria 4650
107 Ga0105238_10314565 3300009551 Bacteria 1551
108 Ga0105249_10001791 3300009553 Bacteria 18701
109 Ga0105239_10027064 3300010375 Bacteria 6313
110 Ga0105239_10034795 3300010375 Bacteria 5533
111 Ga0105239_10062423 3300010375 Bacteria 4090
112 Ga0105239_10632444 3300010375 Bacteria 1222
113 Ga0105246_10185311 3300011119 Bacteria 1606
114 Ga0157371_10067033 3300013102 Bacteria 2541
115 Ga0157369_10007048 3300013105 Bacteria 12962
116 Ga0157374_10014870 3300013296 Bacteria 6820
117 Ga0157372_10047014 3300013307 Bacteria 4793
118 Ga0157372_10134443 3300013307 Bacteria 2847
119 Ga0157375_10467960 3300013308 Bacteria 1426
120 Ga0157375_10827417 3300013308 Bacteria 1074
121 Ga0163163_10011174 3300014325 Bacteria 8131
122 Ga0157379_10091639 3300014968 Bacteria 2726
123 Ga0182005_1004233 3300015265 Bacteria 4684
124 Ga0213876_10007688 3300021384 Bacteria 5852
125 Ga0209233_1000933 3300025261 Bacteria 12708
126 Ga0209758_1050096 3300025297 Bacteria 1468
127 Ga0207653_10108344 3300025885 Bacteria 989
128 Ga0207692_10000282 3300025898 Bacteria 17493
129 Ga0207692_10003656 3300025898 Bacteria 6025
130 Ga0207692_10005126 3300025898 Bacteria 5229
131 Ga0207685_10006711 3300025905 Bacteria 3157
132 Ga0207685_10017678 3300025905 Bacteria 2312
133 Ga0207699_10000577 3300025906 Bacteria 18050
134 Ga0207705_10012022 3300025909 Bacteria 6254
135 Ga0207684_10154662 3300025910 Bacteria 1974
136 Ga0207695_10040729 3300025913 Bacteria 4977
137 Ga0207695_10247058 3300025913 Bacteria 1684
138 Ga0207671_10040116 3300025914 Bacteria 3466
139 Ga0207671_10090609 3300025914 Bacteria 2303
140 Ga0207671_10177214 3300025914 Bacteria 1658
141 Ga0207693_10021249 3300025915 Bacteria 5158
142 Ga0207663_10001206 3300025916 Bacteria 11940
143 Ga0207663_10008914 3300025916 Bacteria 5276
144 Ga0207657_10002856 3300025919 Bacteria 18574
145 Ga0207652_10063657 3300025921 Bacteria 3190
146 Ga0207694_10012428 3300025924 Bacteria 6417
147 Ga0207694_10017237 3300025924 Bacteria 5458
148 Ga0207694_10043771 3300025924 Bacteria 3456
149 Ga0207650_10060570 3300025925 Bacteria 2825
150 Ga0207700_10000848 3300025928 Bacteria 17629
151 Ga0207700_10013608 3300025928 Bacteria 5301
152 Ga0207700_10061229 3300025928 Bacteria 2854
153 Ga0207700_10205510 3300025928 Bacteria 1662
154 Ga0207700_10248908 3300025928 Bacteria 1518
155 Ga0207664_10006915 3300025929 Bacteria 7848
156 Ga0207664_10012974 3300025929 Bacteria 5970
157 Ga0207664_10112013 3300025929 Bacteria 2271
158 Ga0207665_10004132 3300025939 Bacteria 9671
159 Ga0207665_10013741 3300025939 Bacteria 5325
160 Ga0207665_10038971 3300025939 Bacteria 3166
161 Ga0207711_10033638 3300025941 Bacteria 4339
162 Ga0207661_10001720 3300025944 Bacteria 14979
163 Ga0207661_10278370 3300025944 Bacteria 1495
164 Ga0207667_10022560 3300025949 Bacteria 6950
165 Ga0207667_10061306 3300025949 Bacteria 3935
166 Ga0207667_10200742 3300025949 Bacteria 2046
167 Ga0207667_10543958 3300025949 Bacteria 1175
168 Ga0207712_10009741 3300025961 Bacteria 6089
169 Ga0207703_10122438 3300026035 Bacteria 2235
170 Ga0207678_10091745 3300026067 Bacteria 2596
171 Ga0207678_10234204 3300026067 Bacteria 1572
172 Ga0207702_10000744 3300026078 Bacteria 34789
173 Ga0207702_10046859 3300026078 Bacteria 3641
174 Ga0207702_10106923 3300026078 Bacteria 2480
175 Ga0207702_10189788 3300026078 Bacteria 1898
176 Ga0207676_10328372 3300026095 Bacteria 1407
177 Ga0207674_10017516 3300026116 Bacteria 7815
178 Ga0207698_10207371 3300026142 Bacteria 1760
179 Ga0207428_10012894 3300027907 Bacteria 7329
180 Ga0207428_10054962 3300027907 Bacteria 3168
181 Ga0265334_10015714 3300028573 Bacteria 3141
182 Ga0265336_10002175 3300028666 Bacteria 8281
183 Ga0265338_10000116 3300028800 Bacteria 146839
184 Ga0265324_10004388 3300029957 Bacteria 6398
185 Ga0265330_10017046 3300031235 Bacteria 3349
186 Ga0265332_10037816 3300031238 Bacteria 2093
187 Ga0265328_10020747 3300031239 Bacteria 2513
188 Ga0265328_10028367 3300031239 Bacteria 2094
189 Ga0265325_10033747 3300031241 Bacteria 2727
190 Ga0265325_10173613 3300031241 Bacteria 1007
191 Ga0265340_10007199 3300031247 Bacteria 6057
192 Ga0265340_10044483 3300031247 Bacteria 2172
193 Ga0265339_10005164 3300031249 Bacteria 8751
194 Ga0265339_10024640 3300031249 Bacteria 3464
195 Ga0265316_10005377 3300031344 Bacteria 12459
196 Ga0307509_10158340 3300031507 Bacteria 2167
197 Ga0265313_10009058 3300031595 Bacteria 6516
198 Ga0307508_10000008 3300031616 Bacteria 265023
199 Ga0265342_10006821 3300031712 Bacteria 8441
200 Ga0307516_10066581 3300031730 Bacteria 3474
201 Ga0307507_10204366 3300033179 Bacteria 1360
202 Ga0373926_0077522 3300035083 Bacteria 1226
203 Ga0373923_0087526 3300035111 Bacteria 1359
204 Ga0373936_0000741 3300035113 Bacteria 11445
205 Ga0373945_0004474 3300035116 Bacteria 4443
206 Ga0373953_0002125 3300035117 Bacteria 5926
207 Ga0373954_0000381 3300035118 Bacteria 16501
208 Ga0373954_0002341 3300035118 Bacteria 7915
209 Ga0373956_0020178 3300035119 Bacteria 2833
210 Ga0373956_0028172 3300035119 Bacteria 2443
211 Ga0373957_0007751 3300035120 Bacteria 3448
212 Ga0373943_0007879 3300035170 Bacteria 4781
213 Ga0373943_0020836 3300035170 Bacteria 3026
214 Ga0373943_0147219 3300035170 Bacteria 1273
215 Ga0373946_0001413 3300035171 Bacteria 8330
216 Ga0373946_0111034 3300035171 Bacteria 1241
217 Ga0373955_0000504 3300035172 Bacteria 16576
218 Ga0373955_0210592 3300035172 Bacteria 1159
219 Ga0373961_0009070 3300035241 Bacteria 2428
220 Ga0373962_0034220 3300035242 Bacteria 1406
221 Ga0373924_0000932 3300035410 Bacteria 9223
222 Ga0373931_0017094 3300035691 Bacteria 3580
223 Ga0373935_0000038 3300035692 Bacteria 51446
224 Ga0373935_0061409 3300035692 Bacteria 2406
225 Ga0373935_0180986 3300035692 Bacteria 1447
226 Ga0373935_0228156 3300035692 Bacteria 1296
227 Ga0373935_0366764 3300035692 Bacteria 1029
228 Ga0373935_0371763 3300035692 Bacteria 1022
229 Ga0373927_0031221 3300035695 Bacteria 3473
230 Ga0373927_0039237 3300035695 Bacteria 3073
231 Ga0373927_0046710 3300035695 Bacteria 2801
232 Ga0373927_0200405 3300035695 Bacteria 1310
233 Ga0373933_0007615 3300035724 Bacteria 5912
234 Ga0373947_0000229 3300035725 Bacteria 31423
235 Ga0373947_0126027 3300035725 Bacteria 1631
236 Ga0373947_0143869 3300035725 Bacteria 1531
237 Ga0373937_0000004 3300036401 Bacteria 212269
238 Ga0373937_0001725 3300036401 Bacteria 18379
239 Ga0373925_0290686 3300037068 Bacteria 1318
240 Ga0395900_0107503 3300037418 Bacteria 2866
241 Ga0395900_0122865 3300037418 Bacteria 2663
242 Ga0395898_0006221 3300037466 Bacteria 12787
243 Ga0436364_0817478 3300037853 Bacteria 3584
244 Ga0395901_0074714 3300038443 Bacteria 3536
245 Ga0395901_0111508 3300038443 Bacteria 2873
246 Ga0395901_0315186 3300038443 Bacteria 1619
247 Ga0436365_0271615 3300039437 Bacteria 1358
248 Ga0436365_0788813 3300039437 Bacteria 7082
249 Ga0436361_0407903 3300039447 Bacteria 3899
250 Ga0436363_0335225 3300039450 Bacteria 1460
251 Ga0439465_0002288 3300041413 Bacteria 6290
252 Ga0451807_1983576 3300041486 Bacteria 1927
253 Ga0466966_0260931 3300044684 Bacteria 1043
254 Ga0466963_0121054 3300044694 Bacteria 1801
255 Ga0466959_0027870 3300045049 Bacteria 4190
256 Ga0466959_0133557 3300045049 Bacteria 1758
257 Ga0495603_0002928 3300046455 Bacteria 10092
258 Ga0495603_0016023 3300046455 Bacteria 4532
259 Ga0495603_0179929 3300046455 Bacteria 1223
260 Ga0495629_0001232 3300046459 Bacteria 20103
261 Ga0495629_0055936 3300046459 Bacteria 2759
262 Ga0495638_0027817 3300046460 Bacteria 3657
263 Ga0495641_0088667 3300046461 Bacteria 1383
264 Ga0495651_0000799 3300046462 Bacteria 24378
265 Ga0495651_0001901 3300046462 Bacteria 16158
266 Ga0495651_0034560 3300046462 Bacteria 3940
267 Ga0495651_0115534 3300046462 Bacteria 1979
268 Ga0495651_0123862 3300046462 Bacteria 1895
269 Ga0495653_0000012 3300046463 Bacteria 266880
270 Ga0495653_0001172 3300046463 Bacteria 20251
271 Ga0495653_0018454 3300046463 Bacteria 5664
272 Ga0495580_0068755 3300046472 Bacteria 2476
273 Ga0495582_0031519 3300046473 Bacteria 2914
274 Ga0495639_0027847 3300046475 Bacteria 2502
275 Ga0495639_0047220 3300046475 Bacteria 1950
276 Ga0495662_0020452 3300046476 Bacteria 3202
277 Ga0495662_0032039 3300046476 Bacteria 2539
278 Ga0495664_0000004 3300046477 Bacteria 489411
279 Ga0495664_0119968 3300046477 Bacteria 1590
280 Ga0495585_0092313 3300046492 Bacteria 1629
281 Ga0495608_0000017 3300046511 Bacteria 192929
282 Ga0495608_0000272 3300046511 Bacteria 36948
283 Ga0495618_0000006 3300046514 Bacteria 229906
284 Ga0495628_0000001 3300046516 Bacteria 917742
285 Ga0495628_0021841 3300046516 Bacteria 5260
286 Ga0495628_0304198 3300046516 Bacteria 1180
287 Ga0495630_0005871 3300046517 Bacteria 8684
288 Ga0495630_0163928 3300046517 Bacteria 1692
289 Ga0495652_0000002 3300046529 Bacteria 946606
290 Ga0495652_0045854 3300046529 Bacteria 3755
291 Ga0495652_0333000 3300046529 Bacteria 1093
292 Ga0495665_0022181 3300046531 Bacteria 3414
293 Ga0495640_0000001 3300046533 Bacteria 853827
294 Ga0495587_0000008 3300046536 Bacteria 271097
295 Ga0495587_0007120 3300046536 Bacteria 7256
296 Ga0495598_0001843 3300046537 Bacteria 4269
297 Ga0495645_0000002 3300046543 Bacteria 651644
298 Ga0495645_0135871 3300046543 Bacteria 1720
299 Ga0495633_0077761 3300046558 Bacteria 1545
300 Ga0495667_0000124 3300046559 Bacteria 55660
301 Ga0495667_0011432 3300046559 Bacteria 6006
302 Ga0495667_0061363 3300046559 Bacteria 2465
303 Ga0495656_0004314 3300046615 Bacteria 4861
304 Ga0495668_0160577 3300046616 Bacteria 1231
305 Ga0495634_0000003 3300046642 Bacteria 206222
306 Ga0495634_0014482 3300046642 Bacteria 5685
307 Ga0495635_0000002 3300046663 Bacteria 490490
308 Ga0495635_0000500 3300046663 Bacteria 24766
309 Ga0495635_0004998 3300046663 Bacteria 9230
310 Ga0495635_0174731 3300046663 Bacteria 1460
311 Ga0495588_0170737 3300046674 Bacteria 1150
312 Ga0495657_0000054 3300046675 Bacteria 99620
313 Ga0495657_0014481 3300046675 Bacteria 5789
314 Ga0495657_0034655 3300046675 Bacteria 3504
315 Ga0495657_0229789 3300046675 Bacteria 1122
316 Ga0495599_0000005 3300046678 Bacteria 300169
317 Ga0495599_0018645 3300046678 Bacteria 4323
318 Ga0495623_0000148 3300046679 Bacteria 43192
319 Ga0495623_0005093 3300046679 Bacteria 8622
320 Ga0495646_0000002 3300046680 Bacteria 310568
321 Ga0495647_0004214 3300046681 Bacteria 4657
322 Ga0495658_0002178 3300046683 Bacteria 9911
323 Ga0495658_0006226 3300046683 Bacteria 5863
324 Ga0495669_0059400 3300046684 Bacteria 1727
325 Ga0495613_0014301 3300046689 Bacteria 5889
326 Ga0495613_0015932 3300046689 Bacteria 5597
327 Ga0495613_0102094 3300046689 Bacteria 2071
328 Ga0495624_0008567 3300046690 Bacteria 7121
329 Ga0495624_0056351 3300046690 Bacteria 2473
330 Ga0495624_0068661 3300046690 Bacteria 2209
331 Ga0495624_0127588 3300046690 Bacteria 1560
332 Ga0495670_0011251 3300046691 Bacteria 4398
333 Ga0495589_0122430 3300046794 Bacteria 1252
334 Ga0495600_0000012 3300046809 Bacteria 119798
335 Ga0495600_0001148 3300046809 Bacteria 14481
336 Ga0495581_0026555 3300047315 Bacteria 3356
337 Ga0495604_0000009 3300047317 Bacteria 326341
338 Ga0495604_0004436 3300047317 Bacteria 11115
339 Ga0495604_0051100 3300047317 Bacteria 3206
340 Ga0495674_0000002 3300047319 Bacteria 642785
341 Ga0495680_0001385 3300047322 Bacteria 26203
342 Ga0495680_0001508 3300047322 Bacteria 24960
343 Ga0495675_0000028 3300047444 Bacteria 105848
344 Ga0495675_0000362 3300047444 Bacteria 31645
345 Ga0495684_0000006 3300047471 Bacteria 247568
346 Ga0495684_0028479 3300047471 Bacteria 4288
347 Ga0495684_0248044 3300047471 Bacteria 1296
348 Ga0495686_0023990 3300047472 Bacteria 4012
349 Ga0495593_0000140 3300047673 Bacteria 35205
350 Ga0495593_0050350 3300047673 Bacteria 2207
351 Ga0495602_0000005 3300048088 Bacteria 325957
352 Ga0495602_0005892 3300048088 Bacteria 12874
353 Ga0495602_0042945 3300048088 Bacteria 4115
354 Ga0495602_0122658 3300048088 Bacteria 2088
355 Ga0495614_0084288 3300048089 Bacteria 1379
356 Ga0496100_0015421 3300048903 Bacteria 4462
357 Ga0496100_0029450 3300048903 Bacteria 3396
358 Ga0496100_0041015 3300048903 Bacteria 2948
359 Ga0496100_0171275 3300048903 Bacteria 1564
360 Ga0496101_0002395 3300048904 Bacteria 11503
361 Ga0496101_0010276 3300048904 Bacteria 6179
362 Ga0496102_0002614 3300048905 Bacteria 15316
363 Ga0496102_0089830 3300048905 Bacteria 2842
364 Ga0496102_0215790 3300048905 Bacteria 1808
365 Ga0496103_0021349 3300048906 Bacteria 3894
366 Ga0496104_0021951 3300048907 Bacteria 5863
367 Ga0496104_0066189 3300048907 Bacteria 3430
368 Ga0496104_0091129 3300048907 Bacteria 2913
369 Ga0496105_0003019 3300048908 Bacteria 12365
370 Ga0496105_0007082 3300048908 Bacteria 8644
371 Ga0496105_0013076 3300048908 Bacteria 6581
372 Ga0496105_0032830 3300048908 Bacteria 4260
373 Ga0496106_0001912 3300048909 Bacteria 15607
374 Ga0496106_0003207 3300048909 Bacteria 12247
375 Ga0496106_0018657 3300048909 Bacteria 5135
376 Ga0496106_0061023 3300048909 Bacteria 2859
377 Ga0496106_0079659 3300048909 Bacteria 2515
378 Ga0496107_0000684 3300048910 Bacteria 19232
379 Ga0496107_0008466 3300048910 Bacteria 7119
380 Ga0496108_0000951 3300048911 Bacteria 22499
381 Ga0496108_0002201 3300048911 Bacteria 15605
382 Ga0496109_0036779 3300048912 Bacteria 4420
383 Ga0496109_0109183 3300048912 Bacteria 2571
384 Ga0496109_0174491 3300048912 Bacteria 2017
385 Ga0496110_0025021 3300048913 Bacteria 5096
386 Ga0496110_0049864 3300048913 Bacteria 3674
387 Ga0496110_0177180 3300048913 Bacteria 1935
388 Ga0496111_0007619 3300048914 Bacteria 7113
389 Ga0496111_0088518 3300048914 Bacteria 2268
390 Ga0496112_0006785 3300048915 Bacteria 10091
391 Ga0496112_0023680 3300048915 Bacteria 5872
392 Ga0496112_0085546 3300048915 Bacteria 3120
393 Ga0496113_0000043 3300048916 Bacteria 52544
394 Ga0496113_0003867 3300048916 Bacteria 9067
395 Ga0496113_0017042 3300048916 Bacteria 5033
396 Ga0496114_0029897 3300048917 Bacteria 4479
397 Ga0496114_0072474 3300048917 Bacteria 2897
398 Ga0496114_0098816 3300048917 Bacteria 2489
399 Ga0496115_0017339 3300048918 Bacteria 5503
400 Ga0496115_0130197 3300048918 Bacteria 2074
401 Ga0496115_0136450 3300048918 Bacteria 2023
402 Ga0496118_0008409 3300048921 Bacteria 10672
403 Ga0496119_0038526 3300048922 Bacteria 3087
404 Ga0496120_0007337 3300048923 Bacteria 8224
405 Ga0496121_0000104 3300048924 Bacteria 192186
406 Ga0496121_0000365 3300048924 Bacteria 92822
407 Ga0496121_0000881 3300048924 Bacteria 54361
408 Ga0496121_0001293 3300048924 Bacteria 43066
409 Ga0496121_0221079 3300048924 Bacteria 1334
410 Ga0496122_0019295 3300048925 Bacteria 6237
411 Ga0496124_0002671 3300048927 Bacteria 22854
412 Ga0496124_0029811 3300048927 Bacteria 4854
413 Ga0496124_0286484 3300048927 Bacteria 1198
414 Ga0496125_0019036 3300048928 Bacteria 6496
415 Ga0496126_0009177 3300048929 Bacteria 10550
416 Ga0496126_0080901 3300048929 Bacteria 2873
417 Ga0496126_0110937 3300048929 Bacteria 2389
418 Ga0496126_0233642 3300048929 Bacteria 1539
419 Ga0501031_0002596 3300049568 Bacteria 11509
420 Ga0501032_0000366 3300049569 Bacteria 37562
421 Ga0501032_0098879 3300049569 Bacteria 1933
422 Ga0501033_0000707 3300049570 Bacteria 30694
423 Ga0501033_0089241 3300049570 Bacteria 2255
424 Ga0501034_0000332 3300049571 Bacteria 82900
425 Ga0501034_0009154 3300049571 Bacteria 10389
426 Ga0501034_0029876 3300049571 Bacteria 5540
427 Ga0501034_0049799 3300049571 Bacteria 4227
428 Ga0501034_0051508 3300049571 Bacteria 4151
429 Ga0501036_0000220 3300049572 Bacteria 38322
430 Ga0501036_0053292 3300049572 Bacteria 3426
431 Ga0501036_0069688 3300049572 Bacteria 2974
432 Ga0501037_0000054 3300049573 Bacteria 109898
433 Ga0501037_0001926 3300049573 Bacteria 15044
434 Ga0501037_0051222 3300049573 Bacteria 3020
435 Ga0501038_0002737 3300049574 Bacteria 16426
436 Ga0501038_0055484 3300049574 Bacteria 3403
437 Ga0501038_0062439 3300049574 Bacteria 3183
438 Ga0501038_0063864 3300049574 Bacteria 3142
439 Ga0501038_0069285 3300049574 Bacteria 2996
440 Ga0501038_0134334 3300049574 Bacteria 2028
441 Ga0501038_0137169 3300049574 Bacteria 2003
442 Ga0501038_0451786 3300049574 Bacteria 988
443 Ga0501039_0475807 3300049575 Bacteria 981
444 Ga0501043_0000338 3300049579 Bacteria 42452
445 Ga0501043_0018792 3300049579 Bacteria 5424
446 Ga0501043_0026568 3300049579 Bacteria 4542
447 Ga0501043_0037069 3300049579 Bacteria 3836
448 Ga0501043_0130559 3300049579 Bacteria 1969
449 Ga0501043_0383847 3300049579 Bacteria 1063
450 Ga0501046_0000011 3300049580 Bacteria 326457
451 Ga0501046_0000087 3300049580 Bacteria 99252
452 Ga0501047_0001092 3300049581 Bacteria 27014
453 Ga0501047_0026666 3300049581 Bacteria 5561
454 Ga0501047_0052499 3300049581 Bacteria 3940
455 Ga0501047_0060428 3300049581 Bacteria 3657
456 Ga0501047_0236321 3300049581 Bacteria 1679
457 Ga0501048_0001217 3300049582 Bacteria 19492
458 Ga0501048_0009539 3300049582 Bacteria 7285
459 Ga0501067_0001618 3300049583 Bacteria 12343
460 Ga0501067_0065573 3300049583 Bacteria 2010
461 Ga0501068_0000069 3300049584 Bacteria 40615
462 Ga0501069_0007811 3300049585 Bacteria 5616
463 Ga0501070_0045569 3300049586 Bacteria 3647
464 Ga0501070_0047258 3300049586 Bacteria 3578
465 Ga0501070_0195930 3300049586 Bacteria 1659
466 Ga0501070_0381089 3300049586 Bacteria 1142
467 Ga0501070_0417179 3300049586 Bacteria 1084
468 Ga0501071_0049661 3300049587 Bacteria 3020
469 Ga0501072_0010024 3300049588 Bacteria 7207
470 Ga0501072_0045316 3300049588 Bacteria 3457
471 Ga0501073_0000112 3300049589 Bacteria 52280
472 Ga0501073_0007067 3300049589 Bacteria 8363
473 Ga0501073_0019544 3300049589 Bacteria 4889
474 Ga0501073_0027377 3300049589 Bacteria 4076
475 Ga0501073_0035773 3300049589 Bacteria 3528
476 Ga0501073_0133750 3300049589 Bacteria 1719
477 Ga0501074_0003367 3300049590 Bacteria 11324
478 Ga0501074_0015427 3300049590 Bacteria 5553
479 Ga0501074_0020775 3300049590 Bacteria 4770
480 Ga0501074_0131798 3300049590 Bacteria 1788
481 Ga0501079_0001029 3300049741 Bacteria 19331
482 Ga0501079_0180654 3300049741 Bacteria 1646
483 Ga0501079_0319383 3300049741 Bacteria 1216
484 Ga0501080_0001149 3300049742 Bacteria 21844
485 Ga0501080_0003274 3300049742 Bacteria 14300
486 Ga0501080_0060868 3300049742 Bacteria 3515
487 Ga0501080_0063417 3300049742 Bacteria 3439
488 Ga0501080_0099160 3300049742 Bacteria 2703
489 Ga0501080_0118209 3300049742 Bacteria 2457
490 Ga0501080_0144572 3300049742 Bacteria 2198
491 Ga0501083_0008891 3300049744 Bacteria 7093
492 Ga0501083_0009300 3300049744 Bacteria 6937
493 Ga0501083_0022562 3300049744 Bacteria 4368
494 Ga0501083_0049616 3300049744 Bacteria 2828
495 Ga0501083_0197461 3300049744 Bacteria 1312
496 Ga0501035_0001855 3300049822 Bacteria 21278
497 Ga0501035_0014587 3300049822 Bacteria 7252
498 Ga0501035_0016398 3300049822 Bacteria 6834
499 Ga0501035_0044722 3300049822 Bacteria 3986
500 Ga0501035_0081878 3300049822 Bacteria 2848
501 Ga0501035_0157443 3300049822 Bacteria 1968
502 Ga0501044_0000163 3300049823 Bacteria 82581
503 Ga0501044_0012345 3300049823 Bacteria 9247
504 Ga0501044_0038026 3300049823 Bacteria 5026
505 Ga0501044_0049022 3300049823 Bacteria 4359
506 Ga0501044_0160361 3300049823 Bacteria 2226
507 Ga0501045_0003296 3300049824 Bacteria 11026
508 nmdc:mga00v17_21264_c1 3300050491 Bacteria 3728
509 nmdc:mga0yw44_1178_c1 3300050492 Bacteria 10193
510 nmdc:mga0yw44_215220_c1 3300050492 Bacteria 1272
511 nmdc:mga0yw44_28448_c1 3300050492 Bacteria 3215
512 nmdc:mga06z11_32863_c1 3300050494 Bacteria 2533
513 nmdc:mga04h51_21686_c1 3300050495 Bacteria 1935
514 nmdc:mga05p37_140_c1 3300050507 Bacteria 67571
515 nmdc:mga05p37_267187_c1 3300050507 Bacteria 2045
516 nmdc:mga05p37_533808_c1 3300050507 Bacteria 1339
517 nmdc:mga09592_1649_c1 3300050508 Bacteria 17953
518 nmdc:mga06r32_107119_c1 3300050510 Bacteria 2746
519 nmdc:mga06r32_719_c1 3300050510 Bacteria 29006
520 nmdc:mga08y16_104_c1 3300050511 Bacteria 70280
521 nmdc:mga08y16_7940_c1 3300050511 Bacteria 11107
522 nmdc:mga0n895_150524_c1 3300050512 Bacteria 2357
523 nmdc:mga0n895_234560_c1 3300050512 Bacteria 1862
524 nmdc:mga0n895_296488_c1 3300050512 Bacteria 1639
525 nmdc:mga0n895_3613_c1 3300050512 Bacteria 12500
526 nmdc:mga0n895_80372_c1 3300050512 Bacteria 3248
527 nmdc:mga0n895_94631_c1 3300050512 Bacteria 2991
528 nmdc:mga0rr50_249584_c1 3300050513 Bacteria 1473
529 nmdc:mga0rr50_38037_c1 3300050513 Bacteria 3478
530 nmdc:mga0sz30_56585_c1 3300050516 Bacteria 1670
531 Ga0495601_0000002 3300053077 Bacteria 528704
532 Ga0495601_0001735 3300053077 Bacteria 12053
533 Ga0495601_0247737 3300053077 Bacteria 1163
534 Ga0495612_0000010 3300053078 Bacteria 227618
535 Ga0495612_0066243 3300053078 Bacteria 1501
536 Ga0500635_0001213 3300053080 Bacteria 6165
537 Ga0495595_0000026 3300053084 Bacteria 99949
538 Ga0495619_0000019 3300053085 Bacteria 209518
539 Ga0495619_0000743 3300053085 Bacteria 21213
540 Ga0495619_0038918 3300053085 Bacteria 3103
541 Ga0500566_0001828 3300053094 Bacteria 12511
542 Ga0500566_0172451 3300053094 Bacteria 1117
543 Ga0500641_0016917 3300053096 Bacteria 2719
544 Ga0500648_036088 3300053097 Bacteria 2798
545 Ga0500562_036998 3300053108 Bacteria 1295
546 Ga0500597_121197 3300053120 Bacteria 1133
547 Ga0500559_0031655 3300053136 Bacteria 2269
548 Ga0500573_0025465 3300053140 Bacteria 3401
549 Ga0500603_000400 3300053150 Bacteria 11359
550 Ga0500604_0026077 3300053151 Bacteria 1683
551 Ga0500616_0015009 3300053153 Bacteria 4439
552 Ga0500616_0046623 3300053153 Bacteria 2303
553 Ga0500636_0066452 3300053177 Bacteria 2096
554 Ga0500637_0001951 3300053178 Bacteria 8975
555 Ga0501084_0012713 3300054114 Bacteria 6973
556 Ga0501084_0013592 3300054114 Bacteria 6737
557 Ga0501084_0067860 3300054114 Bacteria 2985
558 Ga0501082_0015541 3300060353 Bacteria 6554
559 Ga0501082_0138331 3300060353 Bacteria 2113
560 Ga0501082_0230013 3300060353 Bacteria 1614
561 Ga0530510_0239553 3300061734 Bacteria 1350
562 2509148800 2508501128 Bacteria 8613869
563 2513591496 2513237087 Bacteria 5817514
564 2585166009 2582581283 Bacteria 6030556
565 2671122074 2667528175 Bacteria 7532676
566 2671692204 2671180139 Bacteria 4196045
567 2837654628 2837651117 Bacteria 3772164
568 2879103309 2879099564 Bacteria 10442239
569 2885410118 2885409591 Bacteria 9235467
570 2894777563 2894772417 Bacteria 5305674
571 2904698741 2904690495 Bacteria 9412302
572 2908740996 2908739725 Bacteria 8628932
573 2908759255 2908756301 Bacteria 8864324
574 2917557318 2917554339 Bacteria 4987857
575 643604169 643348564 Bacteria 8839022
576 8056690331 8056689827 Bacteria 6712655
577 JGI25405J52794_10002353
578 JGI24741J21665_1011718
579 JGI24739J22299_10000994
580 JGI24737J22298_10002808
581 JGI25153J46596_10008989
582 Ga0070658_10362565
583 Ga0070683_100160309
584 Ga0070670_100007802
585 Ga0070660_100056216
586 Ga0070659_100032517
587 Ga0070709_10002579
588 Ga0070709_10005804
589 Ga0070714_100008494
590 Ga0070714_100058980
591 Ga0070714_100071409
592 Ga0070713_100017576
593 Ga0070713_100023787
594 Ga0070713_100247239
595 Ga0070710_10000243
596 Ga0070711_100005828
597 Ga0070711_100039692
598 Ga0070711_100138558
599 Ga0070705_100039351
600 Ga0070662_100246732
601 Ga0070681_10039210
602 Ga0070706_100144696
603 Ga0070699_100010972
604 Ga0070699_100203202
605 Ga0070684_100010118
606 Ga0070684_100593075
607 Ga0068853_100280940
608 Ga0070695_100223666
609 Ga0070696_100016750
610 Ga0070696_100042295
611 Ga0070696_100129063
612 Ga0070704_100007997
613 Ga0068855_100020255
614 Ga0068855_100093688
615 Ga0068855_100120346
616 Ga0068857_100010911
617 Ga0068856_100000477
618 Ga0068856_100013826
619 Ga0068856_100112772
620 Ga0068856_100283985
621 Ga0068852_100124265
622 Ga0068858_100178235
623 Ga0081455_10001871
624 Ga0081455_10003729
625 Ga0081455_10011253
626 Ga0081455_10016554
627 Ga0081455_10034433
628 Ga0081455_10049916
629 Ga0081455_10053665
630 Ga0081455_10058158
631 Ga0081455_10140953
632 Ga0081540_1003265
633 Ga0081540_1003527
634 Ga0081539_10021209
635 Ga0070717_10000485
636 Ga0070717_10019455
637 Ga0070717_10066017
638 Ga0075365_10019686
639 Ga0075365_10203565
640 Ga0075368_10014502
641 Ga0070715_10001137
642 Ga0070715_10034945
643 Ga0070716_100016960
644 Ga0070716_100034233
645 Ga0070712_100197660
646 Ga0075367_10077723
647 Ga0075369_10028272
648 Ga0075428_100015591
649 Ga0075428_100805365
650 Ga0075431_100000105
651 Ga0075431_100015573
652 Ga0075431_100464292
653 Ga0075434_100031153
654 Ga0075434_100035379
655 Ga0075434_100076481
656 Ga0075434_100112512
657 Ga0075434_100221889
658 Ga0075429_100002470
659 Ga0075435_100014832
660 Ga0075435_100031407
661 Ga0099794_10078031
662 Ga0105240_10031140
663 Ga0105240_10056305
664 Ga0105240_10238864
665 Ga0105240_10302561
666 Ga0111539_10011548
667 Ga0111539_10089968
668 Ga0111539_10103829
669 Ga0111539_10621501
670 Ga0105247_10046504
671 Ga0105247_10247070
672 Ga0114129_10002163
673 Ga0114129_10024067
674 Ga0114129_10026177
675 Ga0114129_10539122
676 Ga0105241_10422157
677 Ga0105248_10086403
678 Ga0105237_10029563
679 Ga0105237_10061989
680 Ga0105238_10017548
681 Ga0105238_10031279
682 Ga0105238_10041663
683 Ga0105238_10314565
684 Ga0105249_10001791
685 Ga0105239_10027064
686 Ga0105239_10034795
687 Ga0105239_10062423
688 Ga0105239_10632444
689 Ga0105246_10185311
690 Ga0157371_10067033
691 Ga0157369_10007048
692 Ga0157374_10014870
693 Ga0157372_10047014
694 Ga0157372_10134443
695 Ga0157375_10467960
696 Ga0157375_10827417
697 Ga0163163_10011174
698 Ga0157379_10091639
699 Ga0182005_1004233
700 Ga0213876_10007688
701 Ga0209233_1000933
702 Ga0209758_1050096
703 Ga0207653_10108344
704 Ga0207692_10000282
705 Ga0207692_10003656
706 Ga0207692_10005126
707 Ga0207685_10006711
708 Ga0207685_10017678
709 Ga0207699_10000577
710 Ga0207705_10012022
711 Ga0207684_10154662
712 Ga0207695_10040729
713 Ga0207695_10247058
714 Ga0207671_10040116
715 Ga0207671_10090609
716 Ga0207671_10177214
717 Ga0207693_10021249
718 Ga0207663_10001206
719 Ga0207663_10008914
720 Ga0207657_10002856
721 Ga0207652_10063657
722 Ga0207694_10012428
723 Ga0207694_10017237
724 Ga0207694_10043771
725 Ga0207650_10060570
726 Ga0207700_10000848
727 Ga0207700_10013608
728 Ga0207700_10061229
729 Ga0207700_10205510
730 Ga0207700_10248908
731 Ga0207664_10006915
732 Ga0207664_10012974
733 Ga0207664_10112013
734 Ga0207665_10004132
735 Ga0207665_10013741
736 Ga0207665_10038971
737 Ga0207711_10033638
738 Ga0207661_10001720
739 Ga0207661_10278370
740 Ga0207667_10022560
741 Ga0207667_10061306
742 Ga0207667_10200742
743 Ga0207667_10543958
744 Ga0207712_10009741
745 Ga0207703_10122438
746 Ga0207678_10091745
747 Ga0207678_10234204
748 Ga0207702_10000744
749 Ga0207702_10046859
750 Ga0207702_10106923
751 Ga0207702_10189788
752 Ga0207676_10328372
753 Ga0207674_10017516
754 Ga0207698_10207371
755 Ga0207428_10012894
756 Ga0207428_10054962
757 Ga0265334_10015714
758 Ga0265336_10002175
759 Ga0265338_10000116
760 Ga0265324_10004388
761 Ga0265330_10017046
762 Ga0265332_10037816
763 Ga0265328_10020747
764 Ga0265328_10028367
765 Ga0265325_10033747
766 Ga0265325_10173613
767 Ga0265340_10007199
768 Ga0265340_10044483
769 Ga0265339_10005164
770 Ga0265339_10024640
771 Ga0265316_10005377
772 Ga0307509_10158340
773 Ga0265313_10009058
774 Ga0307508_10000008
775 Ga0265342_10006821
776 Ga0307516_10066581
777 Ga0307507_10204366
778 Ga0373926_0077522
779 Ga0373923_0087526
780 Ga0373936_0000741
781 Ga0373945_0004474
782 Ga0373953_0002125
783 Ga0373954_0000381
784 Ga0373954_0002341
785 Ga0373956_0020178
786 Ga0373956_0028172
787 Ga0373957_0007751
788 Ga0373943_0007879
789 Ga0373943_0020836
790 Ga0373943_0147219
791 Ga0373946_0001413
792 Ga0373946_0111034
793 Ga0373955_0000504
794 Ga0373955_0210592
795 Ga0373961_0009070
796 Ga0373962_0034220
797 Ga0373924_0000932
798 Ga0373931_0017094
799 Ga0373935_0000038
800 Ga0373935_0061409
801 Ga0373935_0180986
802 Ga0373935_0228156
803 Ga0373935_0366764
804 Ga0373935_0371763
805 Ga0373927_0031221
806 Ga0373927_0039237
807 Ga0373927_0046710
808 Ga0373927_0200405
809 Ga0373933_0007615
810 Ga0373947_0000229
811 Ga0373947_0126027
812 Ga0373947_0143869
813 Ga0373937_0000004
814 Ga0373937_0001725
815 Ga0373925_0290686
816 Ga0395900_0107503
817 Ga0395900_0122865
818 Ga0395898_0006221
819 Ga0436364_0817478
820 Ga0395901_0074714
821 Ga0395901_0111508
822 Ga0395901_0315186
823 Ga0436365_0271615
824 Ga0436365_0788813
825 Ga0436361_0407903
826 Ga0436363_0335225
827 Ga0439465_0002288
828 Ga0451807_1983576
829 Ga0466966_0260931
830 Ga0466963_0121054
831 Ga0466959_0027870
832 Ga0466959_0133557
833 Ga0495603_0002928
834 Ga0495603_0016023
835 Ga0495603_0179929
836 Ga0495629_0001232
837 Ga0495629_0055936
838 Ga0495638_0027817
839 Ga0495641_0088667
840 Ga0495651_0000799
841 Ga0495651_0001901
842 Ga0495651_0034560
843 Ga0495651_0115534
844 Ga0495651_0123862
845 Ga0495653_0000012
846 Ga0495653_0001172
847 Ga0495653_0018454
848 Ga0495580_0068755
849 Ga0495582_0031519
850 Ga0495639_0027847
851 Ga0495639_0047220
852 Ga0495662_0020452
853 Ga0495662_0032039
854 Ga0495664_0000004
855 Ga0495664_0119968
856 Ga0495585_0092313
857 Ga0495608_0000017
858 Ga0495608_0000272
859 Ga0495618_0000006
860 Ga0495628_0000001
861 Ga0495628_0021841
862 Ga0495628_0304198
863 Ga0495630_0005871
864 Ga0495630_0163928
865 Ga0495652_0000002
866 Ga0495652_0045854
867 Ga0495652_0333000
868 Ga0495665_0022181
869 Ga0495640_0000001
870 Ga0495587_0000008
871 Ga0495587_0007120
872 Ga0495598_0001843
873 Ga0495645_0000002
874 Ga0495645_0135871
875 Ga0495633_0077761
876 Ga0495667_0000124
877 Ga0495667_0011432
878 Ga0495667_0061363
879 Ga0495656_0004314
880 Ga0495668_0160577
881 Ga0495634_0000003
882 Ga0495634_0014482
883 Ga0495635_0000002
884 Ga0495635_0000500
885 Ga0495635_0004998
886 Ga0495635_0174731
887 Ga0495588_0170737
888 Ga0495657_0000054
889 Ga0495657_0014481
890 Ga0495657_0034655
891 Ga0495657_0229789
892 Ga0495599_0000005
893 Ga0495599_0018645
894 Ga0495623_0000148
895 Ga0495623_0005093
896 Ga0495646_0000002
897 Ga0495647_0004214
898 Ga0495658_0002178
899 Ga0495658_0006226
900 Ga0495669_0059400
901 Ga0495613_0014301
902 Ga0495613_0015932
903 Ga0495613_0102094
904 Ga0495624_0008567
905 Ga0495624_0056351
906 Ga0495624_0068661
907 Ga0495624_0127588
908 Ga0495670_0011251
909 Ga0495589_0122430
910 Ga0495600_0000012
911 Ga0495600_0001148
912 Ga0495581_0026555
913 Ga0495604_0000009
914 Ga0495604_0004436
915 Ga0495604_0051100
916 Ga0495674_0000002
917 Ga0495680_0001385
918 Ga0495680_0001508
919 Ga0495675_0000028
920 Ga0495675_0000362
921 Ga0495684_0000006
922 Ga0495684_0028479
923 Ga0495684_0248044
924 Ga0495686_0023990
925 Ga0495593_0000140
926 Ga0495593_0050350
927 Ga0495602_0000005
928 Ga0495602_0005892
929 Ga0495602_0042945
930 Ga0495602_0122658
931 Ga0495614_0084288
932 Ga0496100_0015421
933 Ga0496100_0029450
934 Ga0496100_0041015
935 Ga0496100_0171275
936 Ga0496101_0002395
937 Ga0496101_0010276
938 Ga0496102_0002614
939 Ga0496102_0089830
940 Ga0496102_0215790
941 Ga0496103_0021349
942 Ga0496104_0021951
943 Ga0496104_0066189
944 Ga0496104_0091129
945 Ga0496105_0003019
946 Ga0496105_0007082
947 Ga0496105_0013076
948 Ga0496105_0032830
949 Ga0496106_0001912
950 Ga0496106_0003207
951 Ga0496106_0018657
952 Ga0496106_0061023
953 Ga0496106_0079659
954 Ga0496107_0000684
955 Ga0496107_0008466
956 Ga0496108_0000951
957 Ga0496108_0002201
958 Ga0496109_0036779
959 Ga0496109_0109183
960 Ga0496109_0174491
961 Ga0496110_0025021
962 Ga0496110_0049864
963 Ga0496110_0177180
964 Ga0496111_0007619
965 Ga0496111_0088518
966 Ga0496112_0006785
967 Ga0496112_0023680
968 Ga0496112_0085546
969 Ga0496113_0000043
970 Ga0496113_0003867
971 Ga0496113_0017042
972 Ga0496114_0029897
973 Ga0496114_0072474
974 Ga0496114_0098816
975 Ga0496115_0017339
976 Ga0496115_0130197
977 Ga0496115_0136450
978 Ga0496118_0008409
979 Ga0496119_0038526
980 Ga0496120_0007337
981 Ga0496121_0000104
982 Ga0496121_0000365
983 Ga0496121_0000881
984 Ga0496121_0001293
985 Ga0496121_0221079
986 Ga0496122_0019295
987 Ga0496124_0002671
988 Ga0496124_0029811
989 Ga0496124_0286484
990 Ga0496125_0019036
991 Ga0496126_0009177
992 Ga0496126_0080901
993 Ga0496126_0110937
994 Ga0496126_0233642
995 Ga0501031_0002596
996 Ga0501032_0000366
997 Ga0501032_0098879
998 Ga0501033_0000707
999 Ga0501033_0089241
1000 Ga0501034_0000332
1001 Ga0501034_0009154
1002 Ga0501034_0029876
1003 Ga0501034_0049799
1004 Ga0501034_0051508
1005 Ga0501036_0000220
1006 Ga0501036_0053292
1007 Ga0501036_0069688
1008 Ga0501037_0000054
1009 Ga0501037_0001926
1010 Ga0501037_0051222
1011 Ga0501038_0002737
1012 Ga0501038_0055484
1013 Ga0501038_0062439
1014 Ga0501038_0063864
1015 Ga0501038_0069285
1016 Ga0501038_0134334
1017 Ga0501038_0137169
1018 Ga0501038_0451786
1019 Ga0501039_0475807
1020 Ga0501043_0000338
1021 Ga0501043_0018792
1022 Ga0501043_0026568
1023 Ga0501043_0037069
1024 Ga0501043_0130559
1025 Ga0501043_0383847
1026 Ga0501046_0000011
1027 Ga0501046_0000087
1028 Ga0501047_0001092
1029 Ga0501047_0026666
1030 Ga0501047_0052499
1031 Ga0501047_0060428
1032 Ga0501047_0236321
1033 Ga0501048_0001217
1034 Ga0501048_0009539
1035 Ga0501067_0001618
1036 Ga0501067_0065573
1037 Ga0501068_0000069
1038 Ga0501069_0007811
1039 Ga0501070_0045569
1040 Ga0501070_0047258
1041 Ga0501070_0195930
1042 Ga0501070_0381089
1043 Ga0501070_0417179
1044 Ga0501071_0049661
1045 Ga0501072_0010024
1046 Ga0501072_0045316
1047 Ga0501073_0000112
1048 Ga0501073_0007067
1049 Ga0501073_0019544
1050 Ga0501073_0027377
1051 Ga0501073_0035773
1052 Ga0501073_0133750
1053 Ga0501074_0003367
1054 Ga0501074_0015427
1055 Ga0501074_0020775
1056 Ga0501074_0131798
1057 Ga0501079_0001029
1058 Ga0501079_0180654
1059 Ga0501079_0319383
1060 Ga0501080_0001149
1061 Ga0501080_0003274
1062 Ga0501080_0060868
1063 Ga0501080_0063417
1064 Ga0501080_0099160
1065 Ga0501080_0118209
1066 Ga0501080_0144572
1067 Ga0501083_0008891
1068 Ga0501083_0009300
1069 Ga0501083_0022562
1070 Ga0501083_0049616
1071 Ga0501083_0197461
1072 Ga0501035_0001855
1073 Ga0501035_0014587
1074 Ga0501035_0016398
1075 Ga0501035_0044722
1076 Ga0501035_0081878
1077 Ga0501035_0157443
1078 Ga0501044_0000163
1079 Ga0501044_0012345
1080 Ga0501044_0038026
1081 Ga0501044_0049022
1082 Ga0501044_0160361
1083 Ga0501045_0003296
1084 nmdc:mga00v17_21264_c1
1085 nmdc:mga0yw44_1178_c1
1086 nmdc:mga0yw44_215220_c1
1087 nmdc:mga0yw44_28448_c1
1088 nmdc:mga06z11_32863_c1
1089 nmdc:mga04h51_21686_c1
1090 nmdc:mga05p37_140_c1
1091 nmdc:mga05p37_267187_c1
1092 nmdc:mga05p37_533808_c1
1093 nmdc:mga09592_1649_c1
1094 nmdc:mga06r32_107119_c1
1095 nmdc:mga06r32_719_c1
1096 nmdc:mga08y16_104_c1
1097 nmdc:mga08y16_7940_c1
1098 nmdc:mga0n895_150524_c1
1099 nmdc:mga0n895_234560_c1
1100 nmdc:mga0n895_296488_c1
1101 nmdc:mga0n895_3613_c1
1102 nmdc:mga0n895_80372_c1
1103 nmdc:mga0n895_94631_c1
1104 nmdc:mga0rr50_249584_c1
1105 nmdc:mga0rr50_38037_c1
1106 nmdc:mga0sz30_56585_c1
1107 Ga0495601_0000002
1108 Ga0495601_0001735
1109 Ga0495601_0247737
1110 Ga0495612_0000010
1111 Ga0495612_0066243
1112 Ga0500635_0001213
1113 Ga0495595_0000026
1114 Ga0495619_0000019
1115 Ga0495619_0000743
1116 Ga0495619_0038918
1117 Ga0500566_0001828
1118 Ga0500566_0172451
1119 Ga0500641_0016917
1120 Ga0500648_036088
1121 Ga0500562_036998
1122 Ga0500597_121197
1123 Ga0500559_0031655
1124 Ga0500573_0025465
1125 Ga0500603_000400
1126 Ga0500604_0026077
1127 Ga0500616_0015009
1128 Ga0500616_0046623
1129 Ga0500636_0066452
1130 Ga0500637_0001951
1131 Ga0501084_0012713
1132 Ga0501084_0013592
1133 Ga0501084_0067860
1134 Ga0501082_0015541
1135 Ga0501082_0138331
1136 Ga0501082_0230013
1137 Ga0530510_0239553
1138 2509148800
1139 2513591496
1140 2585166009
1141 2671122074
1142 2671692204
1143 2837654628
1144 2879103309
1145 2885410118
1146 2894777563
1147 2904698741
1148 2908740996
1149 2908759255
1150 2917557318
1151 643604169
1152 8056690331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01218

Coprogen_oxidas

Coproporphyrinogen III oxidase

42

347

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eo6-assembly1.cif.gz_B coproporphyrinogen iii oxidase (hemf) from acinetobacter baumannii 0.9473 13 284
3e8j-assembly1.cif.gz_B coproporphyrinogen iii oxidase from leishmania naiffi 0.9425 13 284
3dwr-assembly1.cif.gz_B leishmania major coproporphyrinogen iii oxidase with bound ligand 0.9412 11 284
3e8j-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania naiffi 0.9329 13 284
2qt8-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania major 0.9242 10 284
ID Description Score Start End Superfamily
3dwsA00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9121 13 284 3.40.1500.10
af_Q54IA7_2_331_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9002 3 284 3.40.1500.10
af_Q9UTE2_2_312_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.897 4 284 3.40.1500.10
af_Q54IA7_2_331_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.891 3 284 3.40.1500.10
af_Q7XPL2_53_398_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8898 1 284 3.40.1500.10
ID Description Score Start End GO Terms
AF-A0A1R1YWK0-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9965 8 284 GO:0004109
GO:0005737
GO:0006782
AF-A0A520DFF3-F1-model_v4 deleted 0.9939 8 221
AF-A0A3M1G5I1-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9915 68 284 GO:0004109
GO:0005737
GO:0006782
AF-A0A2A5BLV3-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9901 104 284 GO:0004109
GO:0005737
GO:0006782
AF-A0A3D2P2U3-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.988 70 176 GO:0004109
GO:0005737
GO:0006782

Map