F465535
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 576 | 296 | 1152 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0000168|Ga0451576_0000168_33493_34566 |
| Length | 357 |
| Sequence | VSADAHVSVLLAEAVAALAIQPAGTYVDATFGRGGHSRAILAGLGSQGRLIALDRDPAAIAVGATIPDPRFTLVHAAFSEIHTVLDRLGVKQVDGVLLDIGVSSPQLNTPERGMSFRFDAPLDMRMDTTQGETAAEFLARASQSELERVIRDYGEERFAHAIAKALVAARGEHGISRTGELATLVAQVVRTREPGQHPATRTFQALRIHVNRELEELSLALPRAVERLAPGGRLAVICFHSLEDRIVKRFMRDAAHPPQPPKGVPVRAADLPQPVMNLVGKAMFPSAAEIAANPRCRSAVLRVAQKVGNPSDPVSANGGDRPAAGPSQGMASQKHGAAKRRTTVTPAHGRGPGGGSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 89 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 172 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 183 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 184 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 185 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 186 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 189 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 190 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 191 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 233 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 277 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 278 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 279 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 281 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 286 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 287 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 288 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 289 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 290 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 291 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 292 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 293 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 294 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 295 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 296 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.4 |
| Metatranscriptomes | 0.69 |
| Isolates | 1.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.89 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 72.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451576_0000168 | 3300045051 | Bacteria | 165624 |
| 2 | JGI24740J21852_10000678 | 3300001979 | Bacteria | 14765 |
| 3 | JGI24739J22299_10000934 | 3300001989 | Bacteria | 10874 |
| 4 | JGI24737J22298_10006753 | 3300001990 | Bacteria | 3900 |
| 5 | JGI24735J21928_10006544 | 3300002067 | Bacteria | 3830 |
| 6 | JGI25162J39368_1001140 | 3300002737 | Bacteria | 15933 |
| 7 | JGI25162J39368_1001141 | 3300002737 | Bacteria | 15919 |
| 8 | JGI25162J39368_1002305 | 3300002737 | Bacteria | 7662 |
| 9 | JGI25157J39369_1000133 | 3300002741 | Bacteria | 62143 |
| 10 | JGI25157J39369_1000213 | 3300002741 | Bacteria | 48048 |
| 11 | JGI25157J39369_1000314 | 3300002741 | Bacteria | 34899 |
| 12 | JGI25157J39369_1002011 | 3300002741 | Bacteria | 5912 |
| 13 | JGI25163J39215_1000210 | 3300002771 | Bacteria | 22204 |
| 14 | JGI25164J39214_1000075 | 3300002772 | Bacteria | 97713 |
| 15 | JGI25164J39214_1001087 | 3300002772 | Bacteria | 7899 |
| 16 | JGI25164J39214_1001115 | 3300002772 | Bacteria | 7662 |
| 17 | JGI25165J46597_1000178 | 3300003214 | Bacteria | 97713 |
| 18 | JGI25165J46597_1002091 | 3300003214 | Bacteria | 7359 |
| 19 | rootH1_10069084 | 3300003316 | Bacteria | 4561 |
| 20 | rootH2_10038156 | 3300003320 | Bacteria | 6937 |
| 21 | Ga0006562J51391_1017132 | 3300003578 | Bacteria | 8263 |
| 22 | Ga0006562J51391_1017133 | 3300003578 | Bacteria | 2870 |
| 23 | Ga0055538_1000590 | 3300003751 | Bacteria | 12121 |
| 24 | Ga0055533_1001374 | 3300003756 | Bacteria | 6492 |
| 25 | Ga0055533_1001584 | 3300003756 | Bacteria | 5909 |
| 26 | Ga0055525_1000124 | 3300003759 | Bacteria | 116698 |
| 27 | Ga0055525_1000184 | 3300003759 | Bacteria | 77971 |
| 28 | Ga0055527_1000094 | 3300003760 | Bacteria | 68614 |
| 29 | Ga0055527_1000180 | 3300003760 | Bacteria | 42287 |
| 30 | Ga0055535_1000350 | 3300003761 | Bacteria | 45642 |
| 31 | Ga0055535_1000421 | 3300003761 | Bacteria | 39851 |
| 32 | Ga0055535_1000807 | 3300003761 | Bacteria | 22701 |
| 33 | Ga0055535_1002095 | 3300003761 | Bacteria | 7939 |
| 34 | Ga0055542_1000312 | 3300003762 | Bacteria | 52869 |
| 35 | Ga0055542_1000326 | 3300003762 | Bacteria | 50636 |
| 36 | Ga0055542_1001122 | 3300003762 | Bacteria | 15933 |
| 37 | Ga0055542_1001123 | 3300003762 | Bacteria | 15927 |
| 38 | Ga0055542_1001976 | 3300003762 | Bacteria | 7951 |
| 39 | Ga0055529_1000153 | 3300003763 | Bacteria | 97713 |
| 40 | Ga0055529_1000434 | 3300003763 | Bacteria | 42287 |
| 41 | Ga0055529_1000893 | 3300003763 | Bacteria | 16800 |
| 42 | Ga0055529_1007994 | 3300003763 | Bacteria | 1417 |
| 43 | Ga0065165_1009247 | 3300005262 | Bacteria | 4449 |
| 44 | Ga0070658_10037931 | 3300005327 | Bacteria | 3885 |
| 45 | Ga0070680_100190937 | 3300005336 | Bacteria | 1726 |
| 46 | Ga0070682_100004611 | 3300005337 | Bacteria | 7659 |
| 47 | Ga0070682_100049271 | 3300005337 | Bacteria | 2625 |
| 48 | Ga0068868_100058991 | 3300005338 | Bacteria | 3034 |
| 49 | Ga0068868_100174768 | 3300005338 | Bacteria | 1779 |
| 50 | Ga0070660_100049952 | 3300005339 | Bacteria | 3217 |
| 51 | Ga0070689_100003954 | 3300005340 | Bacteria | 9951 |
| 52 | Ga0070691_10019335 | 3300005341 | Bacteria | 3143 |
| 53 | Ga0070692_10016893 | 3300005345 | Bacteria | 3478 |
| 54 | Ga0070692_10104267 | 3300005345 | Bacteria | 1559 |
| 55 | Ga0070692_10182993 | 3300005345 | Bacteria | 1216 |
| 56 | Ga0070675_100205720 | 3300005354 | Bacteria | 1710 |
| 57 | Ga0070671_100360320 | 3300005355 | Bacteria | 1242 |
| 58 | Ga0070673_100409039 | 3300005364 | Bacteria | 1214 |
| 59 | Ga0070688_100144312 | 3300005365 | Bacteria | 1620 |
| 60 | Ga0070659_100030519 | 3300005366 | Bacteria | 4172 |
| 61 | Ga0070659_100033518 | 3300005366 | Bacteria | 3989 |
| 62 | Ga0070667_100379680 | 3300005367 | Bacteria | 1283 |
| 63 | Ga0070714_100001006 | 3300005435 | Bacteria | 20106 |
| 64 | Ga0070714_100011167 | 3300005435 | Bacteria | 7119 |
| 65 | Ga0070714_100181124 | 3300005435 | Bacteria | 1917 |
| 66 | Ga0070714_100217626 | 3300005435 | Bacteria | 1754 |
| 67 | Ga0070714_100497302 | 3300005435 | Bacteria | 1163 |
| 68 | Ga0070713_100000528 | 3300005436 | Bacteria | 24207 |
| 69 | Ga0070710_10277303 | 3300005437 | Bacteria | 1087 |
| 70 | Ga0070701_10079706 | 3300005438 | Bacteria | 1769 |
| 71 | Ga0070663_100035591 | 3300005455 | Bacteria | 3455 |
| 72 | Ga0070663_100101789 | 3300005455 | Bacteria | 2145 |
| 73 | Ga0070681_10022732 | 3300005458 | Bacteria | 6301 |
| 74 | Ga0070681_10042404 | 3300005458 | Bacteria | 4560 |
| 75 | Ga0070681_10148217 | 3300005458 | Bacteria | 2274 |
| 76 | Ga0070681_10154381 | 3300005458 | Bacteria | 2221 |
| 77 | Ga0068867_100066741 | 3300005459 | Bacteria | 2680 |
| 78 | Ga0070685_10000983 | 3300005466 | Bacteria | 15333 |
| 79 | Ga0070679_100065616 | 3300005530 | Bacteria | 3618 |
| 80 | Ga0070679_100544246 | 3300005530 | Bacteria | 1104 |
| 81 | Ga0070684_100046846 | 3300005535 | Bacteria | 3746 |
| 82 | Ga0070684_100576382 | 3300005535 | Bacteria | 1045 |
| 83 | Ga0068853_100001937 | 3300005539 | Bacteria | 15270 |
| 84 | Ga0068853_100341086 | 3300005539 | Bacteria | 1392 |
| 85 | Ga0070672_100079419 | 3300005543 | Bacteria | 2626 |
| 86 | Ga0070696_100001750 | 3300005546 | Bacteria | 14237 |
| 87 | Ga0070696_100015752 | 3300005546 | Bacteria | 5081 |
| 88 | Ga0070696_100067995 | 3300005546 | Bacteria | 2501 |
| 89 | Ga0070693_100023320 | 3300005547 | Bacteria | 3306 |
| 90 | Ga0070693_100037352 | 3300005547 | Bacteria | 2708 |
| 91 | Ga0070693_100052699 | 3300005547 | Bacteria | 2334 |
| 92 | Ga0070693_100189133 | 3300005547 | Bacteria | 1330 |
| 93 | Ga0068855_100024000 | 3300005563 | Bacteria | 7301 |
| 94 | Ga0068855_100027019 | 3300005563 | Bacteria | 6867 |
| 95 | Ga0068855_100056615 | 3300005563 | Bacteria | 4599 |
| 96 | Ga0068855_100132671 | 3300005563 | Bacteria | 2843 |
| 97 | Ga0068855_100234556 | 3300005563 | Bacteria | 2052 |
| 98 | Ga0068857_100000919 | 3300005577 | Bacteria | 22265 |
| 99 | Ga0068857_100032172 | 3300005577 | Bacteria | 4637 |
| 100 | Ga0068857_100091782 | 3300005577 | Bacteria | 2719 |
| 101 | Ga0068857_100505324 | 3300005577 | Bacteria | 1135 |
| 102 | Ga0068854_100006938 | 3300005578 | Bacteria | 7224 |
| 103 | Ga0068854_100038019 | 3300005578 | Bacteria | 3382 |
| 104 | Ga0068854_100097000 | 3300005578 | Bacteria | 2203 |
| 105 | Ga0068856_100000495 | 3300005614 | Bacteria | 43612 |
| 106 | Ga0068856_100001721 | 3300005614 | Bacteria | 22879 |
| 107 | Ga0068856_100086428 | 3300005614 | Bacteria | 3116 |
| 108 | Ga0070702_100080963 | 3300005615 | Bacteria | 1944 |
| 109 | Ga0068852_100006980 | 3300005616 | Bacteria | 8218 |
| 110 | Ga0068852_100128247 | 3300005616 | Bacteria | 2332 |
| 111 | Ga0068852_100171059 | 3300005616 | Bacteria | 2036 |
| 112 | Ga0068864_100203333 | 3300005618 | Bacteria | 1820 |
| 113 | Ga0068866_10106766 | 3300005718 | Bacteria | 1554 |
| 114 | Ga0068851_10022370 | 3300005834 | Bacteria | 3079 |
| 115 | Ga0068862_100074944 | 3300005844 | Bacteria | 2926 |
| 116 | Ga0070715_10034867 | 3300006163 | Bacteria | 2066 |
| 117 | Ga0070712_100035625 | 3300006175 | Bacteria | 3379 |
| 118 | Ga0075431_100004424 | 3300006847 | Bacteria | 13776 |
| 119 | Ga0075434_100040256 | 3300006871 | Bacteria | 4628 |
| 120 | Ga0075429_100030108 | 3300006880 | Bacteria | 4716 |
| 121 | Ga0075429_100115244 | 3300006880 | Bacteria | 2349 |
| 122 | Ga0068865_100069426 | 3300006881 | Bacteria | 2493 |
| 123 | Ga0068865_100104063 | 3300006881 | Bacteria | 2083 |
| 124 | Ga0105240_10006007 | 3300009093 | Bacteria | 17950 |
| 125 | Ga0105240_10007228 | 3300009093 | Bacteria | 16170 |
| 126 | Ga0105240_10007369 | 3300009093 | Bacteria | 16004 |
| 127 | Ga0105240_10048609 | 3300009093 | Bacteria | 5360 |
| 128 | Ga0105240_10096165 | 3300009093 | Bacteria | 3610 |
| 129 | Ga0105240_10163584 | 3300009093 | Bacteria | 2641 |
| 130 | Ga0105240_10236454 | 3300009093 | Bacteria | 2120 |
| 131 | Ga0105240_10332181 | 3300009093 | Bacteria | 1729 |
| 132 | Ga0111539_10005579 | 3300009094 | Bacteria | 16271 |
| 133 | Ga0111539_10005732 | 3300009094 | Bacteria | 16058 |
| 134 | Ga0111539_10111077 | 3300009094 | Bacteria | 3216 |
| 135 | Ga0105245_10098453 | 3300009098 | Bacteria | 2702 |
| 136 | Ga0105245_10267129 | 3300009098 | Bacteria | 1667 |
| 137 | Ga0105241_10045116 | 3300009174 | Bacteria | 3343 |
| 138 | Ga0105241_10158928 | 3300009174 | Bacteria | 1856 |
| 139 | Ga0105242_10001680 | 3300009176 | Bacteria | 17528 |
| 140 | Ga0105242_10361377 | 3300009176 | Bacteria | 1344 |
| 141 | Ga0105237_10000011 | 3300009545 | Bacteria | 307361 |
| 142 | Ga0105237_10000815 | 3300009545 | Bacteria | 42625 |
| 143 | Ga0105237_10040935 | 3300009545 | Bacteria | 4673 |
| 144 | Ga0105237_10102910 | 3300009545 | Bacteria | 2847 |
| 145 | Ga0105237_10114424 | 3300009545 | Bacteria | 2690 |
| 146 | Ga0105237_10146214 | 3300009545 | Bacteria | 2359 |
| 147 | Ga0105237_10250314 | 3300009545 | Bacteria | 1774 |
| 148 | Ga0105238_10000760 | 3300009551 | Bacteria | 33531 |
| 149 | Ga0105238_10012012 | 3300009551 | Bacteria | 8724 |
| 150 | Ga0105238_10110623 | 3300009551 | Bacteria | 2728 |
| 151 | Ga0105238_10115605 | 3300009551 | Bacteria | 2662 |
| 152 | Ga0105238_10134680 | 3300009551 | Bacteria | 2448 |
| 153 | Ga0105239_10000027 | 3300010375 | Bacteria | 248028 |
| 154 | Ga0105239_10116093 | 3300010375 | Bacteria | 2970 |
| 155 | Ga0157314_1000064 | 3300012500 | Bacteria | 11359 |
| 156 | Ga0157373_10062853 | 3300013100 | Bacteria | 2629 |
| 157 | Ga0157371_10023341 | 3300013102 | Bacteria | 4524 |
| 158 | Ga0157371_10076383 | 3300013102 | Bacteria | 2372 |
| 159 | Ga0157371_10123516 | 3300013102 | Bacteria | 1841 |
| 160 | Ga0157371_10133511 | 3300013102 | Bacteria | 1766 |
| 161 | Ga0157370_10009289 | 3300013104 | Bacteria | 10532 |
| 162 | Ga0157370_10011822 | 3300013104 | Bacteria | 9109 |
| 163 | Ga0157370_10017730 | 3300013104 | Bacteria | 7178 |
| 164 | Ga0157370_10025808 | 3300013104 | Bacteria | 5813 |
| 165 | Ga0157370_10050049 | 3300013104 | Bacteria | 3996 |
| 166 | Ga0157370_10125537 | 3300013104 | Bacteria | 2395 |
| 167 | Ga0157370_10425737 | 3300013104 | Bacteria | 1221 |
| 168 | Ga0157369_10007761 | 3300013105 | Bacteria | 12344 |
| 169 | Ga0157369_10193712 | 3300013105 | Bacteria | 2135 |
| 170 | Ga0157374_10049675 | 3300013296 | Bacteria | 3897 |
| 171 | Ga0157374_10136811 | 3300013296 | Bacteria | 2375 |
| 172 | Ga0157372_10014552 | 3300013307 | Bacteria | 8416 |
| 173 | Ga0157372_10067138 | 3300013307 | Bacteria | 4030 |
| 174 | Ga0157372_10078054 | 3300013307 | Bacteria | 3741 |
| 175 | Ga0157372_10103975 | 3300013307 | Bacteria | 3246 |
| 176 | Ga0157375_10053233 | 3300013308 | Bacteria | 3981 |
| 177 | Ga0157375_10509277 | 3300013308 | Bacteria | 1367 |
| 178 | Ga0157380_10080886 | 3300014326 | Bacteria | 2656 |
| 179 | Ga0182008_10086054 | 3300014497 | Bacteria | 1548 |
| 180 | Ga0157377_10010130 | 3300014745 | Bacteria | 4651 |
| 181 | Ga0157379_10005424 | 3300014968 | Bacteria | 10955 |
| 182 | Ga0182006_1048094 | 3300015261 | Bacteria | 1651 |
| 183 | Ga0182007_10009448 | 3300015262 | Bacteria | 3928 |
| 184 | Ga0183369_1018 | 3300015685 | Bacteria | 117953 |
| 185 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 186 | Ga0163161_10168107 | 3300017792 | Bacteria | 1675 |
| 187 | Ga0206356_10936611 | 3300020070 | Bacteria | 1730 |
| 188 | Ga0206353_11707163 | 3300020082 | Bacteria | 5109 |
| 189 | Ga0213876_10009570 | 3300021384 | Bacteria | 5214 |
| 190 | Ga0213876_10027810 | 3300021384 | Bacteria | 2982 |
| 191 | Ga0209760_100466 | 3300025207 | Bacteria | 8909 |
| 192 | Ga0209784_100104 | 3300025224 | Bacteria | 98272 |
| 193 | Ga0209566_101646 | 3300025225 | Bacteria | 5730 |
| 194 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 195 | Ga0209674_100079 | 3300025226 | Bacteria | 205836 |
| 196 | Ga0209674_100856 | 3300025226 | Bacteria | 10021 |
| 197 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 198 | Ga0209672_100055 | 3300025228 | Bacteria | 221655 |
| 199 | Ga0209672_100270 | 3300025228 | Bacteria | 38089 |
| 200 | Ga0209672_100765 | 3300025228 | Bacteria | 15441 |
| 201 | Ga0209563_100045 | 3300025230 | Bacteria | 377102 |
| 202 | Ga0207427_100070 | 3300025231 | Bacteria | 160908 |
| 203 | Ga0207427_101337 | 3300025231 | Bacteria | 9162 |
| 204 | Ga0207427_103511 | 3300025231 | Bacteria | 3242 |
| 205 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 206 | Ga0209437_100059 | 3300025233 | Bacteria | 355048 |
| 207 | Ga0209437_100214 | 3300025233 | Bacteria | 107034 |
| 208 | Ga0209437_101184 | 3300025233 | Bacteria | 7709 |
| 209 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 210 | Ga0209258_100027 | 3300025242 | Bacteria | 518449 |
| 211 | Ga0209258_100135 | 3300025242 | Bacteria | 170832 |
| 212 | Ga0209258_100152 | 3300025242 | Bacteria | 160154 |
| 213 | Ga0209258_104449 | 3300025242 | Bacteria | 2648 |
| 214 | Ga0209258_105522 | 3300025242 | Bacteria | 2125 |
| 215 | Ga0209646_1001180 | 3300025246 | Bacteria | 7586 |
| 216 | Ga0209646_1001826 | 3300025246 | Bacteria | 5266 |
| 217 | Ga0209646_1009959 | 3300025246 | Bacteria | 1498 |
| 218 | Ga0209026_1000017 | 3300025250 | Bacteria | 385214 |
| 219 | Ga0209026_1000055 | 3300025250 | Bacteria | 237197 |
| 220 | Ga0209026_1000176 | 3300025250 | Bacteria | 97745 |
| 221 | Ga0209026_1000319 | 3300025250 | Bacteria | 51342 |
| 222 | Ga0209677_101939 | 3300025253 | Bacteria | 8272 |
| 223 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 224 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 225 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 226 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 227 | Ga0209148_1000102 | 3300025254 | Bacteria | 216658 |
| 228 | Ga0209759_1000267 | 3300025256 | Bacteria | 74733 |
| 229 | Ga0209759_1000333 | 3300025256 | Bacteria | 62095 |
| 230 | Ga0209129_1001293 | 3300025258 | Bacteria | 14274 |
| 231 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 232 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 233 | Ga0209233_1000193 | 3300025261 | Bacteria | 126812 |
| 234 | Ga0209233_1001248 | 3300025261 | Bacteria | 10224 |
| 235 | Ga0209233_1013294 | 3300025261 | Bacteria | 2354 |
| 236 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 237 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 238 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 239 | Ga0209455_1000297 | 3300025272 | Bacteria | 51750 |
| 240 | Ga0209758_1000791 | 3300025297 | Bacteria | 45103 |
| 241 | Ga0207656_10012383 | 3300025321 | Bacteria | 3242 |
| 242 | Ga0207682_10034219 | 3300025893 | Bacteria | 2048 |
| 243 | Ga0207692_10150675 | 3300025898 | Bacteria | 1332 |
| 244 | Ga0207647_10002665 | 3300025904 | Bacteria | 13479 |
| 245 | Ga0207654_10094107 | 3300025911 | Bacteria | 1833 |
| 246 | Ga0207654_10105869 | 3300025911 | Bacteria | 1741 |
| 247 | Ga0207707_10004111 | 3300025912 | Bacteria | 12894 |
| 248 | Ga0207707_10035028 | 3300025912 | Bacteria | 4390 |
| 249 | Ga0207695_10001405 | 3300025913 | Bacteria | 40582 |
| 250 | Ga0207695_10005890 | 3300025913 | Bacteria | 16084 |
| 251 | Ga0207695_10005938 | 3300025913 | Bacteria | 15997 |
| 252 | Ga0207695_10009237 | 3300025913 | Bacteria | 12219 |
| 253 | Ga0207695_10013055 | 3300025913 | Bacteria | 9919 |
| 254 | Ga0207695_10152347 | 3300025913 | Bacteria | 2250 |
| 255 | Ga0207695_10291125 | 3300025913 | Bacteria | 1525 |
| 256 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 257 | Ga0207671_10000359 | 3300025914 | Bacteria | 64927 |
| 258 | Ga0207662_10080041 | 3300025918 | Bacteria | 1992 |
| 259 | Ga0207657_10026845 | 3300025919 | Bacteria | 5283 |
| 260 | Ga0207657_10083113 | 3300025919 | Bacteria | 2687 |
| 261 | Ga0207652_10253715 | 3300025921 | Bacteria | 1586 |
| 262 | Ga0207681_10295486 | 3300025923 | Bacteria | 1280 |
| 263 | Ga0207694_10000412 | 3300025924 | Bacteria | 39847 |
| 264 | Ga0207694_10023548 | 3300025924 | Bacteria | 4674 |
| 265 | Ga0207694_10062816 | 3300025924 | Bacteria | 2892 |
| 266 | Ga0207694_10138421 | 3300025924 | Bacteria | 1956 |
| 267 | Ga0207650_10005646 | 3300025925 | Bacteria | 8542 |
| 268 | Ga0207659_10054366 | 3300025926 | Bacteria | 2859 |
| 269 | Ga0207659_10272713 | 3300025926 | Bacteria | 1380 |
| 270 | Ga0207687_10027650 | 3300025927 | Bacteria | 3808 |
| 271 | Ga0207700_10007910 | 3300025928 | Bacteria | 6541 |
| 272 | Ga0207664_10000897 | 3300025929 | Bacteria | 20098 |
| 273 | Ga0207664_10008623 | 3300025929 | Bacteria | 7124 |
| 274 | Ga0207664_10018969 | 3300025929 | Bacteria | 5074 |
| 275 | Ga0207690_10017586 | 3300025932 | Bacteria | 4369 |
| 276 | Ga0207690_10042056 | 3300025932 | Bacteria | 2998 |
| 277 | Ga0207690_10048114 | 3300025932 | Bacteria | 2833 |
| 278 | Ga0207690_10066100 | 3300025932 | Bacteria | 2475 |
| 279 | Ga0207690_10100846 | 3300025932 | Bacteria | 2061 |
| 280 | Ga0207706_10023351 | 3300025933 | Bacteria | 5554 |
| 281 | Ga0207686_10050646 | 3300025934 | Bacteria | 2583 |
| 282 | Ga0207709_10257115 | 3300025935 | Bacteria | 1279 |
| 283 | Ga0207670_10001106 | 3300025936 | Bacteria | 14192 |
| 284 | Ga0207670_10029503 | 3300025936 | Bacteria | 3495 |
| 285 | Ga0207669_10186705 | 3300025937 | Bacteria | 1491 |
| 286 | Ga0207691_10009379 | 3300025940 | Bacteria | 9397 |
| 287 | Ga0207689_10043464 | 3300025942 | Bacteria | 3714 |
| 288 | Ga0207667_10004745 | 3300025949 | Bacteria | 16626 |
| 289 | Ga0207667_10005660 | 3300025949 | Bacteria | 15236 |
| 290 | Ga0207667_10005765 | 3300025949 | Bacteria | 15112 |
| 291 | Ga0207667_10010445 | 3300025949 | Bacteria | 10850 |
| 292 | Ga0207667_10053646 | 3300025949 | Bacteria | 4241 |
| 293 | Ga0207667_10081453 | 3300025949 | Bacteria | 3353 |
| 294 | Ga0207667_10130630 | 3300025949 | Bacteria | 2587 |
| 295 | Ga0207712_10183646 | 3300025961 | Bacteria | 1645 |
| 296 | Ga0207712_10273106 | 3300025961 | Bacteria | 1376 |
| 297 | Ga0207640_10004782 | 3300025981 | Bacteria | 7354 |
| 298 | Ga0207640_10024415 | 3300025981 | Bacteria | 3647 |
| 299 | Ga0207640_10028380 | 3300025981 | Bacteria | 3421 |
| 300 | Ga0207658_10246804 | 3300025986 | Bacteria | 1515 |
| 301 | Ga0207677_10091555 | 3300026023 | Bacteria | 2212 |
| 302 | Ga0207677_10140528 | 3300026023 | Bacteria | 1848 |
| 303 | Ga0207639_10047142 | 3300026041 | Bacteria | 3255 |
| 304 | Ga0207678_10002215 | 3300026067 | Bacteria | 17557 |
| 305 | Ga0207678_10073268 | 3300026067 | Bacteria | 2935 |
| 306 | Ga0207702_10000107 | 3300026078 | Bacteria | 96024 |
| 307 | Ga0207702_10005749 | 3300026078 | Bacteria | 10799 |
| 308 | Ga0207702_10388592 | 3300026078 | Bacteria | 1343 |
| 309 | Ga0207648_10066316 | 3300026089 | Bacteria | 3148 |
| 310 | Ga0207648_10225788 | 3300026089 | Bacteria | 1665 |
| 311 | Ga0207674_10000146 | 3300026116 | Bacteria | 82851 |
| 312 | Ga0207674_10015476 | 3300026116 | Bacteria | 8378 |
| 313 | Ga0207674_10028651 | 3300026116 | Bacteria | 5874 |
| 314 | Ga0207674_10151278 | 3300026116 | Bacteria | 2278 |
| 315 | Ga0207683_10068464 | 3300026121 | Bacteria | 3133 |
| 316 | Ga0207698_10013355 | 3300026142 | Bacteria | 5415 |
| 317 | Ga0207698_10021205 | 3300026142 | Bacteria | 4488 |
| 318 | Ga0207698_10028495 | 3300026142 | Bacteria | 3982 |
| 319 | Ga0209999_1010830 | 3300027543 | Bacteria | 1648 |
| 320 | Ga0209971_1022415 | 3300027682 | Bacteria | 1504 |
| 321 | Ga0207428_10058285 | 3300027907 | Bacteria | 3065 |
| 322 | Ga0207428_10071647 | 3300027907 | Bacteria | 2721 |
| 323 | Ga0268265_10090102 | 3300028380 | Bacteria | 2449 |
| 324 | Ga0268264_10030947 | 3300028381 | Bacteria | 4388 |
| 325 | Ga0265323_10006775 | 3300028653 | Bacteria | 4799 |
| 326 | Ga0265332_10039804 | 3300031238 | Bacteria | 2036 |
| 327 | Ga0265328_10012591 | 3300031239 | Bacteria | 3364 |
| 328 | Ga0265328_10018066 | 3300031239 | Bacteria | 2725 |
| 329 | Ga0265325_10001423 | 3300031241 | Bacteria | 16843 |
| 330 | Ga0265327_10000085 | 3300031251 | Bacteria | 203068 |
| 331 | Ga0265327_10055660 | 3300031251 | Bacteria | 2042 |
| 332 | Ga0265316_10000163 | 3300031344 | Bacteria | 74936 |
| 333 | Ga0265316_10025248 | 3300031344 | Bacteria | 4962 |
| 334 | Ga0265316_10079898 | 3300031344 | Bacteria | 2509 |
| 335 | Ga0307509_10000076 | 3300031507 | Bacteria | 138855 |
| 336 | Ga0307408_100203161 | 3300031548 | Bacteria | 1605 |
| 337 | Ga0307508_10054033 | 3300031616 | Bacteria | 3562 |
| 338 | Ga0307405_10075122 | 3300031731 | Bacteria | 2188 |
| 339 | Ga0307405_10206955 | 3300031731 | Bacteria | 1429 |
| 340 | Ga0316577_10141124 | 3300031733 | Unclassified | 1357 |
| 341 | Ga0307413_10054434 | 3300031824 | Bacteria | 2428 |
| 342 | Ga0307410_10197503 | 3300031852 | Bacteria | 1534 |
| 343 | Ga0307412_10096801 | 3300031911 | Bacteria | 2078 |
| 344 | Ga0307416_100149038 | 3300032002 | Bacteria | 2142 |
| 345 | Ga0307416_100149888 | 3300032002 | Bacteria | 2137 |
| 346 | Ga0307414_10228419 | 3300032004 | Bacteria | 1533 |
| 347 | Ga0316583_10002481 | 3300032133 | Bacteria | 6414 |
| 348 | Ga0373952_0007064 | 3300035092 | Bacteria | 2094 |
| 349 | Ga0373960_0047000 | 3300035121 | Bacteria | 1268 |
| 350 | Ga0373931_0018071 | 3300035691 | Bacteria | 3500 |
| 351 | Ga0373931_0019234 | 3300035691 | Bacteria | 3407 |
| 352 | Ga0373937_0062907 | 3300036401 | Bacteria | 3412 |
| 353 | Ga0373925_0023038 | 3300037068 | Bacteria | 4545 |
| 354 | Ga0395899_0000081 | 3300037312 | Bacteria | 169527 |
| 355 | Ga0395899_0010006 | 3300037312 | Bacteria | 7271 |
| 356 | Ga0395899_0011743 | 3300037312 | Bacteria | 6704 |
| 357 | Ga0395899_0022981 | 3300037312 | Bacteria | 4724 |
| 358 | Ga0395900_0000024 | 3300037418 | Bacteria | 323480 |
| 359 | Ga0395900_0048777 | 3300037418 | Bacteria | 4361 |
| 360 | Ga0395900_0099067 | 3300037418 | Bacteria | 2994 |
| 361 | Ga0395900_0148986 | 3300037418 | Bacteria | 2391 |
| 362 | Ga0395898_0000044 | 3300037466 | Bacteria | 298164 |
| 363 | Ga0395898_0000132 | 3300037466 | Bacteria | 192211 |
| 364 | Ga0395898_0029899 | 3300037466 | Bacteria | 5453 |
| 365 | Ga0395898_0030106 | 3300037466 | Bacteria | 5433 |
| 366 | Ga0395898_0056056 | 3300037466 | Bacteria | 3843 |
| 367 | Ga0395898_0295464 | 3300037466 | Bacteria | 1545 |
| 368 | Ga0395905_0000944 | 3300037471 | Bacteria | 37361 |
| 369 | Ga0395901_0015747 | 3300038443 | Bacteria | 7704 |
| 370 | Ga0395901_0022248 | 3300038443 | Bacteria | 6495 |
| 371 | Ga0395901_0113799 | 3300038443 | Bacteria | 2841 |
| 372 | Ga0395901_0185482 | 3300038443 | Bacteria | 2182 |
| 373 | Ga0395901_0712077 | 3300038443 | Bacteria | 1000 |
| 374 | Ga0400484_06254 | 3300038725 | Bacteria | 35023 |
| 375 | Ga0400484_15735 | 3300038725 | Bacteria | 52349 |
| 376 | Ga0400484_16952 | 3300038725 | Bacteria | 2527 |
| 377 | Ga0400490_21780 | 3300038726 | Bacteria | 8142 |
| 378 | Ga0400490_26731 | 3300038726 | Bacteria | 6535 |
| 379 | Ga0400491_13101 | 3300038727 | Bacteria | 2791 |
| 380 | Ga0400488_48895 | 3300038741 | Bacteria | 10998 |
| 381 | Ga0400487_25945 | 3300039110 | Bacteria | 95730 |
| 382 | Ga0400487_63974 | 3300039110 | Bacteria | 1898 |
| 383 | Ga0436365_1218422 | 3300039437 | Bacteria | 4764 |
| 384 | Ga0436365_1311974 | 3300039437 | Bacteria | 8041 |
| 385 | Ga0439437_007477 | 3300042000 | Bacteria | 1221 |
| 386 | Ga0439441_001493 | 3300042001 | Bacteria | 3079 |
| 387 | Ga0439448_0018422 | 3300042005 | Bacteria | 2140 |
| 388 | Ga0439459_0000277 | 3300042438 | Bacteria | 6042 |
| 389 | Ga0451577_0000997 | 3300042876 | Bacteria | 41140 |
| 390 | Ga0451577_0032467 | 3300042876 | Bacteria | 4703 |
| 391 | Ga0451577_0129486 | 3300042876 | Bacteria | 2263 |
| 392 | Ga0451577_0149632 | 3300042876 | Bacteria | 2100 |
| 393 | Ga0451577_0168409 | 3300042876 | Bacteria | 1974 |
| 394 | Ga0451577_0180408 | 3300042876 | Bacteria | 1903 |
| 395 | Ga0466988_0061414 | 3300044536 | Bacteria | 2216 |
| 396 | Ga0466969_0036812 | 3300044656 | Bacteria | 2470 |
| 397 | Ga0466982_0000012 | 3300044672 | Bacteria | 166823 |
| 398 | Ga0453683_0030211 | 3300044673 | Bacteria | 3426 |
| 399 | Ga0453683_0280986 | 3300044673 | Bacteria | 1063 |
| 400 | Ga0466966_0093317 | 3300044684 | Bacteria | 1866 |
| 401 | Ga0466966_0093319 | 3300044684 | Bacteria | 1866 |
| 402 | Ga0466961_0005884 | 3300044693 | Bacteria | 7771 |
| 403 | Ga0466961_0032939 | 3300044693 | Bacteria | 3329 |
| 404 | Ga0466961_0176524 | 3300044693 | Bacteria | 1327 |
| 405 | Ga0466963_0507856 | 3300044694 | Bacteria | 851 |
| 406 | Ga0466964_0002156 | 3300044706 | Bacteria | 6949 |
| 407 | Ga0466964_0017754 | 3300044706 | Bacteria | 2725 |
| 408 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 409 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 410 | Ga0453684_0001268 | 3300044712 | Bacteria | 75704 |
| 411 | Ga0453684_0001455 | 3300044712 | Bacteria | 67258 |
| 412 | Ga0453684_0002221 | 3300044712 | Bacteria | 48187 |
| 413 | Ga0453684_0006329 | 3300044712 | Bacteria | 22599 |
| 414 | Ga0453684_0014423 | 3300044712 | Bacteria | 12645 |
| 415 | Ga0453684_0014453 | 3300044712 | Bacteria | 12627 |
| 416 | Ga0453684_0033743 | 3300044712 | Bacteria | 7124 |
| 417 | Ga0453684_0769660 | 3300044712 | Bacteria | 1041 |
| 418 | Ga0466971_0002536 | 3300044719 | Bacteria | 7724 |
| 419 | Ga0466971_0005914 | 3300044719 | Bacteria | 5319 |
| 420 | Ga0466971_0029564 | 3300044719 | Bacteria | 2451 |
| 421 | Ga0466970_0012456 | 3300044765 | Bacteria | 4348 |
| 422 | Ga0466970_0012952 | 3300044765 | Bacteria | 4270 |
| 423 | Ga0466957_0003289 | 3300044842 | Bacteria | 8850 |
| 424 | Ga0466959_0000254 | 3300045049 | Bacteria | 32770 |
| 425 | Ga0466959_0031161 | 3300045049 | Bacteria | 3946 |
| 426 | Ga0466959_0064211 | 3300045049 | Bacteria | 2665 |
| 427 | Ga0466959_0264048 | 3300045049 | Bacteria | 1184 |
| 428 | Ga0451576_0001018 | 3300045051 | Bacteria | 51870 |
| 429 | Ga0451576_0008659 | 3300045051 | Bacteria | 11914 |
| 430 | Ga0451576_0016606 | 3300045051 | Bacteria | 8120 |
| 431 | Ga0451576_0064215 | 3300045051 | Bacteria | 3825 |
| 432 | Ga0451576_0069492 | 3300045051 | Bacteria | 3665 |
| 433 | Ga0451576_0170053 | 3300045051 | Bacteria | 2275 |
| 434 | Ga0451576_0679939 | 3300045051 | Bacteria | 1081 |
| 435 | Ga0451576_0855362 | 3300045051 | Bacteria | 955 |
| 436 | Ga0466958_0310714 | 3300045836 | Bacteria | 1012 |
| 437 | Ga0495592_0023258 | 3300046454 | Bacteria | 4713 |
| 438 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 439 | Ga0495638_0000164 | 3300046460 | Bacteria | 103139 |
| 440 | Ga0495638_0003036 | 3300046460 | Bacteria | 13368 |
| 441 | Ga0495650_0000498 | 3300046471 | Bacteria | 59590 |
| 442 | Ga0495606_0001115 | 3300046507 | Bacteria | 38368 |
| 443 | Ga0495642_0059062 | 3300046528 | Bacteria | 1589 |
| 444 | Ga0495652_0036075 | 3300046529 | Bacteria | 4301 |
| 445 | Ga0495645_0001432 | 3300046543 | Bacteria | 16076 |
| 446 | Ga0495622_0134292 | 3300046557 | Bacteria | 1126 |
| 447 | Ga0495625_0025209 | 3300046660 | Bacteria | 4513 |
| 448 | Ga0495623_0003408 | 3300046679 | Bacteria | 10519 |
| 449 | Ga0495649_0001556 | 3300046694 | Bacteria | 17215 |
| 450 | Ga0495675_0137029 | 3300047444 | Bacteria | 1519 |
| 451 | Ga0495677_0051398 | 3300047445 | Bacteria | 1518 |
| 452 | Ga0495684_0132902 | 3300047471 | Bacteria | 1868 |
| 453 | Ga0496100_0146997 | 3300048903 | Bacteria | 1677 |
| 454 | Ga0496102_0487562 | 3300048905 | Bacteria | 1154 |
| 455 | Ga0496104_0098276 | 3300048907 | Bacteria | 2802 |
| 456 | Ga0496104_0250857 | 3300048907 | Bacteria | 1682 |
| 457 | Ga0496105_0001031 | 3300048908 | Bacteria | 19253 |
| 458 | Ga0496106_0302367 | 3300048909 | Bacteria | 1283 |
| 459 | Ga0496107_0050259 | 3300048910 | Bacteria | 3005 |
| 460 | Ga0496108_0005364 | 3300048911 | Bacteria | 10362 |
| 461 | Ga0496109_0005384 | 3300048912 | Bacteria | 10698 |
| 462 | Ga0496109_0134960 | 3300048912 | Bacteria | 2305 |
| 463 | Ga0496110_0281459 | 3300048913 | Bacteria | 1514 |
| 464 | Ga0496114_0044935 | 3300048917 | Bacteria | 3667 |
| 465 | Ga0496114_0070777 | 3300048917 | Bacteria | 2930 |
| 466 | Ga0496114_0237997 | 3300048917 | Bacteria | 1600 |
| 467 | Ga0496115_0000238 | 3300048918 | Bacteria | 50050 |
| 468 | Ga0496115_0012074 | 3300048918 | Bacteria | 6495 |
| 469 | Ga0496115_0046709 | 3300048918 | Bacteria | 3462 |
| 470 | Ga0496117_0007041 | 3300048920 | Bacteria | 11126 |
| 471 | Ga0496117_0184827 | 3300048920 | Bacteria | 1194 |
| 472 | Ga0496118_0002869 | 3300048921 | Bacteria | 22496 |
| 473 | Ga0496118_0006327 | 3300048921 | Bacteria | 13082 |
| 474 | Ga0496119_0000322 | 3300048922 | Bacteria | 67165 |
| 475 | Ga0496119_0016776 | 3300048922 | Bacteria | 5548 |
| 476 | Ga0496120_0000143 | 3300048923 | Bacteria | 120051 |
| 477 | Ga0496120_0000665 | 3300048923 | Bacteria | 50530 |
| 478 | Ga0496121_0000938 | 3300048924 | Bacteria | 52758 |
| 479 | Ga0496121_0008205 | 3300048924 | Bacteria | 12385 |
| 480 | Ga0496121_0279221 | 3300048924 | Bacteria | 1143 |
| 481 | Ga0496125_0000469 | 3300048928 | Bacteria | 72128 |
| 482 | Ga0496126_0001473 | 3300048929 | Bacteria | 36602 |
| 483 | Ga0496126_0043303 | 3300048929 | Bacteria | 4153 |
| 484 | Ga0496126_0045513 | 3300048929 | Bacteria | 4032 |
| 485 | Ga0496126_0074071 | 3300048929 | Bacteria | 3024 |
| 486 | Ga0495678_016942 | 3300049459 | Bacteria | 3315 |
| 487 | Ga0495682_0007012 | 3300049460 | Bacteria | 4517 |
| 488 | Ga0501031_0087879 | 3300049568 | Bacteria | 2027 |
| 489 | Ga0501031_0089798 | 3300049568 | Bacteria | 2004 |
| 490 | Ga0501032_0019572 | 3300049569 | Bacteria | 4734 |
| 491 | Ga0501033_0002131 | 3300049570 | Bacteria | 17126 |
| 492 | Ga0501033_0003284 | 3300049570 | Bacteria | 13373 |
| 493 | Ga0501034_0018960 | 3300049571 | Bacteria | 7049 |
| 494 | Ga0501034_0116810 | 3300049571 | Bacteria | 2656 |
| 495 | Ga0501034_0383564 | 3300049571 | Bacteria | 1330 |
| 496 | Ga0501036_0053819 | 3300049572 | Bacteria | 3407 |
| 497 | Ga0501037_0026675 | 3300049573 | Bacteria | 4269 |
| 498 | Ga0501037_0095363 | 3300049573 | Bacteria | 2151 |
| 499 | Ga0501038_0003652 | 3300049574 | Bacteria | 14338 |
| 500 | Ga0501038_0074165 | 3300049574 | Bacteria | 2879 |
| 501 | Ga0501038_0285546 | 3300049574 | Bacteria | 1298 |
| 502 | Ga0501039_0021237 | 3300049575 | Bacteria | 4981 |
| 503 | Ga0501039_0292798 | 3300049575 | Bacteria | 1280 |
| 504 | Ga0501043_0014179 | 3300049579 | Bacteria | 6236 |
| 505 | Ga0501043_0038535 | 3300049579 | Bacteria | 3758 |
| 506 | Ga0501043_0046317 | 3300049579 | Bacteria | 3419 |
| 507 | Ga0501043_0160655 | 3300049579 | Bacteria | 1756 |
| 508 | Ga0501046_0010016 | 3300049580 | Bacteria | 8166 |
| 509 | Ga0501046_0145748 | 3300049580 | Bacteria | 1788 |
| 510 | Ga0501047_0037903 | 3300049581 | Bacteria | 4662 |
| 511 | Ga0501047_0040310 | 3300049581 | Bacteria | 4516 |
| 512 | Ga0501047_0101440 | 3300049581 | Bacteria | 2757 |
| 513 | Ga0501047_0328659 | 3300049581 | Bacteria | 1367 |
| 514 | Ga0501048_0014497 | 3300049582 | Bacteria | 5836 |
| 515 | Ga0501048_0020424 | 3300049582 | Bacteria | 4854 |
| 516 | Ga0501068_0037572 | 3300049584 | Bacteria | 2898 |
| 517 | Ga0501069_0000324 | 3300049585 | Bacteria | 21605 |
| 518 | Ga0501070_0003889 | 3300049586 | Bacteria | 12886 |
| 519 | Ga0501070_0030728 | 3300049586 | Bacteria | 4499 |
| 520 | Ga0501070_0039754 | 3300049586 | Bacteria | 3922 |
| 521 | Ga0501070_0474226 | 3300049586 | Bacteria | 1007 |
| 522 | Ga0501073_0039357 | 3300049589 | Bacteria | 3349 |
| 523 | Ga0501074_0005759 | 3300049590 | Bacteria | 8935 |
| 524 | Ga0501077_0028057 | 3300049593 | Bacteria | 3578 |
| 525 | Ga0501080_0015011 | 3300049742 | Bacteria | 7134 |
| 526 | Ga0501080_0318239 | 3300049742 | Bacteria | 1409 |
| 527 | Ga0501083_0001485 | 3300049744 | Bacteria | 16009 |
| 528 | Ga0501035_0064311 | 3300049822 | Bacteria | 3260 |
| 529 | Ga0501035_0172871 | 3300049822 | Bacteria | 1865 |
| 530 | Ga0501035_0186994 | 3300049822 | Bacteria | 1782 |
| 531 | Ga0501035_0272266 | 3300049822 | Bacteria | 1433 |
| 532 | Ga0501044_0033622 | 3300049823 | Bacteria | 5386 |
| 533 | Ga0501044_0056240 | 3300049823 | Bacteria | 4039 |
| 534 | Ga0501044_0057195 | 3300049823 | Bacteria | 4002 |
| 535 | Ga0501044_0292086 | 3300049823 | Bacteria | 1561 |
| 536 | Ga0501045_0083209 | 3300049824 | Bacteria | 2361 |
| 537 | nmdc:mga0k408_28277_c1 | 3300050493 | Bacteria | 3187 |
| 538 | nmdc:mga0k408_50556_c1 | 3300050493 | Bacteria | 2407 |
| 539 | nmdc:mga09592_108365_c1 | 3300050508 | Bacteria | 2382 |
| 540 | nmdc:mga09592_190785_c1 | 3300050508 | Bacteria | 1774 |
| 541 | nmdc:mga0qj67_7862_c1 | 3300050509 | Bacteria | 7878 |
| 542 | nmdc:mga06r32_10566_c1 | 3300050510 | Bacteria | 8323 |
| 543 | nmdc:mga08y16_10079_c1 | 3300050511 | Bacteria | 9919 |
| 544 | nmdc:mga08y16_5879_c1 | 3300050511 | Bacteria | 12855 |
| 545 | nmdc:mga08y16_91567_c1 | 3300050511 | Bacteria | 3169 |
| 546 | nmdc:mga0rr50_447979_c1 | 3300050513 | Bacteria | 1094 |
| 547 | nmdc:mga0rr50_79197_c1 | 3300050513 | Bacteria | 2530 |
| 548 | nmdc:mga08x19_42679_c1 | 3300050514 | Bacteria | 2892 |
| 549 | nmdc:mga0a205_34040_c1 | 3300050515 | Bacteria | 4887 |
| 550 | nmdc:mga0sz30_27261_c1 | 3300050516 | Bacteria | 2346 |
| 551 | Ga0495601_0003047 | 3300053077 | Bacteria | 9553 |
| 552 | Ga0495595_0035543 | 3300053084 | Bacteria | 2257 |
| 553 | Ga0495619_0038176 | 3300053085 | Bacteria | 3132 |
| 554 | Ga0500641_0024002 | 3300053096 | Bacteria | 2350 |
| 555 | Ga0500607_024620 | 3300053121 | Bacteria | 3358 |
| 556 | Ga0500559_0017187 | 3300053136 | Bacteria | 3054 |
| 557 | Ga0500636_0016817 | 3300053177 | Bacteria | 4312 |
| 558 | Ga0500637_0007002 | 3300053178 | Bacteria | 5609 |
| 559 | Ga0500625_000359 | 3300053729 | Bacteria | 11591 |
| 560 | Ga0501084_0163680 | 3300054114 | Bacteria | 1877 |
| 561 | Ga0590075_013342 | 3300059424 | Bacteria | 2002 |
| 562 | Ga0501082_0081602 | 3300060353 | Bacteria | 2790 |
| 563 | Ga0466962_0003050 | 3300061719 | Bacteria | 7985 |
| 564 | Ga0466962_0012152 | 3300061719 | Bacteria | 4139 |
| 565 | Ga0466962_0084188 | 3300061719 | Bacteria | 1521 |
| 566 | 2538834787 | 2537561836 | Bacteria | 3910579 |
| 567 | 2643829283 | 2643221562 | Bacteria | 4048635 |
| 568 | 2643895722 | 2643221577 | Bacteria | 3710843 |
| 569 | 2644477915 | 2643221685 | Bacteria | 3673288 |
| 570 | 2687584406 | 2687453130 | Bacteria | 4227172 |
| 571 | 2739732534 | 2739367700 | Bacteria | 4747630 |
| 572 | 2884412616 | 2884411467 | Bacteria | 5246714 |
| 573 | 2891635592 | 2891633521 | Bacteria | 4602265 |
| 574 | 2895398895 | 2895395659 | Bacteria | 3983269 |
| 575 | 2928965251 | 2928963466 | Bacteria | 5165703 |
| 576 | 2939613003 | 2939611941 | Bacteria | 3892017 |
| 577 | Ga0451576_0000168 | |||
| 578 | JGI24740J21852_10000678 | |||
| 579 | JGI24739J22299_10000934 | |||
| 580 | JGI24737J22298_10006753 | |||
| 581 | JGI24735J21928_10006544 | |||
| 582 | JGI25162J39368_1001140 | |||
| 583 | JGI25162J39368_1001141 | |||
| 584 | JGI25162J39368_1002305 | |||
| 585 | JGI25157J39369_1000133 | |||
| 586 | JGI25157J39369_1000213 | |||
| 587 | JGI25157J39369_1000314 | |||
| 588 | JGI25157J39369_1002011 | |||
| 589 | JGI25163J39215_1000210 | |||
| 590 | JGI25164J39214_1000075 | |||
| 591 | JGI25164J39214_1001087 | |||
| 592 | JGI25164J39214_1001115 | |||
| 593 | JGI25165J46597_1000178 | |||
| 594 | JGI25165J46597_1002091 | |||
| 595 | rootH1_10069084 | |||
| 596 | rootH2_10038156 | |||
| 597 | Ga0006562J51391_1017132 | |||
| 598 | Ga0006562J51391_1017133 | |||
| 599 | Ga0055538_1000590 | |||
| 600 | Ga0055533_1001374 | |||
| 601 | Ga0055533_1001584 | |||
| 602 | Ga0055525_1000124 | |||
| 603 | Ga0055525_1000184 | |||
| 604 | Ga0055527_1000094 | |||
| 605 | Ga0055527_1000180 | |||
| 606 | Ga0055535_1000350 | |||
| 607 | Ga0055535_1000421 | |||
| 608 | Ga0055535_1000807 | |||
| 609 | Ga0055535_1002095 | |||
| 610 | Ga0055542_1000312 | |||
| 611 | Ga0055542_1000326 | |||
| 612 | Ga0055542_1001122 | |||
| 613 | Ga0055542_1001123 | |||
| 614 | Ga0055542_1001976 | |||
| 615 | Ga0055529_1000153 | |||
| 616 | Ga0055529_1000434 | |||
| 617 | Ga0055529_1000893 | |||
| 618 | Ga0055529_1007994 | |||
| 619 | Ga0065165_1009247 | |||
| 620 | Ga0070658_10037931 | |||
| 621 | Ga0070680_100190937 | |||
| 622 | Ga0070682_100004611 | |||
| 623 | Ga0070682_100049271 | |||
| 624 | Ga0068868_100058991 | |||
| 625 | Ga0068868_100174768 | |||
| 626 | Ga0070660_100049952 | |||
| 627 | Ga0070689_100003954 | |||
| 628 | Ga0070691_10019335 | |||
| 629 | Ga0070692_10016893 | |||
| 630 | Ga0070692_10104267 | |||
| 631 | Ga0070692_10182993 | |||
| 632 | Ga0070675_100205720 | |||
| 633 | Ga0070671_100360320 | |||
| 634 | Ga0070673_100409039 | |||
| 635 | Ga0070688_100144312 | |||
| 636 | Ga0070659_100030519 | |||
| 637 | Ga0070659_100033518 | |||
| 638 | Ga0070667_100379680 | |||
| 639 | Ga0070714_100001006 | |||
| 640 | Ga0070714_100011167 | |||
| 641 | Ga0070714_100181124 | |||
| 642 | Ga0070714_100217626 | |||
| 643 | Ga0070714_100497302 | |||
| 644 | Ga0070713_100000528 | |||
| 645 | Ga0070710_10277303 | |||
| 646 | Ga0070701_10079706 | |||
| 647 | Ga0070663_100035591 | |||
| 648 | Ga0070663_100101789 | |||
| 649 | Ga0070681_10022732 | |||
| 650 | Ga0070681_10042404 | |||
| 651 | Ga0070681_10148217 | |||
| 652 | Ga0070681_10154381 | |||
| 653 | Ga0068867_100066741 | |||
| 654 | Ga0070685_10000983 | |||
| 655 | Ga0070679_100065616 | |||
| 656 | Ga0070679_100544246 | |||
| 657 | Ga0070684_100046846 | |||
| 658 | Ga0070684_100576382 | |||
| 659 | Ga0068853_100001937 | |||
| 660 | Ga0068853_100341086 | |||
| 661 | Ga0070672_100079419 | |||
| 662 | Ga0070696_100001750 | |||
| 663 | Ga0070696_100015752 | |||
| 664 | Ga0070696_100067995 | |||
| 665 | Ga0070693_100023320 | |||
| 666 | Ga0070693_100037352 | |||
| 667 | Ga0070693_100052699 | |||
| 668 | Ga0070693_100189133 | |||
| 669 | Ga0068855_100024000 | |||
| 670 | Ga0068855_100027019 | |||
| 671 | Ga0068855_100056615 | |||
| 672 | Ga0068855_100132671 | |||
| 673 | Ga0068855_100234556 | |||
| 674 | Ga0068857_100000919 | |||
| 675 | Ga0068857_100032172 | |||
| 676 | Ga0068857_100091782 | |||
| 677 | Ga0068857_100505324 | |||
| 678 | Ga0068854_100006938 | |||
| 679 | Ga0068854_100038019 | |||
| 680 | Ga0068854_100097000 | |||
| 681 | Ga0068856_100000495 | |||
| 682 | Ga0068856_100001721 | |||
| 683 | Ga0068856_100086428 | |||
| 684 | Ga0070702_100080963 | |||
| 685 | Ga0068852_100006980 | |||
| 686 | Ga0068852_100128247 | |||
| 687 | Ga0068852_100171059 | |||
| 688 | Ga0068864_100203333 | |||
| 689 | Ga0068866_10106766 | |||
| 690 | Ga0068851_10022370 | |||
| 691 | Ga0068862_100074944 | |||
| 692 | Ga0070715_10034867 | |||
| 693 | Ga0070712_100035625 | |||
| 694 | Ga0075431_100004424 | |||
| 695 | Ga0075434_100040256 | |||
| 696 | Ga0075429_100030108 | |||
| 697 | Ga0075429_100115244 | |||
| 698 | Ga0068865_100069426 | |||
| 699 | Ga0068865_100104063 | |||
| 700 | Ga0105240_10006007 | |||
| 701 | Ga0105240_10007228 | |||
| 702 | Ga0105240_10007369 | |||
| 703 | Ga0105240_10048609 | |||
| 704 | Ga0105240_10096165 | |||
| 705 | Ga0105240_10163584 | |||
| 706 | Ga0105240_10236454 | |||
| 707 | Ga0105240_10332181 | |||
| 708 | Ga0111539_10005579 | |||
| 709 | Ga0111539_10005732 | |||
| 710 | Ga0111539_10111077 | |||
| 711 | Ga0105245_10098453 | |||
| 712 | Ga0105245_10267129 | |||
| 713 | Ga0105241_10045116 | |||
| 714 | Ga0105241_10158928 | |||
| 715 | Ga0105242_10001680 | |||
| 716 | Ga0105242_10361377 | |||
| 717 | Ga0105237_10000011 | |||
| 718 | Ga0105237_10000815 | |||
| 719 | Ga0105237_10040935 | |||
| 720 | Ga0105237_10102910 | |||
| 721 | Ga0105237_10114424 | |||
| 722 | Ga0105237_10146214 | |||
| 723 | Ga0105237_10250314 | |||
| 724 | Ga0105238_10000760 | |||
| 725 | Ga0105238_10012012 | |||
| 726 | Ga0105238_10110623 | |||
| 727 | Ga0105238_10115605 | |||
| 728 | Ga0105238_10134680 | |||
| 729 | Ga0105239_10000027 | |||
| 730 | Ga0105239_10116093 | |||
| 731 | Ga0157314_1000064 | |||
| 732 | Ga0157373_10062853 | |||
| 733 | Ga0157371_10023341 | |||
| 734 | Ga0157371_10076383 | |||
| 735 | Ga0157371_10123516 | |||
| 736 | Ga0157371_10133511 | |||
| 737 | Ga0157370_10009289 | |||
| 738 | Ga0157370_10011822 | |||
| 739 | Ga0157370_10017730 | |||
| 740 | Ga0157370_10025808 | |||
| 741 | Ga0157370_10050049 | |||
| 742 | Ga0157370_10125537 | |||
| 743 | Ga0157370_10425737 | |||
| 744 | Ga0157369_10007761 | |||
| 745 | Ga0157369_10193712 | |||
| 746 | Ga0157374_10049675 | |||
| 747 | Ga0157374_10136811 | |||
| 748 | Ga0157372_10014552 | |||
| 749 | Ga0157372_10067138 | |||
| 750 | Ga0157372_10078054 | |||
| 751 | Ga0157372_10103975 | |||
| 752 | Ga0157375_10053233 | |||
| 753 | Ga0157375_10509277 | |||
| 754 | Ga0157380_10080886 | |||
| 755 | Ga0182008_10086054 | |||
| 756 | Ga0157377_10010130 | |||
| 757 | Ga0157379_10005424 | |||
| 758 | Ga0182006_1048094 | |||
| 759 | Ga0182007_10009448 | |||
| 760 | Ga0183369_1018 | |||
| 761 | Ga0183368_1003 | |||
| 762 | Ga0163161_10168107 | |||
| 763 | Ga0206356_10936611 | |||
| 764 | Ga0206353_11707163 | |||
| 765 | Ga0213876_10009570 | |||
| 766 | Ga0213876_10027810 | |||
| 767 | Ga0209760_100466 | |||
| 768 | Ga0209784_100104 | |||
| 769 | Ga0209566_101646 | |||
| 770 | Ga0209674_100012 | |||
| 771 | Ga0209674_100079 | |||
| 772 | Ga0209674_100856 | |||
| 773 | Ga0209672_100005 | |||
| 774 | Ga0209672_100055 | |||
| 775 | Ga0209672_100270 | |||
| 776 | Ga0209672_100765 | |||
| 777 | Ga0209563_100045 | |||
| 778 | Ga0207427_100070 | |||
| 779 | Ga0207427_101337 | |||
| 780 | Ga0207427_103511 | |||
| 781 | Ga0209437_100005 | |||
| 782 | Ga0209437_100059 | |||
| 783 | Ga0209437_100214 | |||
| 784 | Ga0209437_101184 | |||
| 785 | Ga0209258_100006 | |||
| 786 | Ga0209258_100027 | |||
| 787 | Ga0209258_100135 | |||
| 788 | Ga0209258_100152 | |||
| 789 | Ga0209258_104449 | |||
| 790 | Ga0209258_105522 | |||
| 791 | Ga0209646_1001180 | |||
| 792 | Ga0209646_1001826 | |||
| 793 | Ga0209646_1009959 | |||
| 794 | Ga0209026_1000017 | |||
| 795 | Ga0209026_1000055 | |||
| 796 | Ga0209026_1000176 | |||
| 797 | Ga0209026_1000319 | |||
| 798 | Ga0209677_101939 | |||
| 799 | Ga0209148_1000001 | |||
| 800 | Ga0209148_1000002 | |||
| 801 | Ga0209148_1000012 | |||
| 802 | Ga0209148_1000014 | |||
| 803 | Ga0209148_1000102 | |||
| 804 | Ga0209759_1000267 | |||
| 805 | Ga0209759_1000333 | |||
| 806 | Ga0209129_1001293 | |||
| 807 | Ga0209233_1000002 | |||
| 808 | Ga0209233_1000011 | |||
| 809 | Ga0209233_1000193 | |||
| 810 | Ga0209233_1001248 | |||
| 811 | Ga0209233_1013294 | |||
| 812 | Ga0209455_1000008 | |||
| 813 | Ga0209455_1000014 | |||
| 814 | Ga0209455_1000019 | |||
| 815 | Ga0209455_1000297 | |||
| 816 | Ga0209758_1000791 | |||
| 817 | Ga0207656_10012383 | |||
| 818 | Ga0207682_10034219 | |||
| 819 | Ga0207692_10150675 | |||
| 820 | Ga0207647_10002665 | |||
| 821 | Ga0207654_10094107 | |||
| 822 | Ga0207654_10105869 | |||
| 823 | Ga0207707_10004111 | |||
| 824 | Ga0207707_10035028 | |||
| 825 | Ga0207695_10001405 | |||
| 826 | Ga0207695_10005890 | |||
| 827 | Ga0207695_10005938 | |||
| 828 | Ga0207695_10009237 | |||
| 829 | Ga0207695_10013055 | |||
| 830 | Ga0207695_10152347 | |||
| 831 | Ga0207695_10291125 | |||
| 832 | Ga0207671_10000011 | |||
| 833 | Ga0207671_10000359 | |||
| 834 | Ga0207662_10080041 | |||
| 835 | Ga0207657_10026845 | |||
| 836 | Ga0207657_10083113 | |||
| 837 | Ga0207652_10253715 | |||
| 838 | Ga0207681_10295486 | |||
| 839 | Ga0207694_10000412 | |||
| 840 | Ga0207694_10023548 | |||
| 841 | Ga0207694_10062816 | |||
| 842 | Ga0207694_10138421 | |||
| 843 | Ga0207650_10005646 | |||
| 844 | Ga0207659_10054366 | |||
| 845 | Ga0207659_10272713 | |||
| 846 | Ga0207687_10027650 | |||
| 847 | Ga0207700_10007910 | |||
| 848 | Ga0207664_10000897 | |||
| 849 | Ga0207664_10008623 | |||
| 850 | Ga0207664_10018969 | |||
| 851 | Ga0207690_10017586 | |||
| 852 | Ga0207690_10042056 | |||
| 853 | Ga0207690_10048114 | |||
| 854 | Ga0207690_10066100 | |||
| 855 | Ga0207690_10100846 | |||
| 856 | Ga0207706_10023351 | |||
| 857 | Ga0207686_10050646 | |||
| 858 | Ga0207709_10257115 | |||
| 859 | Ga0207670_10001106 | |||
| 860 | Ga0207670_10029503 | |||
| 861 | Ga0207669_10186705 | |||
| 862 | Ga0207691_10009379 | |||
| 863 | Ga0207689_10043464 | |||
| 864 | Ga0207667_10004745 | |||
| 865 | Ga0207667_10005660 | |||
| 866 | Ga0207667_10005765 | |||
| 867 | Ga0207667_10010445 | |||
| 868 | Ga0207667_10053646 | |||
| 869 | Ga0207667_10081453 | |||
| 870 | Ga0207667_10130630 | |||
| 871 | Ga0207712_10183646 | |||
| 872 | Ga0207712_10273106 | |||
| 873 | Ga0207640_10004782 | |||
| 874 | Ga0207640_10024415 | |||
| 875 | Ga0207640_10028380 | |||
| 876 | Ga0207658_10246804 | |||
| 877 | Ga0207677_10091555 | |||
| 878 | Ga0207677_10140528 | |||
| 879 | Ga0207639_10047142 | |||
| 880 | Ga0207678_10002215 | |||
| 881 | Ga0207678_10073268 | |||
| 882 | Ga0207702_10000107 | |||
| 883 | Ga0207702_10005749 | |||
| 884 | Ga0207702_10388592 | |||
| 885 | Ga0207648_10066316 | |||
| 886 | Ga0207648_10225788 | |||
| 887 | Ga0207674_10000146 | |||
| 888 | Ga0207674_10015476 | |||
| 889 | Ga0207674_10028651 | |||
| 890 | Ga0207674_10151278 | |||
| 891 | Ga0207683_10068464 | |||
| 892 | Ga0207698_10013355 | |||
| 893 | Ga0207698_10021205 | |||
| 894 | Ga0207698_10028495 | |||
| 895 | Ga0209999_1010830 | |||
| 896 | Ga0209971_1022415 | |||
| 897 | Ga0207428_10058285 | |||
| 898 | Ga0207428_10071647 | |||
| 899 | Ga0268265_10090102 | |||
| 900 | Ga0268264_10030947 | |||
| 901 | Ga0265323_10006775 | |||
| 902 | Ga0265332_10039804 | |||
| 903 | Ga0265328_10012591 | |||
| 904 | Ga0265328_10018066 | |||
| 905 | Ga0265325_10001423 | |||
| 906 | Ga0265327_10000085 | |||
| 907 | Ga0265327_10055660 | |||
| 908 | Ga0265316_10000163 | |||
| 909 | Ga0265316_10025248 | |||
| 910 | Ga0265316_10079898 | |||
| 911 | Ga0307509_10000076 | |||
| 912 | Ga0307408_100203161 | |||
| 913 | Ga0307508_10054033 | |||
| 914 | Ga0307405_10075122 | |||
| 915 | Ga0307405_10206955 | |||
| 916 | Ga0316577_10141124 | |||
| 917 | Ga0307413_10054434 | |||
| 918 | Ga0307410_10197503 | |||
| 919 | Ga0307412_10096801 | |||
| 920 | Ga0307416_100149038 | |||
| 921 | Ga0307416_100149888 | |||
| 922 | Ga0307414_10228419 | |||
| 923 | Ga0316583_10002481 | |||
| 924 | Ga0373952_0007064 | |||
| 925 | Ga0373960_0047000 | |||
| 926 | Ga0373931_0018071 | |||
| 927 | Ga0373931_0019234 | |||
| 928 | Ga0373937_0062907 | |||
| 929 | Ga0373925_0023038 | |||
| 930 | Ga0395899_0000081 | |||
| 931 | Ga0395899_0010006 | |||
| 932 | Ga0395899_0011743 | |||
| 933 | Ga0395899_0022981 | |||
| 934 | Ga0395900_0000024 | |||
| 935 | Ga0395900_0048777 | |||
| 936 | Ga0395900_0099067 | |||
| 937 | Ga0395900_0148986 | |||
| 938 | Ga0395898_0000044 | |||
| 939 | Ga0395898_0000132 | |||
| 940 | Ga0395898_0029899 | |||
| 941 | Ga0395898_0030106 | |||
| 942 | Ga0395898_0056056 | |||
| 943 | Ga0395898_0295464 | |||
| 944 | Ga0395905_0000944 | |||
| 945 | Ga0395901_0015747 | |||
| 946 | Ga0395901_0022248 | |||
| 947 | Ga0395901_0113799 | |||
| 948 | Ga0395901_0185482 | |||
| 949 | Ga0395901_0712077 | |||
| 950 | Ga0400484_06254 | |||
| 951 | Ga0400484_15735 | |||
| 952 | Ga0400484_16952 | |||
| 953 | Ga0400490_21780 | |||
| 954 | Ga0400490_26731 | |||
| 955 | Ga0400491_13101 | |||
| 956 | Ga0400488_48895 | |||
| 957 | Ga0400487_25945 | |||
| 958 | Ga0400487_63974 | |||
| 959 | Ga0436365_1218422 | |||
| 960 | Ga0436365_1311974 | |||
| 961 | Ga0439437_007477 | |||
| 962 | Ga0439441_001493 | |||
| 963 | Ga0439448_0018422 | |||
| 964 | Ga0439459_0000277 | |||
| 965 | Ga0451577_0000997 | |||
| 966 | Ga0451577_0032467 | |||
| 967 | Ga0451577_0129486 | |||
| 968 | Ga0451577_0149632 | |||
| 969 | Ga0451577_0168409 | |||
| 970 | Ga0451577_0180408 | |||
| 971 | Ga0466988_0061414 | |||
| 972 | Ga0466969_0036812 | |||
| 973 | Ga0466982_0000012 | |||
| 974 | Ga0453683_0030211 | |||
| 975 | Ga0453683_0280986 | |||
| 976 | Ga0466966_0093317 | |||
| 977 | Ga0466966_0093319 | |||
| 978 | Ga0466961_0005884 | |||
| 979 | Ga0466961_0032939 | |||
| 980 | Ga0466961_0176524 | |||
| 981 | Ga0466963_0507856 | |||
| 982 | Ga0466964_0002156 | |||
| 983 | Ga0466964_0017754 | |||
| 984 | Ga0453684_0000014 | |||
| 985 | Ga0453684_0000114 | |||
| 986 | Ga0453684_0001268 | |||
| 987 | Ga0453684_0001455 | |||
| 988 | Ga0453684_0002221 | |||
| 989 | Ga0453684_0006329 | |||
| 990 | Ga0453684_0014423 | |||
| 991 | Ga0453684_0014453 | |||
| 992 | Ga0453684_0033743 | |||
| 993 | Ga0453684_0769660 | |||
| 994 | Ga0466971_0002536 | |||
| 995 | Ga0466971_0005914 | |||
| 996 | Ga0466971_0029564 | |||
| 997 | Ga0466970_0012456 | |||
| 998 | Ga0466970_0012952 | |||
| 999 | Ga0466957_0003289 | |||
| 1000 | Ga0466959_0000254 | |||
| 1001 | Ga0466959_0031161 | |||
| 1002 | Ga0466959_0064211 | |||
| 1003 | Ga0466959_0264048 | |||
| 1004 | Ga0451576_0001018 | |||
| 1005 | Ga0451576_0008659 | |||
| 1006 | Ga0451576_0016606 | |||
| 1007 | Ga0451576_0064215 | |||
| 1008 | Ga0451576_0069492 | |||
| 1009 | Ga0451576_0170053 | |||
| 1010 | Ga0451576_0679939 | |||
| 1011 | Ga0451576_0855362 | |||
| 1012 | Ga0466958_0310714 | |||
| 1013 | Ga0495592_0023258 | |||
| 1014 | Ga0495638_0000019 | |||
| 1015 | Ga0495638_0000164 | |||
| 1016 | Ga0495638_0003036 | |||
| 1017 | Ga0495650_0000498 | |||
| 1018 | Ga0495606_0001115 | |||
| 1019 | Ga0495642_0059062 | |||
| 1020 | Ga0495652_0036075 | |||
| 1021 | Ga0495645_0001432 | |||
| 1022 | Ga0495622_0134292 | |||
| 1023 | Ga0495625_0025209 | |||
| 1024 | Ga0495623_0003408 | |||
| 1025 | Ga0495649_0001556 | |||
| 1026 | Ga0495675_0137029 | |||
| 1027 | Ga0495677_0051398 | |||
| 1028 | Ga0495684_0132902 | |||
| 1029 | Ga0496100_0146997 | |||
| 1030 | Ga0496102_0487562 | |||
| 1031 | Ga0496104_0098276 | |||
| 1032 | Ga0496104_0250857 | |||
| 1033 | Ga0496105_0001031 | |||
| 1034 | Ga0496106_0302367 | |||
| 1035 | Ga0496107_0050259 | |||
| 1036 | Ga0496108_0005364 | |||
| 1037 | Ga0496109_0005384 | |||
| 1038 | Ga0496109_0134960 | |||
| 1039 | Ga0496110_0281459 | |||
| 1040 | Ga0496114_0044935 | |||
| 1041 | Ga0496114_0070777 | |||
| 1042 | Ga0496114_0237997 | |||
| 1043 | Ga0496115_0000238 | |||
| 1044 | Ga0496115_0012074 | |||
| 1045 | Ga0496115_0046709 | |||
| 1046 | Ga0496117_0007041 | |||
| 1047 | Ga0496117_0184827 | |||
| 1048 | Ga0496118_0002869 | |||
| 1049 | Ga0496118_0006327 | |||
| 1050 | Ga0496119_0000322 | |||
| 1051 | Ga0496119_0016776 | |||
| 1052 | Ga0496120_0000143 | |||
| 1053 | Ga0496120_0000665 | |||
| 1054 | Ga0496121_0000938 | |||
| 1055 | Ga0496121_0008205 | |||
| 1056 | Ga0496121_0279221 | |||
| 1057 | Ga0496125_0000469 | |||
| 1058 | Ga0496126_0001473 | |||
| 1059 | Ga0496126_0043303 | |||
| 1060 | Ga0496126_0045513 | |||
| 1061 | Ga0496126_0074071 | |||
| 1062 | Ga0495678_016942 | |||
| 1063 | Ga0495682_0007012 | |||
| 1064 | Ga0501031_0087879 | |||
| 1065 | Ga0501031_0089798 | |||
| 1066 | Ga0501032_0019572 | |||
| 1067 | Ga0501033_0002131 | |||
| 1068 | Ga0501033_0003284 | |||
| 1069 | Ga0501034_0018960 | |||
| 1070 | Ga0501034_0116810 | |||
| 1071 | Ga0501034_0383564 | |||
| 1072 | Ga0501036_0053819 | |||
| 1073 | Ga0501037_0026675 | |||
| 1074 | Ga0501037_0095363 | |||
| 1075 | Ga0501038_0003652 | |||
| 1076 | Ga0501038_0074165 | |||
| 1077 | Ga0501038_0285546 | |||
| 1078 | Ga0501039_0021237 | |||
| 1079 | Ga0501039_0292798 | |||
| 1080 | Ga0501043_0014179 | |||
| 1081 | Ga0501043_0038535 | |||
| 1082 | Ga0501043_0046317 | |||
| 1083 | Ga0501043_0160655 | |||
| 1084 | Ga0501046_0010016 | |||
| 1085 | Ga0501046_0145748 | |||
| 1086 | Ga0501047_0037903 | |||
| 1087 | Ga0501047_0040310 | |||
| 1088 | Ga0501047_0101440 | |||
| 1089 | Ga0501047_0328659 | |||
| 1090 | Ga0501048_0014497 | |||
| 1091 | Ga0501048_0020424 | |||
| 1092 | Ga0501068_0037572 | |||
| 1093 | Ga0501069_0000324 | |||
| 1094 | Ga0501070_0003889 | |||
| 1095 | Ga0501070_0030728 | |||
| 1096 | Ga0501070_0039754 | |||
| 1097 | Ga0501070_0474226 | |||
| 1098 | Ga0501073_0039357 | |||
| 1099 | Ga0501074_0005759 | |||
| 1100 | Ga0501077_0028057 | |||
| 1101 | Ga0501080_0015011 | |||
| 1102 | Ga0501080_0318239 | |||
| 1103 | Ga0501083_0001485 | |||
| 1104 | Ga0501035_0064311 | |||
| 1105 | Ga0501035_0172871 | |||
| 1106 | Ga0501035_0186994 | |||
| 1107 | Ga0501035_0272266 | |||
| 1108 | Ga0501044_0033622 | |||
| 1109 | Ga0501044_0056240 | |||
| 1110 | Ga0501044_0057195 | |||
| 1111 | Ga0501044_0292086 | |||
| 1112 | Ga0501045_0083209 | |||
| 1113 | nmdc:mga0k408_28277_c1 | |||
| 1114 | nmdc:mga0k408_50556_c1 | |||
| 1115 | nmdc:mga09592_108365_c1 | |||
| 1116 | nmdc:mga09592_190785_c1 | |||
| 1117 | nmdc:mga0qj67_7862_c1 | |||
| 1118 | nmdc:mga06r32_10566_c1 | |||
| 1119 | nmdc:mga08y16_10079_c1 | |||
| 1120 | nmdc:mga08y16_5879_c1 | |||
| 1121 | nmdc:mga08y16_91567_c1 | |||
| 1122 | nmdc:mga0rr50_447979_c1 | |||
| 1123 | nmdc:mga0rr50_79197_c1 | |||
| 1124 | nmdc:mga08x19_42679_c1 | |||
| 1125 | nmdc:mga0a205_34040_c1 | |||
| 1126 | nmdc:mga0sz30_27261_c1 | |||
| 1127 | Ga0495601_0003047 | |||
| 1128 | Ga0495595_0035543 | |||
| 1129 | Ga0495619_0038176 | |||
| 1130 | Ga0500641_0024002 | |||
| 1131 | Ga0500607_024620 | |||
| 1132 | Ga0500559_0017187 | |||
| 1133 | Ga0500636_0016817 | |||
| 1134 | Ga0500637_0007002 | |||
| 1135 | Ga0500625_000359 | |||
| 1136 | Ga0501084_0163680 | |||
| 1137 | Ga0590075_013342 | |||
| 1138 | Ga0501082_0081602 | |||
| 1139 | Ga0466962_0003050 | |||
| 1140 | Ga0466962_0012152 | |||
| 1141 | Ga0466962_0084188 | |||
| 1142 | 2538834787 | |||
| 1143 | 2643829283 | |||
| 1144 | 2643895722 | |||
| 1145 | 2644477915 | |||
| 1146 | 2687584406 | |||
| 1147 | 2739732534 | |||
| 1148 | 2884412616 | |||
| 1149 | 2891635592 | |||
| 1150 | 2895398895 | |||
| 1151 | 2928965251 | |||
| 1152 | 2939613003 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.9427 | 10 | 307 |
| 3tka-assembly1.cif.gz_A-2 | crystal structure and solution saxs of methyltransferase rsmh from e.coli | 0.933 | 10 | 307 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9249 | 8 | 308 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.9185 | 8 | 308 |
| 1n2x-assembly2.cif.gz_B | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.8948 | 8 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9678 | 113 | 213 | 1.10.150.170 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9656 | 114 | 213 | 1.10.150.170 |
| af_P60390_9_313_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9458 | 10 | 307 | 3.40.50.150 |
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9399 | 113 | 213 | 1.10.150.170 |
| af_P9WJP1_66_380_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9307 | 9 | 307 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A508B7A7-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9857 | 6 | 308 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A1E4KB80-F1-model_v4 | Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) | 0.9825 | 12 | 307 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A2X3E5Y1-F1-model_v4 | rRNA small subunit methyltransferase H (EC 2.1.1.199) | 0.9788 | 119 | 213 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A5Q4FCA8-F1-model_v4 | deleted | 0.9773 | 6 | 254 |
|
| AF-A0A656GR36-F1-model_v4 | deleted | 0.9755 | 82 | 255 |
|