F465535

General Info

Members Datasets Scaffolds Average Seq Length
576 296 1152 310

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0000168|Ga0451576_0000168_33493_34566
Length 357
Sequence VSADAHVSVLLAEAVAALAIQPAGTYVDATFGRGGHSRAILAGLGSQGRLIALDRDPAAIAVGATIPDPRFTLVHAAFSEIHTVLDRLGVKQVDGVLLDIGVSSPQLNTPERGMSFRFDAPLDMRMDTTQGETAAEFLARASQSELERVIRDYGEERFAHAIAKALVAARGEHGISRTGELATLVAQVVRTREPGQHPATRTFQALRIHVNRELEELSLALPRAVERLAPGGRLAVICFHSLEDRIVKRFMRDAAHPPQPPKGVPVRAADLPQPVMNLVGKAMFPSAAEIAANPRCRSAVLRVAQKVGNPSDPVSANGGDRPAAGPSQGMASQKHGAAKRRTTVTPAHGRGPGGGSH

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
89 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
183 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
184 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
185 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
186 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
287 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
288 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
289 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
290 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
291 2739367700 Dyella sp. YR388 Isolate Unclassified
292 2884411467 Dyella sp. AD56 Isolate Rhizosphere
293 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
294 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
295 2928963466 Dyella japonica 1073 Isolate Unclassified
296 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0.69
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 0
Rhizoplane 2.95
Rhizosphere 72.92
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0000168 3300045051 Bacteria 165624
2 JGI24740J21852_10000678 3300001979 Bacteria 14765
3 JGI24739J22299_10000934 3300001989 Bacteria 10874
4 JGI24737J22298_10006753 3300001990 Bacteria 3900
5 JGI24735J21928_10006544 3300002067 Bacteria 3830
6 JGI25162J39368_1001140 3300002737 Bacteria 15933
7 JGI25162J39368_1001141 3300002737 Bacteria 15919
8 JGI25162J39368_1002305 3300002737 Bacteria 7662
9 JGI25157J39369_1000133 3300002741 Bacteria 62143
10 JGI25157J39369_1000213 3300002741 Bacteria 48048
11 JGI25157J39369_1000314 3300002741 Bacteria 34899
12 JGI25157J39369_1002011 3300002741 Bacteria 5912
13 JGI25163J39215_1000210 3300002771 Bacteria 22204
14 JGI25164J39214_1000075 3300002772 Bacteria 97713
15 JGI25164J39214_1001087 3300002772 Bacteria 7899
16 JGI25164J39214_1001115 3300002772 Bacteria 7662
17 JGI25165J46597_1000178 3300003214 Bacteria 97713
18 JGI25165J46597_1002091 3300003214 Bacteria 7359
19 rootH1_10069084 3300003316 Bacteria 4561
20 rootH2_10038156 3300003320 Bacteria 6937
21 Ga0006562J51391_1017132 3300003578 Bacteria 8263
22 Ga0006562J51391_1017133 3300003578 Bacteria 2870
23 Ga0055538_1000590 3300003751 Bacteria 12121
24 Ga0055533_1001374 3300003756 Bacteria 6492
25 Ga0055533_1001584 3300003756 Bacteria 5909
26 Ga0055525_1000124 3300003759 Bacteria 116698
27 Ga0055525_1000184 3300003759 Bacteria 77971
28 Ga0055527_1000094 3300003760 Bacteria 68614
29 Ga0055527_1000180 3300003760 Bacteria 42287
30 Ga0055535_1000350 3300003761 Bacteria 45642
31 Ga0055535_1000421 3300003761 Bacteria 39851
32 Ga0055535_1000807 3300003761 Bacteria 22701
33 Ga0055535_1002095 3300003761 Bacteria 7939
34 Ga0055542_1000312 3300003762 Bacteria 52869
35 Ga0055542_1000326 3300003762 Bacteria 50636
36 Ga0055542_1001122 3300003762 Bacteria 15933
37 Ga0055542_1001123 3300003762 Bacteria 15927
38 Ga0055542_1001976 3300003762 Bacteria 7951
39 Ga0055529_1000153 3300003763 Bacteria 97713
40 Ga0055529_1000434 3300003763 Bacteria 42287
41 Ga0055529_1000893 3300003763 Bacteria 16800
42 Ga0055529_1007994 3300003763 Bacteria 1417
43 Ga0065165_1009247 3300005262 Bacteria 4449
44 Ga0070658_10037931 3300005327 Bacteria 3885
45 Ga0070680_100190937 3300005336 Bacteria 1726
46 Ga0070682_100004611 3300005337 Bacteria 7659
47 Ga0070682_100049271 3300005337 Bacteria 2625
48 Ga0068868_100058991 3300005338 Bacteria 3034
49 Ga0068868_100174768 3300005338 Bacteria 1779
50 Ga0070660_100049952 3300005339 Bacteria 3217
51 Ga0070689_100003954 3300005340 Bacteria 9951
52 Ga0070691_10019335 3300005341 Bacteria 3143
53 Ga0070692_10016893 3300005345 Bacteria 3478
54 Ga0070692_10104267 3300005345 Bacteria 1559
55 Ga0070692_10182993 3300005345 Bacteria 1216
56 Ga0070675_100205720 3300005354 Bacteria 1710
57 Ga0070671_100360320 3300005355 Bacteria 1242
58 Ga0070673_100409039 3300005364 Bacteria 1214
59 Ga0070688_100144312 3300005365 Bacteria 1620
60 Ga0070659_100030519 3300005366 Bacteria 4172
61 Ga0070659_100033518 3300005366 Bacteria 3989
62 Ga0070667_100379680 3300005367 Bacteria 1283
63 Ga0070714_100001006 3300005435 Bacteria 20106
64 Ga0070714_100011167 3300005435 Bacteria 7119
65 Ga0070714_100181124 3300005435 Bacteria 1917
66 Ga0070714_100217626 3300005435 Bacteria 1754
67 Ga0070714_100497302 3300005435 Bacteria 1163
68 Ga0070713_100000528 3300005436 Bacteria 24207
69 Ga0070710_10277303 3300005437 Bacteria 1087
70 Ga0070701_10079706 3300005438 Bacteria 1769
71 Ga0070663_100035591 3300005455 Bacteria 3455
72 Ga0070663_100101789 3300005455 Bacteria 2145
73 Ga0070681_10022732 3300005458 Bacteria 6301
74 Ga0070681_10042404 3300005458 Bacteria 4560
75 Ga0070681_10148217 3300005458 Bacteria 2274
76 Ga0070681_10154381 3300005458 Bacteria 2221
77 Ga0068867_100066741 3300005459 Bacteria 2680
78 Ga0070685_10000983 3300005466 Bacteria 15333
79 Ga0070679_100065616 3300005530 Bacteria 3618
80 Ga0070679_100544246 3300005530 Bacteria 1104
81 Ga0070684_100046846 3300005535 Bacteria 3746
82 Ga0070684_100576382 3300005535 Bacteria 1045
83 Ga0068853_100001937 3300005539 Bacteria 15270
84 Ga0068853_100341086 3300005539 Bacteria 1392
85 Ga0070672_100079419 3300005543 Bacteria 2626
86 Ga0070696_100001750 3300005546 Bacteria 14237
87 Ga0070696_100015752 3300005546 Bacteria 5081
88 Ga0070696_100067995 3300005546 Bacteria 2501
89 Ga0070693_100023320 3300005547 Bacteria 3306
90 Ga0070693_100037352 3300005547 Bacteria 2708
91 Ga0070693_100052699 3300005547 Bacteria 2334
92 Ga0070693_100189133 3300005547 Bacteria 1330
93 Ga0068855_100024000 3300005563 Bacteria 7301
94 Ga0068855_100027019 3300005563 Bacteria 6867
95 Ga0068855_100056615 3300005563 Bacteria 4599
96 Ga0068855_100132671 3300005563 Bacteria 2843
97 Ga0068855_100234556 3300005563 Bacteria 2052
98 Ga0068857_100000919 3300005577 Bacteria 22265
99 Ga0068857_100032172 3300005577 Bacteria 4637
100 Ga0068857_100091782 3300005577 Bacteria 2719
101 Ga0068857_100505324 3300005577 Bacteria 1135
102 Ga0068854_100006938 3300005578 Bacteria 7224
103 Ga0068854_100038019 3300005578 Bacteria 3382
104 Ga0068854_100097000 3300005578 Bacteria 2203
105 Ga0068856_100000495 3300005614 Bacteria 43612
106 Ga0068856_100001721 3300005614 Bacteria 22879
107 Ga0068856_100086428 3300005614 Bacteria 3116
108 Ga0070702_100080963 3300005615 Bacteria 1944
109 Ga0068852_100006980 3300005616 Bacteria 8218
110 Ga0068852_100128247 3300005616 Bacteria 2332
111 Ga0068852_100171059 3300005616 Bacteria 2036
112 Ga0068864_100203333 3300005618 Bacteria 1820
113 Ga0068866_10106766 3300005718 Bacteria 1554
114 Ga0068851_10022370 3300005834 Bacteria 3079
115 Ga0068862_100074944 3300005844 Bacteria 2926
116 Ga0070715_10034867 3300006163 Bacteria 2066
117 Ga0070712_100035625 3300006175 Bacteria 3379
118 Ga0075431_100004424 3300006847 Bacteria 13776
119 Ga0075434_100040256 3300006871 Bacteria 4628
120 Ga0075429_100030108 3300006880 Bacteria 4716
121 Ga0075429_100115244 3300006880 Bacteria 2349
122 Ga0068865_100069426 3300006881 Bacteria 2493
123 Ga0068865_100104063 3300006881 Bacteria 2083
124 Ga0105240_10006007 3300009093 Bacteria 17950
125 Ga0105240_10007228 3300009093 Bacteria 16170
126 Ga0105240_10007369 3300009093 Bacteria 16004
127 Ga0105240_10048609 3300009093 Bacteria 5360
128 Ga0105240_10096165 3300009093 Bacteria 3610
129 Ga0105240_10163584 3300009093 Bacteria 2641
130 Ga0105240_10236454 3300009093 Bacteria 2120
131 Ga0105240_10332181 3300009093 Bacteria 1729
132 Ga0111539_10005579 3300009094 Bacteria 16271
133 Ga0111539_10005732 3300009094 Bacteria 16058
134 Ga0111539_10111077 3300009094 Bacteria 3216
135 Ga0105245_10098453 3300009098 Bacteria 2702
136 Ga0105245_10267129 3300009098 Bacteria 1667
137 Ga0105241_10045116 3300009174 Bacteria 3343
138 Ga0105241_10158928 3300009174 Bacteria 1856
139 Ga0105242_10001680 3300009176 Bacteria 17528
140 Ga0105242_10361377 3300009176 Bacteria 1344
141 Ga0105237_10000011 3300009545 Bacteria 307361
142 Ga0105237_10000815 3300009545 Bacteria 42625
143 Ga0105237_10040935 3300009545 Bacteria 4673
144 Ga0105237_10102910 3300009545 Bacteria 2847
145 Ga0105237_10114424 3300009545 Bacteria 2690
146 Ga0105237_10146214 3300009545 Bacteria 2359
147 Ga0105237_10250314 3300009545 Bacteria 1774
148 Ga0105238_10000760 3300009551 Bacteria 33531
149 Ga0105238_10012012 3300009551 Bacteria 8724
150 Ga0105238_10110623 3300009551 Bacteria 2728
151 Ga0105238_10115605 3300009551 Bacteria 2662
152 Ga0105238_10134680 3300009551 Bacteria 2448
153 Ga0105239_10000027 3300010375 Bacteria 248028
154 Ga0105239_10116093 3300010375 Bacteria 2970
155 Ga0157314_1000064 3300012500 Bacteria 11359
156 Ga0157373_10062853 3300013100 Bacteria 2629
157 Ga0157371_10023341 3300013102 Bacteria 4524
158 Ga0157371_10076383 3300013102 Bacteria 2372
159 Ga0157371_10123516 3300013102 Bacteria 1841
160 Ga0157371_10133511 3300013102 Bacteria 1766
161 Ga0157370_10009289 3300013104 Bacteria 10532
162 Ga0157370_10011822 3300013104 Bacteria 9109
163 Ga0157370_10017730 3300013104 Bacteria 7178
164 Ga0157370_10025808 3300013104 Bacteria 5813
165 Ga0157370_10050049 3300013104 Bacteria 3996
166 Ga0157370_10125537 3300013104 Bacteria 2395
167 Ga0157370_10425737 3300013104 Bacteria 1221
168 Ga0157369_10007761 3300013105 Bacteria 12344
169 Ga0157369_10193712 3300013105 Bacteria 2135
170 Ga0157374_10049675 3300013296 Bacteria 3897
171 Ga0157374_10136811 3300013296 Bacteria 2375
172 Ga0157372_10014552 3300013307 Bacteria 8416
173 Ga0157372_10067138 3300013307 Bacteria 4030
174 Ga0157372_10078054 3300013307 Bacteria 3741
175 Ga0157372_10103975 3300013307 Bacteria 3246
176 Ga0157375_10053233 3300013308 Bacteria 3981
177 Ga0157375_10509277 3300013308 Bacteria 1367
178 Ga0157380_10080886 3300014326 Bacteria 2656
179 Ga0182008_10086054 3300014497 Bacteria 1548
180 Ga0157377_10010130 3300014745 Bacteria 4651
181 Ga0157379_10005424 3300014968 Bacteria 10955
182 Ga0182006_1048094 3300015261 Bacteria 1651
183 Ga0182007_10009448 3300015262 Bacteria 3928
184 Ga0183369_1018 3300015685 Bacteria 117953
185 Ga0183368_1003 3300015687 Bacteria 1276390
186 Ga0163161_10168107 3300017792 Bacteria 1675
187 Ga0206356_10936611 3300020070 Bacteria 1730
188 Ga0206353_11707163 3300020082 Bacteria 5109
189 Ga0213876_10009570 3300021384 Bacteria 5214
190 Ga0213876_10027810 3300021384 Bacteria 2982
191 Ga0209760_100466 3300025207 Bacteria 8909
192 Ga0209784_100104 3300025224 Bacteria 98272
193 Ga0209566_101646 3300025225 Bacteria 5730
194 Ga0209674_100012 3300025226 Bacteria 950162
195 Ga0209674_100079 3300025226 Bacteria 205836
196 Ga0209674_100856 3300025226 Bacteria 10021
197 Ga0209672_100005 3300025228 Bacteria 1069303
198 Ga0209672_100055 3300025228 Bacteria 221655
199 Ga0209672_100270 3300025228 Bacteria 38089
200 Ga0209672_100765 3300025228 Bacteria 15441
201 Ga0209563_100045 3300025230 Bacteria 377102
202 Ga0207427_100070 3300025231 Bacteria 160908
203 Ga0207427_101337 3300025231 Bacteria 9162
204 Ga0207427_103511 3300025231 Bacteria 3242
205 Ga0209437_100005 3300025233 Bacteria 1071596
206 Ga0209437_100059 3300025233 Bacteria 355048
207 Ga0209437_100214 3300025233 Bacteria 107034
208 Ga0209437_101184 3300025233 Bacteria 7709
209 Ga0209258_100006 3300025242 Bacteria 1069303
210 Ga0209258_100027 3300025242 Bacteria 518449
211 Ga0209258_100135 3300025242 Bacteria 170832
212 Ga0209258_100152 3300025242 Bacteria 160154
213 Ga0209258_104449 3300025242 Bacteria 2648
214 Ga0209258_105522 3300025242 Bacteria 2125
215 Ga0209646_1001180 3300025246 Bacteria 7586
216 Ga0209646_1001826 3300025246 Bacteria 5266
217 Ga0209646_1009959 3300025246 Bacteria 1498
218 Ga0209026_1000017 3300025250 Bacteria 385214
219 Ga0209026_1000055 3300025250 Bacteria 237197
220 Ga0209026_1000176 3300025250 Bacteria 97745
221 Ga0209026_1000319 3300025250 Bacteria 51342
222 Ga0209677_101939 3300025253 Bacteria 8272
223 Ga0209148_1000001 3300025254 Bacteria 2545271
224 Ga0209148_1000002 3300025254 Bacteria 2399500
225 Ga0209148_1000012 3300025254 Bacteria 1069303
226 Ga0209148_1000014 3300025254 Bacteria 925277
227 Ga0209148_1000102 3300025254 Bacteria 216658
228 Ga0209759_1000267 3300025256 Bacteria 74733
229 Ga0209759_1000333 3300025256 Bacteria 62095
230 Ga0209129_1001293 3300025258 Bacteria 14274
231 Ga0209233_1000002 3300025261 Bacteria 2501366
232 Ga0209233_1000011 3300025261 Bacteria 1071611
233 Ga0209233_1000193 3300025261 Bacteria 126812
234 Ga0209233_1001248 3300025261 Bacteria 10224
235 Ga0209233_1013294 3300025261 Bacteria 2354
236 Ga0209455_1000008 3300025272 Bacteria 1069303
237 Ga0209455_1000014 3300025272 Bacteria 806601
238 Ga0209455_1000019 3300025272 Bacteria 705658
239 Ga0209455_1000297 3300025272 Bacteria 51750
240 Ga0209758_1000791 3300025297 Bacteria 45103
241 Ga0207656_10012383 3300025321 Bacteria 3242
242 Ga0207682_10034219 3300025893 Bacteria 2048
243 Ga0207692_10150675 3300025898 Bacteria 1332
244 Ga0207647_10002665 3300025904 Bacteria 13479
245 Ga0207654_10094107 3300025911 Bacteria 1833
246 Ga0207654_10105869 3300025911 Bacteria 1741
247 Ga0207707_10004111 3300025912 Bacteria 12894
248 Ga0207707_10035028 3300025912 Bacteria 4390
249 Ga0207695_10001405 3300025913 Bacteria 40582
250 Ga0207695_10005890 3300025913 Bacteria 16084
251 Ga0207695_10005938 3300025913 Bacteria 15997
252 Ga0207695_10009237 3300025913 Bacteria 12219
253 Ga0207695_10013055 3300025913 Bacteria 9919
254 Ga0207695_10152347 3300025913 Bacteria 2250
255 Ga0207695_10291125 3300025913 Bacteria 1525
256 Ga0207671_10000011 3300025914 Bacteria 530349
257 Ga0207671_10000359 3300025914 Bacteria 64927
258 Ga0207662_10080041 3300025918 Bacteria 1992
259 Ga0207657_10026845 3300025919 Bacteria 5283
260 Ga0207657_10083113 3300025919 Bacteria 2687
261 Ga0207652_10253715 3300025921 Bacteria 1586
262 Ga0207681_10295486 3300025923 Bacteria 1280
263 Ga0207694_10000412 3300025924 Bacteria 39847
264 Ga0207694_10023548 3300025924 Bacteria 4674
265 Ga0207694_10062816 3300025924 Bacteria 2892
266 Ga0207694_10138421 3300025924 Bacteria 1956
267 Ga0207650_10005646 3300025925 Bacteria 8542
268 Ga0207659_10054366 3300025926 Bacteria 2859
269 Ga0207659_10272713 3300025926 Bacteria 1380
270 Ga0207687_10027650 3300025927 Bacteria 3808
271 Ga0207700_10007910 3300025928 Bacteria 6541
272 Ga0207664_10000897 3300025929 Bacteria 20098
273 Ga0207664_10008623 3300025929 Bacteria 7124
274 Ga0207664_10018969 3300025929 Bacteria 5074
275 Ga0207690_10017586 3300025932 Bacteria 4369
276 Ga0207690_10042056 3300025932 Bacteria 2998
277 Ga0207690_10048114 3300025932 Bacteria 2833
278 Ga0207690_10066100 3300025932 Bacteria 2475
279 Ga0207690_10100846 3300025932 Bacteria 2061
280 Ga0207706_10023351 3300025933 Bacteria 5554
281 Ga0207686_10050646 3300025934 Bacteria 2583
282 Ga0207709_10257115 3300025935 Bacteria 1279
283 Ga0207670_10001106 3300025936 Bacteria 14192
284 Ga0207670_10029503 3300025936 Bacteria 3495
285 Ga0207669_10186705 3300025937 Bacteria 1491
286 Ga0207691_10009379 3300025940 Bacteria 9397
287 Ga0207689_10043464 3300025942 Bacteria 3714
288 Ga0207667_10004745 3300025949 Bacteria 16626
289 Ga0207667_10005660 3300025949 Bacteria 15236
290 Ga0207667_10005765 3300025949 Bacteria 15112
291 Ga0207667_10010445 3300025949 Bacteria 10850
292 Ga0207667_10053646 3300025949 Bacteria 4241
293 Ga0207667_10081453 3300025949 Bacteria 3353
294 Ga0207667_10130630 3300025949 Bacteria 2587
295 Ga0207712_10183646 3300025961 Bacteria 1645
296 Ga0207712_10273106 3300025961 Bacteria 1376
297 Ga0207640_10004782 3300025981 Bacteria 7354
298 Ga0207640_10024415 3300025981 Bacteria 3647
299 Ga0207640_10028380 3300025981 Bacteria 3421
300 Ga0207658_10246804 3300025986 Bacteria 1515
301 Ga0207677_10091555 3300026023 Bacteria 2212
302 Ga0207677_10140528 3300026023 Bacteria 1848
303 Ga0207639_10047142 3300026041 Bacteria 3255
304 Ga0207678_10002215 3300026067 Bacteria 17557
305 Ga0207678_10073268 3300026067 Bacteria 2935
306 Ga0207702_10000107 3300026078 Bacteria 96024
307 Ga0207702_10005749 3300026078 Bacteria 10799
308 Ga0207702_10388592 3300026078 Bacteria 1343
309 Ga0207648_10066316 3300026089 Bacteria 3148
310 Ga0207648_10225788 3300026089 Bacteria 1665
311 Ga0207674_10000146 3300026116 Bacteria 82851
312 Ga0207674_10015476 3300026116 Bacteria 8378
313 Ga0207674_10028651 3300026116 Bacteria 5874
314 Ga0207674_10151278 3300026116 Bacteria 2278
315 Ga0207683_10068464 3300026121 Bacteria 3133
316 Ga0207698_10013355 3300026142 Bacteria 5415
317 Ga0207698_10021205 3300026142 Bacteria 4488
318 Ga0207698_10028495 3300026142 Bacteria 3982
319 Ga0209999_1010830 3300027543 Bacteria 1648
320 Ga0209971_1022415 3300027682 Bacteria 1504
321 Ga0207428_10058285 3300027907 Bacteria 3065
322 Ga0207428_10071647 3300027907 Bacteria 2721
323 Ga0268265_10090102 3300028380 Bacteria 2449
324 Ga0268264_10030947 3300028381 Bacteria 4388
325 Ga0265323_10006775 3300028653 Bacteria 4799
326 Ga0265332_10039804 3300031238 Bacteria 2036
327 Ga0265328_10012591 3300031239 Bacteria 3364
328 Ga0265328_10018066 3300031239 Bacteria 2725
329 Ga0265325_10001423 3300031241 Bacteria 16843
330 Ga0265327_10000085 3300031251 Bacteria 203068
331 Ga0265327_10055660 3300031251 Bacteria 2042
332 Ga0265316_10000163 3300031344 Bacteria 74936
333 Ga0265316_10025248 3300031344 Bacteria 4962
334 Ga0265316_10079898 3300031344 Bacteria 2509
335 Ga0307509_10000076 3300031507 Bacteria 138855
336 Ga0307408_100203161 3300031548 Bacteria 1605
337 Ga0307508_10054033 3300031616 Bacteria 3562
338 Ga0307405_10075122 3300031731 Bacteria 2188
339 Ga0307405_10206955 3300031731 Bacteria 1429
340 Ga0316577_10141124 3300031733 Unclassified 1357
341 Ga0307413_10054434 3300031824 Bacteria 2428
342 Ga0307410_10197503 3300031852 Bacteria 1534
343 Ga0307412_10096801 3300031911 Bacteria 2078
344 Ga0307416_100149038 3300032002 Bacteria 2142
345 Ga0307416_100149888 3300032002 Bacteria 2137
346 Ga0307414_10228419 3300032004 Bacteria 1533
347 Ga0316583_10002481 3300032133 Bacteria 6414
348 Ga0373952_0007064 3300035092 Bacteria 2094
349 Ga0373960_0047000 3300035121 Bacteria 1268
350 Ga0373931_0018071 3300035691 Bacteria 3500
351 Ga0373931_0019234 3300035691 Bacteria 3407
352 Ga0373937_0062907 3300036401 Bacteria 3412
353 Ga0373925_0023038 3300037068 Bacteria 4545
354 Ga0395899_0000081 3300037312 Bacteria 169527
355 Ga0395899_0010006 3300037312 Bacteria 7271
356 Ga0395899_0011743 3300037312 Bacteria 6704
357 Ga0395899_0022981 3300037312 Bacteria 4724
358 Ga0395900_0000024 3300037418 Bacteria 323480
359 Ga0395900_0048777 3300037418 Bacteria 4361
360 Ga0395900_0099067 3300037418 Bacteria 2994
361 Ga0395900_0148986 3300037418 Bacteria 2391
362 Ga0395898_0000044 3300037466 Bacteria 298164
363 Ga0395898_0000132 3300037466 Bacteria 192211
364 Ga0395898_0029899 3300037466 Bacteria 5453
365 Ga0395898_0030106 3300037466 Bacteria 5433
366 Ga0395898_0056056 3300037466 Bacteria 3843
367 Ga0395898_0295464 3300037466 Bacteria 1545
368 Ga0395905_0000944 3300037471 Bacteria 37361
369 Ga0395901_0015747 3300038443 Bacteria 7704
370 Ga0395901_0022248 3300038443 Bacteria 6495
371 Ga0395901_0113799 3300038443 Bacteria 2841
372 Ga0395901_0185482 3300038443 Bacteria 2182
373 Ga0395901_0712077 3300038443 Bacteria 1000
374 Ga0400484_06254 3300038725 Bacteria 35023
375 Ga0400484_15735 3300038725 Bacteria 52349
376 Ga0400484_16952 3300038725 Bacteria 2527
377 Ga0400490_21780 3300038726 Bacteria 8142
378 Ga0400490_26731 3300038726 Bacteria 6535
379 Ga0400491_13101 3300038727 Bacteria 2791
380 Ga0400488_48895 3300038741 Bacteria 10998
381 Ga0400487_25945 3300039110 Bacteria 95730
382 Ga0400487_63974 3300039110 Bacteria 1898
383 Ga0436365_1218422 3300039437 Bacteria 4764
384 Ga0436365_1311974 3300039437 Bacteria 8041
385 Ga0439437_007477 3300042000 Bacteria 1221
386 Ga0439441_001493 3300042001 Bacteria 3079
387 Ga0439448_0018422 3300042005 Bacteria 2140
388 Ga0439459_0000277 3300042438 Bacteria 6042
389 Ga0451577_0000997 3300042876 Bacteria 41140
390 Ga0451577_0032467 3300042876 Bacteria 4703
391 Ga0451577_0129486 3300042876 Bacteria 2263
392 Ga0451577_0149632 3300042876 Bacteria 2100
393 Ga0451577_0168409 3300042876 Bacteria 1974
394 Ga0451577_0180408 3300042876 Bacteria 1903
395 Ga0466988_0061414 3300044536 Bacteria 2216
396 Ga0466969_0036812 3300044656 Bacteria 2470
397 Ga0466982_0000012 3300044672 Bacteria 166823
398 Ga0453683_0030211 3300044673 Bacteria 3426
399 Ga0453683_0280986 3300044673 Bacteria 1063
400 Ga0466966_0093317 3300044684 Bacteria 1866
401 Ga0466966_0093319 3300044684 Bacteria 1866
402 Ga0466961_0005884 3300044693 Bacteria 7771
403 Ga0466961_0032939 3300044693 Bacteria 3329
404 Ga0466961_0176524 3300044693 Bacteria 1327
405 Ga0466963_0507856 3300044694 Bacteria 851
406 Ga0466964_0002156 3300044706 Bacteria 6949
407 Ga0466964_0017754 3300044706 Bacteria 2725
408 Ga0453684_0000014 3300044712 Bacteria 993311
409 Ga0453684_0000114 3300044712 Bacteria 356610
410 Ga0453684_0001268 3300044712 Bacteria 75704
411 Ga0453684_0001455 3300044712 Bacteria 67258
412 Ga0453684_0002221 3300044712 Bacteria 48187
413 Ga0453684_0006329 3300044712 Bacteria 22599
414 Ga0453684_0014423 3300044712 Bacteria 12645
415 Ga0453684_0014453 3300044712 Bacteria 12627
416 Ga0453684_0033743 3300044712 Bacteria 7124
417 Ga0453684_0769660 3300044712 Bacteria 1041
418 Ga0466971_0002536 3300044719 Bacteria 7724
419 Ga0466971_0005914 3300044719 Bacteria 5319
420 Ga0466971_0029564 3300044719 Bacteria 2451
421 Ga0466970_0012456 3300044765 Bacteria 4348
422 Ga0466970_0012952 3300044765 Bacteria 4270
423 Ga0466957_0003289 3300044842 Bacteria 8850
424 Ga0466959_0000254 3300045049 Bacteria 32770
425 Ga0466959_0031161 3300045049 Bacteria 3946
426 Ga0466959_0064211 3300045049 Bacteria 2665
427 Ga0466959_0264048 3300045049 Bacteria 1184
428 Ga0451576_0001018 3300045051 Bacteria 51870
429 Ga0451576_0008659 3300045051 Bacteria 11914
430 Ga0451576_0016606 3300045051 Bacteria 8120
431 Ga0451576_0064215 3300045051 Bacteria 3825
432 Ga0451576_0069492 3300045051 Bacteria 3665
433 Ga0451576_0170053 3300045051 Bacteria 2275
434 Ga0451576_0679939 3300045051 Bacteria 1081
435 Ga0451576_0855362 3300045051 Bacteria 955
436 Ga0466958_0310714 3300045836 Bacteria 1012
437 Ga0495592_0023258 3300046454 Bacteria 4713
438 Ga0495638_0000019 3300046460 Bacteria 384671
439 Ga0495638_0000164 3300046460 Bacteria 103139
440 Ga0495638_0003036 3300046460 Bacteria 13368
441 Ga0495650_0000498 3300046471 Bacteria 59590
442 Ga0495606_0001115 3300046507 Bacteria 38368
443 Ga0495642_0059062 3300046528 Bacteria 1589
444 Ga0495652_0036075 3300046529 Bacteria 4301
445 Ga0495645_0001432 3300046543 Bacteria 16076
446 Ga0495622_0134292 3300046557 Bacteria 1126
447 Ga0495625_0025209 3300046660 Bacteria 4513
448 Ga0495623_0003408 3300046679 Bacteria 10519
449 Ga0495649_0001556 3300046694 Bacteria 17215
450 Ga0495675_0137029 3300047444 Bacteria 1519
451 Ga0495677_0051398 3300047445 Bacteria 1518
452 Ga0495684_0132902 3300047471 Bacteria 1868
453 Ga0496100_0146997 3300048903 Bacteria 1677
454 Ga0496102_0487562 3300048905 Bacteria 1154
455 Ga0496104_0098276 3300048907 Bacteria 2802
456 Ga0496104_0250857 3300048907 Bacteria 1682
457 Ga0496105_0001031 3300048908 Bacteria 19253
458 Ga0496106_0302367 3300048909 Bacteria 1283
459 Ga0496107_0050259 3300048910 Bacteria 3005
460 Ga0496108_0005364 3300048911 Bacteria 10362
461 Ga0496109_0005384 3300048912 Bacteria 10698
462 Ga0496109_0134960 3300048912 Bacteria 2305
463 Ga0496110_0281459 3300048913 Bacteria 1514
464 Ga0496114_0044935 3300048917 Bacteria 3667
465 Ga0496114_0070777 3300048917 Bacteria 2930
466 Ga0496114_0237997 3300048917 Bacteria 1600
467 Ga0496115_0000238 3300048918 Bacteria 50050
468 Ga0496115_0012074 3300048918 Bacteria 6495
469 Ga0496115_0046709 3300048918 Bacteria 3462
470 Ga0496117_0007041 3300048920 Bacteria 11126
471 Ga0496117_0184827 3300048920 Bacteria 1194
472 Ga0496118_0002869 3300048921 Bacteria 22496
473 Ga0496118_0006327 3300048921 Bacteria 13082
474 Ga0496119_0000322 3300048922 Bacteria 67165
475 Ga0496119_0016776 3300048922 Bacteria 5548
476 Ga0496120_0000143 3300048923 Bacteria 120051
477 Ga0496120_0000665 3300048923 Bacteria 50530
478 Ga0496121_0000938 3300048924 Bacteria 52758
479 Ga0496121_0008205 3300048924 Bacteria 12385
480 Ga0496121_0279221 3300048924 Bacteria 1143
481 Ga0496125_0000469 3300048928 Bacteria 72128
482 Ga0496126_0001473 3300048929 Bacteria 36602
483 Ga0496126_0043303 3300048929 Bacteria 4153
484 Ga0496126_0045513 3300048929 Bacteria 4032
485 Ga0496126_0074071 3300048929 Bacteria 3024
486 Ga0495678_016942 3300049459 Bacteria 3315
487 Ga0495682_0007012 3300049460 Bacteria 4517
488 Ga0501031_0087879 3300049568 Bacteria 2027
489 Ga0501031_0089798 3300049568 Bacteria 2004
490 Ga0501032_0019572 3300049569 Bacteria 4734
491 Ga0501033_0002131 3300049570 Bacteria 17126
492 Ga0501033_0003284 3300049570 Bacteria 13373
493 Ga0501034_0018960 3300049571 Bacteria 7049
494 Ga0501034_0116810 3300049571 Bacteria 2656
495 Ga0501034_0383564 3300049571 Bacteria 1330
496 Ga0501036_0053819 3300049572 Bacteria 3407
497 Ga0501037_0026675 3300049573 Bacteria 4269
498 Ga0501037_0095363 3300049573 Bacteria 2151
499 Ga0501038_0003652 3300049574 Bacteria 14338
500 Ga0501038_0074165 3300049574 Bacteria 2879
501 Ga0501038_0285546 3300049574 Bacteria 1298
502 Ga0501039_0021237 3300049575 Bacteria 4981
503 Ga0501039_0292798 3300049575 Bacteria 1280
504 Ga0501043_0014179 3300049579 Bacteria 6236
505 Ga0501043_0038535 3300049579 Bacteria 3758
506 Ga0501043_0046317 3300049579 Bacteria 3419
507 Ga0501043_0160655 3300049579 Bacteria 1756
508 Ga0501046_0010016 3300049580 Bacteria 8166
509 Ga0501046_0145748 3300049580 Bacteria 1788
510 Ga0501047_0037903 3300049581 Bacteria 4662
511 Ga0501047_0040310 3300049581 Bacteria 4516
512 Ga0501047_0101440 3300049581 Bacteria 2757
513 Ga0501047_0328659 3300049581 Bacteria 1367
514 Ga0501048_0014497 3300049582 Bacteria 5836
515 Ga0501048_0020424 3300049582 Bacteria 4854
516 Ga0501068_0037572 3300049584 Bacteria 2898
517 Ga0501069_0000324 3300049585 Bacteria 21605
518 Ga0501070_0003889 3300049586 Bacteria 12886
519 Ga0501070_0030728 3300049586 Bacteria 4499
520 Ga0501070_0039754 3300049586 Bacteria 3922
521 Ga0501070_0474226 3300049586 Bacteria 1007
522 Ga0501073_0039357 3300049589 Bacteria 3349
523 Ga0501074_0005759 3300049590 Bacteria 8935
524 Ga0501077_0028057 3300049593 Bacteria 3578
525 Ga0501080_0015011 3300049742 Bacteria 7134
526 Ga0501080_0318239 3300049742 Bacteria 1409
527 Ga0501083_0001485 3300049744 Bacteria 16009
528 Ga0501035_0064311 3300049822 Bacteria 3260
529 Ga0501035_0172871 3300049822 Bacteria 1865
530 Ga0501035_0186994 3300049822 Bacteria 1782
531 Ga0501035_0272266 3300049822 Bacteria 1433
532 Ga0501044_0033622 3300049823 Bacteria 5386
533 Ga0501044_0056240 3300049823 Bacteria 4039
534 Ga0501044_0057195 3300049823 Bacteria 4002
535 Ga0501044_0292086 3300049823 Bacteria 1561
536 Ga0501045_0083209 3300049824 Bacteria 2361
537 nmdc:mga0k408_28277_c1 3300050493 Bacteria 3187
538 nmdc:mga0k408_50556_c1 3300050493 Bacteria 2407
539 nmdc:mga09592_108365_c1 3300050508 Bacteria 2382
540 nmdc:mga09592_190785_c1 3300050508 Bacteria 1774
541 nmdc:mga0qj67_7862_c1 3300050509 Bacteria 7878
542 nmdc:mga06r32_10566_c1 3300050510 Bacteria 8323
543 nmdc:mga08y16_10079_c1 3300050511 Bacteria 9919
544 nmdc:mga08y16_5879_c1 3300050511 Bacteria 12855
545 nmdc:mga08y16_91567_c1 3300050511 Bacteria 3169
546 nmdc:mga0rr50_447979_c1 3300050513 Bacteria 1094
547 nmdc:mga0rr50_79197_c1 3300050513 Bacteria 2530
548 nmdc:mga08x19_42679_c1 3300050514 Bacteria 2892
549 nmdc:mga0a205_34040_c1 3300050515 Bacteria 4887
550 nmdc:mga0sz30_27261_c1 3300050516 Bacteria 2346
551 Ga0495601_0003047 3300053077 Bacteria 9553
552 Ga0495595_0035543 3300053084 Bacteria 2257
553 Ga0495619_0038176 3300053085 Bacteria 3132
554 Ga0500641_0024002 3300053096 Bacteria 2350
555 Ga0500607_024620 3300053121 Bacteria 3358
556 Ga0500559_0017187 3300053136 Bacteria 3054
557 Ga0500636_0016817 3300053177 Bacteria 4312
558 Ga0500637_0007002 3300053178 Bacteria 5609
559 Ga0500625_000359 3300053729 Bacteria 11591
560 Ga0501084_0163680 3300054114 Bacteria 1877
561 Ga0590075_013342 3300059424 Bacteria 2002
562 Ga0501082_0081602 3300060353 Bacteria 2790
563 Ga0466962_0003050 3300061719 Bacteria 7985
564 Ga0466962_0012152 3300061719 Bacteria 4139
565 Ga0466962_0084188 3300061719 Bacteria 1521
566 2538834787 2537561836 Bacteria 3910579
567 2643829283 2643221562 Bacteria 4048635
568 2643895722 2643221577 Bacteria 3710843
569 2644477915 2643221685 Bacteria 3673288
570 2687584406 2687453130 Bacteria 4227172
571 2739732534 2739367700 Bacteria 4747630
572 2884412616 2884411467 Bacteria 5246714
573 2891635592 2891633521 Bacteria 4602265
574 2895398895 2895395659 Bacteria 3983269
575 2928965251 2928963466 Bacteria 5165703
576 2939613003 2939611941 Bacteria 3892017
577 Ga0451576_0000168
578 JGI24740J21852_10000678
579 JGI24739J22299_10000934
580 JGI24737J22298_10006753
581 JGI24735J21928_10006544
582 JGI25162J39368_1001140
583 JGI25162J39368_1001141
584 JGI25162J39368_1002305
585 JGI25157J39369_1000133
586 JGI25157J39369_1000213
587 JGI25157J39369_1000314
588 JGI25157J39369_1002011
589 JGI25163J39215_1000210
590 JGI25164J39214_1000075
591 JGI25164J39214_1001087
592 JGI25164J39214_1001115
593 JGI25165J46597_1000178
594 JGI25165J46597_1002091
595 rootH1_10069084
596 rootH2_10038156
597 Ga0006562J51391_1017132
598 Ga0006562J51391_1017133
599 Ga0055538_1000590
600 Ga0055533_1001374
601 Ga0055533_1001584
602 Ga0055525_1000124
603 Ga0055525_1000184
604 Ga0055527_1000094
605 Ga0055527_1000180
606 Ga0055535_1000350
607 Ga0055535_1000421
608 Ga0055535_1000807
609 Ga0055535_1002095
610 Ga0055542_1000312
611 Ga0055542_1000326
612 Ga0055542_1001122
613 Ga0055542_1001123
614 Ga0055542_1001976
615 Ga0055529_1000153
616 Ga0055529_1000434
617 Ga0055529_1000893
618 Ga0055529_1007994
619 Ga0065165_1009247
620 Ga0070658_10037931
621 Ga0070680_100190937
622 Ga0070682_100004611
623 Ga0070682_100049271
624 Ga0068868_100058991
625 Ga0068868_100174768
626 Ga0070660_100049952
627 Ga0070689_100003954
628 Ga0070691_10019335
629 Ga0070692_10016893
630 Ga0070692_10104267
631 Ga0070692_10182993
632 Ga0070675_100205720
633 Ga0070671_100360320
634 Ga0070673_100409039
635 Ga0070688_100144312
636 Ga0070659_100030519
637 Ga0070659_100033518
638 Ga0070667_100379680
639 Ga0070714_100001006
640 Ga0070714_100011167
641 Ga0070714_100181124
642 Ga0070714_100217626
643 Ga0070714_100497302
644 Ga0070713_100000528
645 Ga0070710_10277303
646 Ga0070701_10079706
647 Ga0070663_100035591
648 Ga0070663_100101789
649 Ga0070681_10022732
650 Ga0070681_10042404
651 Ga0070681_10148217
652 Ga0070681_10154381
653 Ga0068867_100066741
654 Ga0070685_10000983
655 Ga0070679_100065616
656 Ga0070679_100544246
657 Ga0070684_100046846
658 Ga0070684_100576382
659 Ga0068853_100001937
660 Ga0068853_100341086
661 Ga0070672_100079419
662 Ga0070696_100001750
663 Ga0070696_100015752
664 Ga0070696_100067995
665 Ga0070693_100023320
666 Ga0070693_100037352
667 Ga0070693_100052699
668 Ga0070693_100189133
669 Ga0068855_100024000
670 Ga0068855_100027019
671 Ga0068855_100056615
672 Ga0068855_100132671
673 Ga0068855_100234556
674 Ga0068857_100000919
675 Ga0068857_100032172
676 Ga0068857_100091782
677 Ga0068857_100505324
678 Ga0068854_100006938
679 Ga0068854_100038019
680 Ga0068854_100097000
681 Ga0068856_100000495
682 Ga0068856_100001721
683 Ga0068856_100086428
684 Ga0070702_100080963
685 Ga0068852_100006980
686 Ga0068852_100128247
687 Ga0068852_100171059
688 Ga0068864_100203333
689 Ga0068866_10106766
690 Ga0068851_10022370
691 Ga0068862_100074944
692 Ga0070715_10034867
693 Ga0070712_100035625
694 Ga0075431_100004424
695 Ga0075434_100040256
696 Ga0075429_100030108
697 Ga0075429_100115244
698 Ga0068865_100069426
699 Ga0068865_100104063
700 Ga0105240_10006007
701 Ga0105240_10007228
702 Ga0105240_10007369
703 Ga0105240_10048609
704 Ga0105240_10096165
705 Ga0105240_10163584
706 Ga0105240_10236454
707 Ga0105240_10332181
708 Ga0111539_10005579
709 Ga0111539_10005732
710 Ga0111539_10111077
711 Ga0105245_10098453
712 Ga0105245_10267129
713 Ga0105241_10045116
714 Ga0105241_10158928
715 Ga0105242_10001680
716 Ga0105242_10361377
717 Ga0105237_10000011
718 Ga0105237_10000815
719 Ga0105237_10040935
720 Ga0105237_10102910
721 Ga0105237_10114424
722 Ga0105237_10146214
723 Ga0105237_10250314
724 Ga0105238_10000760
725 Ga0105238_10012012
726 Ga0105238_10110623
727 Ga0105238_10115605
728 Ga0105238_10134680
729 Ga0105239_10000027
730 Ga0105239_10116093
731 Ga0157314_1000064
732 Ga0157373_10062853
733 Ga0157371_10023341
734 Ga0157371_10076383
735 Ga0157371_10123516
736 Ga0157371_10133511
737 Ga0157370_10009289
738 Ga0157370_10011822
739 Ga0157370_10017730
740 Ga0157370_10025808
741 Ga0157370_10050049
742 Ga0157370_10125537
743 Ga0157370_10425737
744 Ga0157369_10007761
745 Ga0157369_10193712
746 Ga0157374_10049675
747 Ga0157374_10136811
748 Ga0157372_10014552
749 Ga0157372_10067138
750 Ga0157372_10078054
751 Ga0157372_10103975
752 Ga0157375_10053233
753 Ga0157375_10509277
754 Ga0157380_10080886
755 Ga0182008_10086054
756 Ga0157377_10010130
757 Ga0157379_10005424
758 Ga0182006_1048094
759 Ga0182007_10009448
760 Ga0183369_1018
761 Ga0183368_1003
762 Ga0163161_10168107
763 Ga0206356_10936611
764 Ga0206353_11707163
765 Ga0213876_10009570
766 Ga0213876_10027810
767 Ga0209760_100466
768 Ga0209784_100104
769 Ga0209566_101646
770 Ga0209674_100012
771 Ga0209674_100079
772 Ga0209674_100856
773 Ga0209672_100005
774 Ga0209672_100055
775 Ga0209672_100270
776 Ga0209672_100765
777 Ga0209563_100045
778 Ga0207427_100070
779 Ga0207427_101337
780 Ga0207427_103511
781 Ga0209437_100005
782 Ga0209437_100059
783 Ga0209437_100214
784 Ga0209437_101184
785 Ga0209258_100006
786 Ga0209258_100027
787 Ga0209258_100135
788 Ga0209258_100152
789 Ga0209258_104449
790 Ga0209258_105522
791 Ga0209646_1001180
792 Ga0209646_1001826
793 Ga0209646_1009959
794 Ga0209026_1000017
795 Ga0209026_1000055
796 Ga0209026_1000176
797 Ga0209026_1000319
798 Ga0209677_101939
799 Ga0209148_1000001
800 Ga0209148_1000002
801 Ga0209148_1000012
802 Ga0209148_1000014
803 Ga0209148_1000102
804 Ga0209759_1000267
805 Ga0209759_1000333
806 Ga0209129_1001293
807 Ga0209233_1000002
808 Ga0209233_1000011
809 Ga0209233_1000193
810 Ga0209233_1001248
811 Ga0209233_1013294
812 Ga0209455_1000008
813 Ga0209455_1000014
814 Ga0209455_1000019
815 Ga0209455_1000297
816 Ga0209758_1000791
817 Ga0207656_10012383
818 Ga0207682_10034219
819 Ga0207692_10150675
820 Ga0207647_10002665
821 Ga0207654_10094107
822 Ga0207654_10105869
823 Ga0207707_10004111
824 Ga0207707_10035028
825 Ga0207695_10001405
826 Ga0207695_10005890
827 Ga0207695_10005938
828 Ga0207695_10009237
829 Ga0207695_10013055
830 Ga0207695_10152347
831 Ga0207695_10291125
832 Ga0207671_10000011
833 Ga0207671_10000359
834 Ga0207662_10080041
835 Ga0207657_10026845
836 Ga0207657_10083113
837 Ga0207652_10253715
838 Ga0207681_10295486
839 Ga0207694_10000412
840 Ga0207694_10023548
841 Ga0207694_10062816
842 Ga0207694_10138421
843 Ga0207650_10005646
844 Ga0207659_10054366
845 Ga0207659_10272713
846 Ga0207687_10027650
847 Ga0207700_10007910
848 Ga0207664_10000897
849 Ga0207664_10008623
850 Ga0207664_10018969
851 Ga0207690_10017586
852 Ga0207690_10042056
853 Ga0207690_10048114
854 Ga0207690_10066100
855 Ga0207690_10100846
856 Ga0207706_10023351
857 Ga0207686_10050646
858 Ga0207709_10257115
859 Ga0207670_10001106
860 Ga0207670_10029503
861 Ga0207669_10186705
862 Ga0207691_10009379
863 Ga0207689_10043464
864 Ga0207667_10004745
865 Ga0207667_10005660
866 Ga0207667_10005765
867 Ga0207667_10010445
868 Ga0207667_10053646
869 Ga0207667_10081453
870 Ga0207667_10130630
871 Ga0207712_10183646
872 Ga0207712_10273106
873 Ga0207640_10004782
874 Ga0207640_10024415
875 Ga0207640_10028380
876 Ga0207658_10246804
877 Ga0207677_10091555
878 Ga0207677_10140528
879 Ga0207639_10047142
880 Ga0207678_10002215
881 Ga0207678_10073268
882 Ga0207702_10000107
883 Ga0207702_10005749
884 Ga0207702_10388592
885 Ga0207648_10066316
886 Ga0207648_10225788
887 Ga0207674_10000146
888 Ga0207674_10015476
889 Ga0207674_10028651
890 Ga0207674_10151278
891 Ga0207683_10068464
892 Ga0207698_10013355
893 Ga0207698_10021205
894 Ga0207698_10028495
895 Ga0209999_1010830
896 Ga0209971_1022415
897 Ga0207428_10058285
898 Ga0207428_10071647
899 Ga0268265_10090102
900 Ga0268264_10030947
901 Ga0265323_10006775
902 Ga0265332_10039804
903 Ga0265328_10012591
904 Ga0265328_10018066
905 Ga0265325_10001423
906 Ga0265327_10000085
907 Ga0265327_10055660
908 Ga0265316_10000163
909 Ga0265316_10025248
910 Ga0265316_10079898
911 Ga0307509_10000076
912 Ga0307408_100203161
913 Ga0307508_10054033
914 Ga0307405_10075122
915 Ga0307405_10206955
916 Ga0316577_10141124
917 Ga0307413_10054434
918 Ga0307410_10197503
919 Ga0307412_10096801
920 Ga0307416_100149038
921 Ga0307416_100149888
922 Ga0307414_10228419
923 Ga0316583_10002481
924 Ga0373952_0007064
925 Ga0373960_0047000
926 Ga0373931_0018071
927 Ga0373931_0019234
928 Ga0373937_0062907
929 Ga0373925_0023038
930 Ga0395899_0000081
931 Ga0395899_0010006
932 Ga0395899_0011743
933 Ga0395899_0022981
934 Ga0395900_0000024
935 Ga0395900_0048777
936 Ga0395900_0099067
937 Ga0395900_0148986
938 Ga0395898_0000044
939 Ga0395898_0000132
940 Ga0395898_0029899
941 Ga0395898_0030106
942 Ga0395898_0056056
943 Ga0395898_0295464
944 Ga0395905_0000944
945 Ga0395901_0015747
946 Ga0395901_0022248
947 Ga0395901_0113799
948 Ga0395901_0185482
949 Ga0395901_0712077
950 Ga0400484_06254
951 Ga0400484_15735
952 Ga0400484_16952
953 Ga0400490_21780
954 Ga0400490_26731
955 Ga0400491_13101
956 Ga0400488_48895
957 Ga0400487_25945
958 Ga0400487_63974
959 Ga0436365_1218422
960 Ga0436365_1311974
961 Ga0439437_007477
962 Ga0439441_001493
963 Ga0439448_0018422
964 Ga0439459_0000277
965 Ga0451577_0000997
966 Ga0451577_0032467
967 Ga0451577_0129486
968 Ga0451577_0149632
969 Ga0451577_0168409
970 Ga0451577_0180408
971 Ga0466988_0061414
972 Ga0466969_0036812
973 Ga0466982_0000012
974 Ga0453683_0030211
975 Ga0453683_0280986
976 Ga0466966_0093317
977 Ga0466966_0093319
978 Ga0466961_0005884
979 Ga0466961_0032939
980 Ga0466961_0176524
981 Ga0466963_0507856
982 Ga0466964_0002156
983 Ga0466964_0017754
984 Ga0453684_0000014
985 Ga0453684_0000114
986 Ga0453684_0001268
987 Ga0453684_0001455
988 Ga0453684_0002221
989 Ga0453684_0006329
990 Ga0453684_0014423
991 Ga0453684_0014453
992 Ga0453684_0033743
993 Ga0453684_0769660
994 Ga0466971_0002536
995 Ga0466971_0005914
996 Ga0466971_0029564
997 Ga0466970_0012456
998 Ga0466970_0012952
999 Ga0466957_0003289
1000 Ga0466959_0000254
1001 Ga0466959_0031161
1002 Ga0466959_0064211
1003 Ga0466959_0264048
1004 Ga0451576_0001018
1005 Ga0451576_0008659
1006 Ga0451576_0016606
1007 Ga0451576_0064215
1008 Ga0451576_0069492
1009 Ga0451576_0170053
1010 Ga0451576_0679939
1011 Ga0451576_0855362
1012 Ga0466958_0310714
1013 Ga0495592_0023258
1014 Ga0495638_0000019
1015 Ga0495638_0000164
1016 Ga0495638_0003036
1017 Ga0495650_0000498
1018 Ga0495606_0001115
1019 Ga0495642_0059062
1020 Ga0495652_0036075
1021 Ga0495645_0001432
1022 Ga0495622_0134292
1023 Ga0495625_0025209
1024 Ga0495623_0003408
1025 Ga0495649_0001556
1026 Ga0495675_0137029
1027 Ga0495677_0051398
1028 Ga0495684_0132902
1029 Ga0496100_0146997
1030 Ga0496102_0487562
1031 Ga0496104_0098276
1032 Ga0496104_0250857
1033 Ga0496105_0001031
1034 Ga0496106_0302367
1035 Ga0496107_0050259
1036 Ga0496108_0005364
1037 Ga0496109_0005384
1038 Ga0496109_0134960
1039 Ga0496110_0281459
1040 Ga0496114_0044935
1041 Ga0496114_0070777
1042 Ga0496114_0237997
1043 Ga0496115_0000238
1044 Ga0496115_0012074
1045 Ga0496115_0046709
1046 Ga0496117_0007041
1047 Ga0496117_0184827
1048 Ga0496118_0002869
1049 Ga0496118_0006327
1050 Ga0496119_0000322
1051 Ga0496119_0016776
1052 Ga0496120_0000143
1053 Ga0496120_0000665
1054 Ga0496121_0000938
1055 Ga0496121_0008205
1056 Ga0496121_0279221
1057 Ga0496125_0000469
1058 Ga0496126_0001473
1059 Ga0496126_0043303
1060 Ga0496126_0045513
1061 Ga0496126_0074071
1062 Ga0495678_016942
1063 Ga0495682_0007012
1064 Ga0501031_0087879
1065 Ga0501031_0089798
1066 Ga0501032_0019572
1067 Ga0501033_0002131
1068 Ga0501033_0003284
1069 Ga0501034_0018960
1070 Ga0501034_0116810
1071 Ga0501034_0383564
1072 Ga0501036_0053819
1073 Ga0501037_0026675
1074 Ga0501037_0095363
1075 Ga0501038_0003652
1076 Ga0501038_0074165
1077 Ga0501038_0285546
1078 Ga0501039_0021237
1079 Ga0501039_0292798
1080 Ga0501043_0014179
1081 Ga0501043_0038535
1082 Ga0501043_0046317
1083 Ga0501043_0160655
1084 Ga0501046_0010016
1085 Ga0501046_0145748
1086 Ga0501047_0037903
1087 Ga0501047_0040310
1088 Ga0501047_0101440
1089 Ga0501047_0328659
1090 Ga0501048_0014497
1091 Ga0501048_0020424
1092 Ga0501068_0037572
1093 Ga0501069_0000324
1094 Ga0501070_0003889
1095 Ga0501070_0030728
1096 Ga0501070_0039754
1097 Ga0501070_0474226
1098 Ga0501073_0039357
1099 Ga0501074_0005759
1100 Ga0501077_0028057
1101 Ga0501080_0015011
1102 Ga0501080_0318239
1103 Ga0501083_0001485
1104 Ga0501035_0064311
1105 Ga0501035_0172871
1106 Ga0501035_0186994
1107 Ga0501035_0272266
1108 Ga0501044_0033622
1109 Ga0501044_0056240
1110 Ga0501044_0057195
1111 Ga0501044_0292086
1112 Ga0501045_0083209
1113 nmdc:mga0k408_28277_c1
1114 nmdc:mga0k408_50556_c1
1115 nmdc:mga09592_108365_c1
1116 nmdc:mga09592_190785_c1
1117 nmdc:mga0qj67_7862_c1
1118 nmdc:mga06r32_10566_c1
1119 nmdc:mga08y16_10079_c1
1120 nmdc:mga08y16_5879_c1
1121 nmdc:mga08y16_91567_c1
1122 nmdc:mga0rr50_447979_c1
1123 nmdc:mga0rr50_79197_c1
1124 nmdc:mga08x19_42679_c1
1125 nmdc:mga0a205_34040_c1
1126 nmdc:mga0sz30_27261_c1
1127 Ga0495601_0003047
1128 Ga0495595_0035543
1129 Ga0495619_0038176
1130 Ga0500641_0024002
1131 Ga0500607_024620
1132 Ga0500559_0017187
1133 Ga0500636_0016817
1134 Ga0500637_0007002
1135 Ga0500625_000359
1136 Ga0501084_0163680
1137 Ga0590075_013342
1138 Ga0501082_0081602
1139 Ga0466962_0003050
1140 Ga0466962_0012152
1141 Ga0466962_0084188
1142 2538834787
1143 2643829283
1144 2643895722
1145 2644477915
1146 2687584406
1147 2739732534
1148 2884412616
1149 2891635592
1150 2895398895
1151 2928965251
1152 2939613003

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

3

307

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.9427 10 307
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.933 10 307
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9249 8 308
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9185 8 308
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8948 8 305
ID Description Score Start End Superfamily
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9678 113 213 1.10.150.170
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9656 114 213 1.10.150.170
af_P60390_9_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9458 10 307 3.40.50.150
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9399 113 213 1.10.150.170
af_P9WJP1_66_380_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9307 9 307 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A508B7A7-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9857 6 308 GO:0005737
GO:0070475
GO:0071424
AF-A0A1E4KB80-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9825 12 307 GO:0005737
GO:0070475
GO:0071424
AF-A0A2X3E5Y1-F1-model_v4 rRNA small subunit methyltransferase H (EC 2.1.1.199) 0.9788 119 213 GO:0005737
GO:0070475
GO:0071424
AF-A0A5Q4FCA8-F1-model_v4 deleted 0.9773 6 254
AF-A0A656GR36-F1-model_v4 deleted 0.9755 82 255

Map