F465573
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 576 | 299 | 1152 | 400 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2939631187|2939634047 |
| Length | 470 |
| Sequence | AESMQILTVLRAANCARFGILNMPGFTLIPGFLRFTLFPHLFYAWVPTRGRLPYFLSGLSMTAKSAAIGVPDLSSAPPATEKSSGFLLPIVGGAAFAHLLNDLIQAMLPSIYPLLKDNFSLSFSQIGILAMVYQVTASLLQPWIGLYTDKHPKPFLLPSGMGMTFIGIILLATAGSFYMLLVAAAVIGVGSATFHPEASRIARLASGGRFGTAQSTFQVGGNTGSAIGPLLAAAIIIPYGQKAAAWFTVVAGVAIVVLYHLTIWVKHNGQAKAKSLARSHSEGLARSKVVQAVTVICILMFAKFVYIASFTNYFTFYLIQHFSLSVQQSQLFLFMFLASVAAGTFAGGPVGDRIGRKAVIWISFLGVAPFALALPYANLFWTGALSIIIGLIMSSAFAALVVYAQEAVPGRVGLVSGLMFGLMFGIGGIGAAGLGELADKYGIVWVYGVTSFLPLLGLATAFLPNTRKKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 44 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 72 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 113 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 114 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 120 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 132 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 133 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 134 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 135 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 214 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 217 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 218 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 240 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 241 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 242 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 243 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 244 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 245 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 246 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 247 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 248 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 249 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 250 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 251 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 252 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 253 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 254 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 255 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 256 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 257 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 258 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 259 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 260 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 261 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 262 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 263 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 264 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 265 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 266 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 267 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 268 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 269 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 270 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 271 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 272 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 273 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 274 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 275 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 276 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 277 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 278 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 279 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 280 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 281 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 282 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 283 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 284 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 285 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 286 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 287 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 288 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 289 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 290 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 291 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 292 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 293 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 294 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 295 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 296 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 297 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 298 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 299 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.93 |
| Metatranscriptomes | 0 |
| Isolates | 10.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.35 |
| Bulb | 0 |
| Endosphere | 8.68 |
| Nodule | 1.39 |
| Rhizoplane | 2.6 |
| Rhizosphere | 70.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1013011 | 3300001904 | Bacteria | 1345 |
| 2 | JGI25154J39366_1001065 | 3300002738 | Bacteria | 10834 |
| 3 | JGI25159J45721_1001688 | 3300002987 | Bacteria | 8942 |
| 4 | rootL2_10103549 | 3300003322 | Bacteria | 4946 |
| 5 | Ga0055526_1000973 | 3300003771 | Bacteria | 21094 |
| 6 | Ga0055537_1000440 | 3300003773 | Bacteria | 26604 |
| 7 | Ga0055536_1000444 | 3300003781 | Bacteria | 29058 |
| 8 | Ga0055536_1000543 | 3300003781 | Bacteria | 25842 |
| 9 | Ga0055536_1011470 | 3300003781 | Bacteria | 3395 |
| 10 | Ga0055536_1025964 | 3300003781 | Bacteria | 1655 |
| 11 | Ga0055528_1000860 | 3300003790 | Bacteria | 20583 |
| 12 | Ga0055530_10000021 | 3300003791 | Bacteria | 139383 |
| 13 | Ga0055530_10000323 | 3300003791 | Bacteria | 43172 |
| 14 | Ga0055531_10001266 | 3300003794 | Bacteria | 19128 |
| 15 | Ga0055531_10002303 | 3300003794 | Bacteria | 12902 |
| 16 | Ga0055531_10003871 | 3300003794 | Bacteria | 9366 |
| 17 | Ga0055531_10014955 | 3300003794 | Bacteria | 3458 |
| 18 | Ga0058692_1000014 | 3300003856 | Bacteria | 313984 |
| 19 | Ga0058692_1007691 | 3300003856 | Bacteria | 2839 |
| 20 | Ga0065165_1000005 | 3300005262 | Bacteria | 370361 |
| 21 | Ga0065165_1003002 | 3300005262 | Bacteria | 12769 |
| 22 | Ga0065703_1000120 | 3300005272 | Bacteria | 47864 |
| 23 | Ga0065704_10006065 | 3300005289 | Bacteria | 2673 |
| 24 | Ga0070658_10085130 | 3300005327 | Bacteria | 2600 |
| 25 | Ga0070683_100056176 | 3300005329 | Bacteria | 3655 |
| 26 | Ga0070670_100009223 | 3300005331 | Bacteria | 8431 |
| 27 | Ga0070666_10001416 | 3300005335 | Bacteria | 14517 |
| 28 | Ga0070666_10013299 | 3300005335 | Bacteria | 5218 |
| 29 | Ga0070668_100052987 | 3300005347 | Bacteria | 3129 |
| 30 | Ga0070711_100047669 | 3300005439 | Bacteria | 2927 |
| 31 | Ga0070663_100024233 | 3300005455 | Bacteria | 4081 |
| 32 | Ga0070662_100002992 | 3300005457 | Bacteria | 10507 |
| 33 | Ga0068867_100058751 | 3300005459 | Bacteria | 2850 |
| 34 | Ga0068867_100287819 | 3300005459 | Bacteria | 1350 |
| 35 | Ga0070685_10001399 | 3300005466 | Bacteria | 12653 |
| 36 | Ga0068853_100068815 | 3300005539 | Bacteria | 3078 |
| 37 | Ga0070693_100015318 | 3300005547 | Bacteria | 3945 |
| 38 | Ga0070665_100002074 | 3300005548 | Bacteria | 22481 |
| 39 | Ga0070665_100123098 | 3300005548 | Bacteria | 2596 |
| 40 | Ga0070665_100180444 | 3300005548 | Bacteria | 2112 |
| 41 | Ga0068855_100219355 | 3300005563 | Bacteria | 2133 |
| 42 | Ga0068854_100001668 | 3300005578 | Bacteria | 13516 |
| 43 | Ga0068856_100163854 | 3300005614 | Bacteria | 2234 |
| 44 | Ga0068852_100021482 | 3300005616 | Bacteria | 5155 |
| 45 | Ga0068852_100294492 | 3300005616 | Bacteria | 1569 |
| 46 | Ga0068859_100105454 | 3300005617 | Bacteria | 2878 |
| 47 | Ga0068864_100170091 | 3300005618 | Bacteria | 1986 |
| 48 | Ga0068851_10007699 | 3300005834 | Bacteria | 4953 |
| 49 | Ga0068858_100011561 | 3300005842 | Bacteria | 8328 |
| 50 | Ga0068860_100006646 | 3300005843 | Bacteria | 11615 |
| 51 | Ga0075365_10033667 | 3300006038 | Bacteria | 3304 |
| 52 | Ga0075364_10008169 | 3300006051 | Bacteria | 6246 |
| 53 | Ga0075364_10010115 | 3300006051 | Bacteria | 5689 |
| 54 | Ga0075364_10063113 | 3300006051 | Bacteria | 2432 |
| 55 | Ga0075362_10003784 | 3300006177 | Bacteria | 5356 |
| 56 | Ga0097621_100098237 | 3300006237 | Bacteria | 2459 |
| 57 | Ga0068871_100120401 | 3300006358 | Bacteria | 2216 |
| 58 | Ga0068865_100052282 | 3300006881 | Bacteria | 2831 |
| 59 | Ga0099823_1000097 | 3300006944 | Bacteria | 42542 |
| 60 | Ga0079104_1000167 | 3300006946 | Bacteria | 93750 |
| 61 | Ga0079104_1010157 | 3300006946 | Bacteria | 3125 |
| 62 | Ga0105251_10027421 | 3300009011 | Bacteria | 2888 |
| 63 | Ga0105244_10000377 | 3300009036 | Bacteria | 41493 |
| 64 | Ga0105244_10045369 | 3300009036 | Bacteria | 2261 |
| 65 | Ga0105244_10102552 | 3300009036 | Bacteria | 1398 |
| 66 | Ga0105250_10000700 | 3300009092 | Bacteria | 20825 |
| 67 | Ga0105250_10009178 | 3300009092 | Bacteria | 4173 |
| 68 | Ga0105240_10001002 | 3300009093 | Bacteria | 50418 |
| 69 | Ga0105240_10010295 | 3300009093 | Bacteria | 13164 |
| 70 | Ga0105240_10155309 | 3300009093 | Bacteria | 2722 |
| 71 | Ga0105240_10255603 | 3300009093 | Bacteria | 2024 |
| 72 | Ga0105247_10000502 | 3300009101 | Bacteria | 32176 |
| 73 | Ga0105243_10000163 | 3300009148 | Bacteria | 75904 |
| 74 | Ga0105243_10009598 | 3300009148 | Bacteria | 7368 |
| 75 | Ga0105241_10010307 | 3300009174 | Bacteria | 6861 |
| 76 | Ga0105242_10006291 | 3300009176 | Bacteria | 9148 |
| 77 | Ga0105242_10107905 | 3300009176 | Bacteria | 2369 |
| 78 | Ga0105248_10071149 | 3300009177 | Bacteria | 3907 |
| 79 | Ga0105248_10402198 | 3300009177 | Bacteria | 1542 |
| 80 | Ga0105237_10078783 | 3300009545 | Bacteria | 3285 |
| 81 | Ga0105237_10142936 | 3300009545 | Bacteria | 2387 |
| 82 | Ga0105238_10027161 | 3300009551 | Bacteria | 5833 |
| 83 | Ga0105238_10030988 | 3300009551 | Bacteria | 5444 |
| 84 | Ga0105249_10012965 | 3300009553 | Bacteria | 7356 |
| 85 | Ga0105239_10051630 | 3300010375 | Bacteria | 4507 |
| 86 | Ga0157371_10000022 | 3300013102 | Bacteria | 295029 |
| 87 | Ga0157371_10037745 | 3300013102 | Bacteria | 3457 |
| 88 | Ga0157370_10005813 | 3300013104 | Bacteria | 13785 |
| 89 | Ga0157369_10000653 | 3300013105 | Bacteria | 44847 |
| 90 | Ga0163162_10025637 | 3300013306 | Bacteria | 5828 |
| 91 | Ga0163162_10035513 | 3300013306 | Bacteria | 4965 |
| 92 | Ga0163162_10062232 | 3300013306 | Bacteria | 3772 |
| 93 | Ga0157372_10123800 | 3300013307 | Bacteria | 2972 |
| 94 | Ga0157375_10000107 | 3300013308 | Bacteria | 81910 |
| 95 | Ga0163163_10003683 | 3300014325 | Bacteria | 13047 |
| 96 | Ga0182008_10000013 | 3300014497 | Bacteria | 286492 |
| 97 | Ga0182008_10000390 | 3300014497 | Bacteria | 34042 |
| 98 | Ga0182008_10010135 | 3300014497 | Bacteria | 5052 |
| 99 | Ga0157376_10016081 | 3300014969 | Bacteria | 5671 |
| 100 | Ga0157376_10066806 | 3300014969 | Bacteria | 3040 |
| 101 | Ga0157376_10139449 | 3300014969 | Bacteria | 2173 |
| 102 | Ga0182006_1000026 | 3300015261 | Bacteria | 253543 |
| 103 | Ga0182006_1000097 | 3300015261 | Bacteria | 102186 |
| 104 | Ga0182006_1005529 | 3300015261 | Bacteria | 6002 |
| 105 | Ga0182007_10000004 | 3300015262 | Bacteria | 485875 |
| 106 | Ga0182007_10000095 | 3300015262 | Bacteria | 63829 |
| 107 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 108 | Ga0182005_1000038 | 3300015265 | Bacteria | 160030 |
| 109 | Ga0163161_10001217 | 3300017792 | Bacteria | 19401 |
| 110 | Ga0163161_10006939 | 3300017792 | Bacteria | 7830 |
| 111 | Ga0163161_10016788 | 3300017792 | Bacteria | 5118 |
| 112 | Ga0163161_10026647 | 3300017792 | Bacteria | 4095 |
| 113 | Ga0213872_10029947 | 3300021361 | Bacteria | 2496 |
| 114 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 115 | Ga0209233_1000759 | 3300025261 | Bacteria | 14553 |
| 116 | Ga0209565_1000024 | 3300025263 | Bacteria | 379907 |
| 117 | Ga0209673_1000413 | 3300025273 | Bacteria | 75089 |
| 118 | Ga0209130_1000046 | 3300025284 | Bacteria | 236658 |
| 119 | Ga0209675_1000039 | 3300025291 | Bacteria | 247966 |
| 120 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 121 | Ga0209676_1000650 | 3300025292 | Bacteria | 49825 |
| 122 | Ga0209676_1000655 | 3300025292 | Bacteria | 49591 |
| 123 | Ga0209676_1000724 | 3300025292 | Bacteria | 45433 |
| 124 | Ga0209676_1012468 | 3300025292 | Bacteria | 3336 |
| 125 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 126 | Ga0209564_1000411 | 3300025295 | Bacteria | 75939 |
| 127 | Ga0209050_1000032 | 3300025298 | Bacteria | 456335 |
| 128 | Ga0209050_1000069 | 3300025298 | Bacteria | 297615 |
| 129 | Ga0209050_1006468 | 3300025298 | Bacteria | 6925 |
| 130 | Ga0209256_1006758 | 3300025299 | Bacteria | 5934 |
| 131 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 132 | Ga0209257_1000858 | 3300025304 | Bacteria | 43308 |
| 133 | Ga0209257_1003880 | 3300025304 | Bacteria | 12204 |
| 134 | Ga0209257_1007359 | 3300025304 | Bacteria | 6673 |
| 135 | Ga0207696_1001811 | 3300025711 | Bacteria | 11015 |
| 136 | Ga0207696_1002185 | 3300025711 | Bacteria | 9800 |
| 137 | Ga0207696_1002705 | 3300025711 | Bacteria | 8482 |
| 138 | Ga0207655_1000646 | 3300025728 | Bacteria | 41672 |
| 139 | Ga0207655_1000822 | 3300025728 | Bacteria | 33630 |
| 140 | Ga0207655_1001110 | 3300025728 | Bacteria | 26288 |
| 141 | Ga0207713_1002154 | 3300025735 | Bacteria | 14631 |
| 142 | Ga0207713_1008819 | 3300025735 | Bacteria | 5748 |
| 143 | Ga0207713_1023376 | 3300025735 | Bacteria | 2910 |
| 144 | Ga0207710_10000009 | 3300025900 | Bacteria | 485205 |
| 145 | Ga0207680_10145788 | 3300025903 | Bacteria | 1574 |
| 146 | Ga0207647_10000269 | 3300025904 | Bacteria | 42790 |
| 147 | Ga0207654_10023484 | 3300025911 | Bacteria | 3304 |
| 148 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 149 | Ga0207695_10004908 | 3300025913 | Bacteria | 18021 |
| 150 | Ga0207695_10006253 | 3300025913 | Bacteria | 15503 |
| 151 | Ga0207695_10021399 | 3300025913 | Bacteria | 7377 |
| 152 | Ga0207695_10054758 | 3300025913 | Bacteria | 4162 |
| 153 | Ga0207671_10006578 | 3300025914 | Bacteria | 10322 |
| 154 | Ga0207671_10042268 | 3300025914 | Bacteria | 3374 |
| 155 | Ga0207671_10081813 | 3300025914 | Bacteria | 2422 |
| 156 | Ga0207649_10071702 | 3300025920 | Bacteria | 2213 |
| 157 | Ga0207681_10001205 | 3300025923 | Bacteria | 16638 |
| 158 | Ga0207694_10006754 | 3300025924 | Bacteria | 8714 |
| 159 | Ga0207694_10016455 | 3300025924 | Bacteria | 5584 |
| 160 | Ga0207694_10296854 | 3300025924 | Bacteria | 1330 |
| 161 | Ga0207650_10248764 | 3300025925 | Bacteria | 1439 |
| 162 | Ga0207706_10003257 | 3300025933 | Bacteria | 15550 |
| 163 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 164 | Ga0207709_10000143 | 3300025935 | Bacteria | 99457 |
| 165 | Ga0207711_10080412 | 3300025941 | Bacteria | 2846 |
| 166 | Ga0207689_10251638 | 3300025942 | Bacteria | 1461 |
| 167 | Ga0207667_10074390 | 3300025949 | Bacteria | 3529 |
| 168 | Ga0207667_10135978 | 3300025949 | Bacteria | 2531 |
| 169 | Ga0207712_10000364 | 3300025961 | Bacteria | 40077 |
| 170 | Ga0207658_10001525 | 3300025986 | Bacteria | 18001 |
| 171 | Ga0207677_10134254 | 3300026023 | Bacteria | 1884 |
| 172 | Ga0207703_10002227 | 3300026035 | Bacteria | 16996 |
| 173 | Ga0207639_10000308 | 3300026041 | Bacteria | 34625 |
| 174 | Ga0207639_10005209 | 3300026041 | Bacteria | 8770 |
| 175 | Ga0207678_10006904 | 3300026067 | Bacteria | 10072 |
| 176 | Ga0207702_10016777 | 3300026078 | Bacteria | 6062 |
| 177 | Ga0207648_10029800 | 3300026089 | Bacteria | 4839 |
| 178 | Ga0207648_10076713 | 3300026089 | Bacteria | 2913 |
| 179 | Ga0207674_10054318 | 3300026116 | Bacteria | 4078 |
| 180 | Ga0207683_10017243 | 3300026121 | Bacteria | 6150 |
| 181 | Ga0207698_10009909 | 3300026142 | Bacteria | 6095 |
| 182 | Ga0209281_1000017 | 3300027111 | Bacteria | 583251 |
| 183 | Ga0209281_1003314 | 3300027111 | Bacteria | 5426 |
| 184 | Ga0209389_1000013 | 3300027296 | Bacteria | 208890 |
| 185 | Ga0209371_1000040 | 3300027312 | Bacteria | 340804 |
| 186 | Ga0209371_1000095 | 3300027312 | Bacteria | 166175 |
| 187 | Ga0209971_1009826 | 3300027682 | Bacteria | 2266 |
| 188 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 189 | Ga0268264_10040409 | 3300028381 | Bacteria | 3854 |
| 190 | Ga0268256_1000041 | 3300030500 | Bacteria | 340725 |
| 191 | Ga0268256_1000116 | 3300030500 | Bacteria | 115451 |
| 192 | Ga0316176_1172566 | 3300030732 | Bacteria | 3913 |
| 193 | Ga0265327_10001037 | 3300031251 | Bacteria | 39182 |
| 194 | Ga0265316_10042875 | 3300031344 | Bacteria | 3613 |
| 195 | Ga0307408_100002587 | 3300031548 | Bacteria | 12614 |
| 196 | Ga0307508_10052854 | 3300031616 | Bacteria | 3607 |
| 197 | Ga0265314_10019230 | 3300031711 | Bacteria | 5297 |
| 198 | Ga0307412_10064926 | 3300031911 | Bacteria | 2468 |
| 199 | Ga0307414_10004927 | 3300032004 | Bacteria | 7301 |
| 200 | Ga0373937_0029112 | 3300036401 | Bacteria | 5001 |
| 201 | Ga0395899_0038892 | 3300037312 | Bacteria | 3562 |
| 202 | Ga0395905_0016308 | 3300037471 | Bacteria | 7060 |
| 203 | Ga0395905_0085602 | 3300037471 | Bacteria | 2953 |
| 204 | Ga0436361_0010019 | 3300039447 | Bacteria | 6376 |
| 205 | Ga0436361_0915026 | 3300039447 | Bacteria | 2082 |
| 206 | Ga0439466_0036358 | 3300041411 | Bacteria | 1663 |
| 207 | Ga0439432_007006 | 3300042006 | Bacteria | 4008 |
| 208 | Ga0450904_000075 | 3300042139 | Bacteria | 22281 |
| 209 | Ga0450905_006046 | 3300042142 | Bacteria | 1631 |
| 210 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 211 | Ga0495617_000041 | 3300046452 | Bacteria | 124027 |
| 212 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 213 | Ga0495627_002837 | 3300046453 | Bacteria | 8019 |
| 214 | Ga0495627_006326 | 3300046453 | Bacteria | 4651 |
| 215 | Ga0495603_0010538 | 3300046455 | Bacteria | 5600 |
| 216 | Ga0495590_0000025 | 3300046457 | Bacteria | 165221 |
| 217 | Ga0495590_0002397 | 3300046457 | Bacteria | 7763 |
| 218 | Ga0495591_004009 | 3300046458 | Bacteria | 7368 |
| 219 | Ga0495591_010207 | 3300046458 | Bacteria | 3658 |
| 220 | Ga0495638_0000711 | 3300046460 | Bacteria | 35843 |
| 221 | Ga0495638_0010587 | 3300046460 | Bacteria | 6390 |
| 222 | Ga0495638_0018141 | 3300046460 | Bacteria | 4677 |
| 223 | Ga0495638_0044745 | 3300046460 | Bacteria | 2788 |
| 224 | Ga0495638_0047547 | 3300046460 | Bacteria | 2689 |
| 225 | Ga0495653_0025046 | 3300046463 | Bacteria | 4800 |
| 226 | Ga0495650_0000156 | 3300046471 | Bacteria | 155338 |
| 227 | Ga0495650_0017029 | 3300046471 | Bacteria | 3656 |
| 228 | Ga0495580_0023251 | 3300046472 | Bacteria | 4554 |
| 229 | Ga0495580_0027938 | 3300046472 | Bacteria | 4103 |
| 230 | Ga0495582_0011407 | 3300046473 | Bacteria | 4896 |
| 231 | Ga0495582_0027916 | 3300046473 | Bacteria | 3095 |
| 232 | Ga0495582_0033012 | 3300046473 | Bacteria | 2844 |
| 233 | Ga0495605_0005636 | 3300046474 | Bacteria | 7276 |
| 234 | Ga0495605_0006745 | 3300046474 | Bacteria | 6564 |
| 235 | Ga0495639_0022458 | 3300046475 | Bacteria | 2768 |
| 236 | Ga0495584_0000238 | 3300046491 | Bacteria | 39636 |
| 237 | Ga0495584_0009414 | 3300046491 | Bacteria | 5032 |
| 238 | Ga0495584_0014400 | 3300046491 | Bacteria | 4028 |
| 239 | Ga0495584_0036003 | 3300046491 | Bacteria | 2500 |
| 240 | Ga0495585_0000812 | 3300046492 | Bacteria | 27226 |
| 241 | Ga0495585_0000946 | 3300046492 | Bacteria | 24469 |
| 242 | Ga0495585_0002065 | 3300046492 | Bacteria | 14773 |
| 243 | Ga0495585_0036784 | 3300046492 | Bacteria | 2758 |
| 244 | Ga0495585_0107215 | 3300046492 | Bacteria | 1488 |
| 245 | Ga0495594_0007313 | 3300046499 | Bacteria | 5680 |
| 246 | Ga0495596_0002512 | 3300046500 | Bacteria | 9829 |
| 247 | Ga0495596_0005819 | 3300046500 | Bacteria | 5772 |
| 248 | Ga0495596_0006752 | 3300046500 | Bacteria | 5245 |
| 249 | Ga0495596_0007102 | 3300046500 | Bacteria | 5073 |
| 250 | Ga0495596_0008228 | 3300046500 | Bacteria | 4650 |
| 251 | Ga0495596_0024858 | 3300046500 | Bacteria | 2423 |
| 252 | Ga0495607_0000811 | 3300046501 | Bacteria | 29602 |
| 253 | Ga0495607_0011620 | 3300046501 | Bacteria | 5852 |
| 254 | Ga0495583_0000520 | 3300046506 | Bacteria | 54664 |
| 255 | Ga0495583_0006505 | 3300046506 | Bacteria | 7629 |
| 256 | Ga0495583_0010415 | 3300046506 | Bacteria | 5424 |
| 257 | Ga0495606_0000777 | 3300046507 | Bacteria | 48912 |
| 258 | Ga0495606_0005924 | 3300046507 | Bacteria | 11489 |
| 259 | Ga0495606_0051981 | 3300046507 | Bacteria | 2668 |
| 260 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 261 | Ga0495610_0001963 | 3300046512 | Bacteria | 17672 |
| 262 | Ga0495610_0004467 | 3300046512 | Bacteria | 10331 |
| 263 | Ga0495610_0004537 | 3300046512 | Bacteria | 10214 |
| 264 | Ga0495610_0005886 | 3300046512 | Bacteria | 8593 |
| 265 | Ga0495616_0004348 | 3300046513 | Bacteria | 8939 |
| 266 | Ga0495616_0035503 | 3300046513 | Bacteria | 2579 |
| 267 | Ga0495616_0062265 | 3300046513 | Bacteria | 1827 |
| 268 | Ga0495630_0027991 | 3300046517 | Bacteria | 4188 |
| 269 | Ga0495631_0000128 | 3300046518 | Bacteria | 51035 |
| 270 | Ga0495631_0000871 | 3300046518 | Bacteria | 18972 |
| 271 | Ga0495631_0006308 | 3300046518 | Bacteria | 6134 |
| 272 | Ga0495631_0006728 | 3300046518 | Bacteria | 5899 |
| 273 | Ga0495631_0008825 | 3300046518 | Bacteria | 5061 |
| 274 | Ga0495631_0014922 | 3300046518 | Bacteria | 3737 |
| 275 | Ga0495631_0058772 | 3300046518 | Bacteria | 1671 |
| 276 | Ga0495632_0000068 | 3300046519 | Bacteria | 108872 |
| 277 | Ga0495632_0003587 | 3300046519 | Bacteria | 10927 |
| 278 | Ga0495632_0045572 | 3300046519 | Bacteria | 2183 |
| 279 | Ga0495637_0000019 | 3300046520 | Bacteria | 185953 |
| 280 | Ga0495643_0000123 | 3300046522 | Bacteria | 124936 |
| 281 | Ga0495643_0000612 | 3300046522 | Bacteria | 42656 |
| 282 | Ga0495643_0010698 | 3300046522 | Bacteria | 5637 |
| 283 | Ga0495643_0011229 | 3300046522 | Bacteria | 5470 |
| 284 | Ga0495643_0027735 | 3300046522 | Bacteria | 3180 |
| 285 | Ga0495643_0080484 | 3300046522 | Bacteria | 1695 |
| 286 | Ga0495644_0003419 | 3300046523 | Bacteria | 6283 |
| 287 | Ga0495644_0021512 | 3300046523 | Bacteria | 2461 |
| 288 | Ga0495648_0000193 | 3300046524 | Bacteria | 70395 |
| 289 | Ga0495648_0001612 | 3300046524 | Bacteria | 21954 |
| 290 | Ga0495648_0009406 | 3300046524 | Bacteria | 7582 |
| 291 | Ga0495648_0010068 | 3300046524 | Bacteria | 7243 |
| 292 | Ga0495648_0027319 | 3300046524 | Bacteria | 3823 |
| 293 | Ga0495663_0002101 | 3300046525 | Bacteria | 6096 |
| 294 | Ga0495666_0094449 | 3300046526 | Bacteria | 1410 |
| 295 | Ga0495642_0002275 | 3300046528 | Bacteria | 7835 |
| 296 | Ga0495642_0002852 | 3300046528 | Bacteria | 6896 |
| 297 | Ga0495642_0004437 | 3300046528 | Bacteria | 5444 |
| 298 | Ga0495642_0006340 | 3300046528 | Bacteria | 4534 |
| 299 | Ga0495642_0009593 | 3300046528 | Bacteria | 3704 |
| 300 | Ga0495654_0004469 | 3300046530 | Bacteria | 8292 |
| 301 | Ga0495654_0005433 | 3300046530 | Bacteria | 7401 |
| 302 | Ga0495654_0006835 | 3300046530 | Bacteria | 6436 |
| 303 | Ga0495654_0009350 | 3300046530 | Bacteria | 5372 |
| 304 | Ga0495654_0014693 | 3300046530 | Bacteria | 4164 |
| 305 | Ga0495609_0000380 | 3300046538 | Bacteria | 37754 |
| 306 | Ga0495609_0002456 | 3300046538 | Bacteria | 11400 |
| 307 | Ga0495609_0003906 | 3300046538 | Bacteria | 8364 |
| 308 | Ga0495609_0081175 | 3300046538 | Bacteria | 1417 |
| 309 | Ga0495597_0000067 | 3300046542 | Bacteria | 90183 |
| 310 | Ga0495597_0000738 | 3300046542 | Bacteria | 26102 |
| 311 | Ga0495597_0001580 | 3300046542 | Bacteria | 16010 |
| 312 | Ga0495597_0002866 | 3300046542 | Bacteria | 10532 |
| 313 | Ga0495597_0004500 | 3300046542 | Bacteria | 7635 |
| 314 | Ga0495597_0085746 | 3300046542 | Bacteria | 1341 |
| 315 | Ga0495633_0000528 | 3300046558 | Bacteria | 38185 |
| 316 | Ga0495633_0001592 | 3300046558 | Bacteria | 17205 |
| 317 | Ga0495633_0003379 | 3300046558 | Bacteria | 10678 |
| 318 | Ga0495633_0004064 | 3300046558 | Bacteria | 9443 |
| 319 | Ga0495633_0004095 | 3300046558 | Bacteria | 9406 |
| 320 | Ga0495633_0006212 | 3300046558 | Bacteria | 7135 |
| 321 | Ga0495633_0037345 | 3300046558 | Bacteria | 2324 |
| 322 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 323 | Ga0495668_0000718 | 3300046616 | Bacteria | 39893 |
| 324 | Ga0495668_0002188 | 3300046616 | Bacteria | 16714 |
| 325 | Ga0495668_0005410 | 3300046616 | Bacteria | 8678 |
| 326 | Ga0495668_0006070 | 3300046616 | Bacteria | 8001 |
| 327 | Ga0495668_0010723 | 3300046616 | Bacteria | 5535 |
| 328 | Ga0495668_0017490 | 3300046616 | Bacteria | 4156 |
| 329 | Ga0495668_0030721 | 3300046616 | Bacteria | 3031 |
| 330 | Ga0495634_0070630 | 3300046642 | Bacteria | 2301 |
| 331 | Ga0495611_0000724 | 3300046648 | Bacteria | 18536 |
| 332 | Ga0495611_0008372 | 3300046648 | Bacteria | 4380 |
| 333 | Ga0495611_0017878 | 3300046648 | Bacteria | 3037 |
| 334 | Ga0495611_0037631 | 3300046648 | Bacteria | 2150 |
| 335 | Ga0495625_0003436 | 3300046660 | Bacteria | 15795 |
| 336 | Ga0495625_0006578 | 3300046660 | Bacteria | 10315 |
| 337 | Ga0495625_0016791 | 3300046660 | Bacteria | 5749 |
| 338 | Ga0495625_0019641 | 3300046660 | Bacteria | 5233 |
| 339 | Ga0495625_0020788 | 3300046660 | Bacteria | 5061 |
| 340 | Ga0495659_0041617 | 3300046664 | Bacteria | 1642 |
| 341 | Ga0495661_0000602 | 3300046665 | Bacteria | 36783 |
| 342 | Ga0495661_0001847 | 3300046665 | Bacteria | 16912 |
| 343 | Ga0495661_0047386 | 3300046665 | Bacteria | 2617 |
| 344 | Ga0495661_0083799 | 3300046665 | Bacteria | 1831 |
| 345 | Ga0495623_0003901 | 3300046679 | Bacteria | 9835 |
| 346 | Ga0495658_0033448 | 3300046683 | Bacteria | 2815 |
| 347 | Ga0495669_0001110 | 3300046684 | Bacteria | 11153 |
| 348 | Ga0495669_0002499 | 3300046684 | Bacteria | 7504 |
| 349 | Ga0495669_0008965 | 3300046684 | Bacteria | 4214 |
| 350 | Ga0495669_0009574 | 3300046684 | Bacteria | 4087 |
| 351 | Ga0495669_0039753 | 3300046684 | Bacteria | 2083 |
| 352 | Ga0495613_0022795 | 3300046689 | Bacteria | 4666 |
| 353 | Ga0495670_0004077 | 3300046691 | Bacteria | 7165 |
| 354 | Ga0495670_0074271 | 3300046691 | Bacteria | 1724 |
| 355 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 356 | Ga0495671_0000331 | 3300046692 | Bacteria | 39699 |
| 357 | Ga0495671_0004188 | 3300046692 | Bacteria | 8688 |
| 358 | Ga0495671_0004504 | 3300046692 | Bacteria | 8313 |
| 359 | Ga0495671_0005746 | 3300046692 | Bacteria | 7231 |
| 360 | Ga0495671_0007451 | 3300046692 | Bacteria | 6236 |
| 361 | Ga0495671_0049342 | 3300046692 | Bacteria | 2098 |
| 362 | Ga0495649_0000196 | 3300046694 | Bacteria | 53380 |
| 363 | Ga0495649_0041514 | 3300046694 | Bacteria | 2516 |
| 364 | Ga0495589_0000079 | 3300046794 | Bacteria | 89713 |
| 365 | Ga0495589_0012412 | 3300046794 | Bacteria | 4412 |
| 366 | Ga0495589_0039330 | 3300046794 | Bacteria | 2363 |
| 367 | Ga0495660_0000496 | 3300046810 | Bacteria | 32573 |
| 368 | Ga0495660_0003195 | 3300046810 | Bacteria | 10188 |
| 369 | Ga0495660_0004248 | 3300046810 | Bacteria | 8694 |
| 370 | Ga0495660_0005828 | 3300046810 | Bacteria | 7352 |
| 371 | Ga0495660_0006150 | 3300046810 | Bacteria | 7126 |
| 372 | Ga0495660_0007544 | 3300046810 | Bacteria | 6385 |
| 373 | Ga0495660_0012326 | 3300046810 | Bacteria | 4960 |
| 374 | Ga0495581_0010853 | 3300047315 | Bacteria | 5266 |
| 375 | Ga0495604_0011550 | 3300047317 | Bacteria | 7018 |
| 376 | Ga0495604_0017522 | 3300047317 | Bacteria | 5736 |
| 377 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 378 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 379 | Ga0495672_0000429 | 3300047320 | Bacteria | 50347 |
| 380 | Ga0495672_0006417 | 3300047320 | Bacteria | 9122 |
| 381 | Ga0495672_0016377 | 3300047320 | Bacteria | 4998 |
| 382 | Ga0495676_0000092 | 3300047321 | Bacteria | 66361 |
| 383 | Ga0495683_0001072 | 3300047323 | Bacteria | 18936 |
| 384 | Ga0495683_0011492 | 3300047323 | Bacteria | 4655 |
| 385 | Ga0495683_0097806 | 3300047323 | Bacteria | 1414 |
| 386 | Ga0495687_000133 | 3300047443 | Bacteria | 113757 |
| 387 | Ga0495687_000537 | 3300047443 | Bacteria | 45261 |
| 388 | Ga0495687_011570 | 3300047443 | Bacteria | 4734 |
| 389 | Ga0495675_0004233 | 3300047444 | Bacteria | 8679 |
| 390 | Ga0495677_0000367 | 3300047445 | Bacteria | 19447 |
| 391 | Ga0495677_0001844 | 3300047445 | Bacteria | 8468 |
| 392 | Ga0495677_0011833 | 3300047445 | Bacteria | 3186 |
| 393 | Ga0495677_0030502 | 3300047445 | Bacteria | 1962 |
| 394 | Ga0495679_013486 | 3300047446 | Bacteria | 3065 |
| 395 | Ga0495679_030806 | 3300047446 | Bacteria | 1737 |
| 396 | Ga0495679_032135 | 3300047446 | Bacteria | 1686 |
| 397 | Ga0495685_001039 | 3300047447 | Bacteria | 8451 |
| 398 | Ga0495685_022108 | 3300047447 | Bacteria | 2188 |
| 399 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 400 | Ga0495681_0002000 | 3300047470 | Bacteria | 14898 |
| 401 | Ga0495681_0006542 | 3300047470 | Bacteria | 7634 |
| 402 | Ga0495681_0011916 | 3300047470 | Bacteria | 5137 |
| 403 | Ga0495686_0000006 | 3300047472 | Bacteria | 770778 |
| 404 | Ga0495686_0000279 | 3300047472 | Bacteria | 90202 |
| 405 | Ga0495686_0000479 | 3300047472 | Bacteria | 59585 |
| 406 | Ga0495686_0001600 | 3300047472 | Bacteria | 23919 |
| 407 | Ga0495686_0002005 | 3300047472 | Bacteria | 20174 |
| 408 | Ga0495686_0019374 | 3300047472 | Bacteria | 4546 |
| 409 | Ga0495614_0002457 | 3300048089 | Bacteria | 8238 |
| 410 | Ga0495626_0004630 | 3300048091 | Bacteria | 8364 |
| 411 | Ga0495626_0005307 | 3300048091 | Bacteria | 7599 |
| 412 | Ga0495626_0009099 | 3300048091 | Bacteria | 5388 |
| 413 | Ga0496101_0063990 | 3300048904 | Bacteria | 2678 |
| 414 | Ga0496102_0178071 | 3300048905 | Bacteria | 2003 |
| 415 | Ga0496103_0073604 | 3300048906 | Bacteria | 2140 |
| 416 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 417 | Ga0496104_0000039 | 3300048907 | Bacteria | 177103 |
| 418 | Ga0496104_0162562 | 3300048907 | Bacteria | 2141 |
| 419 | Ga0496105_0000084 | 3300048908 | Bacteria | 67834 |
| 420 | Ga0496105_0138863 | 3300048908 | Bacteria | 2001 |
| 421 | Ga0496107_0126992 | 3300048910 | Bacteria | 1881 |
| 422 | Ga0496110_0014675 | 3300048913 | Bacteria | 6512 |
| 423 | Ga0496111_0243464 | 3300048914 | Bacteria | 1335 |
| 424 | Ga0496112_0183096 | 3300048915 | Bacteria | 2058 |
| 425 | Ga0496115_0000002 | 3300048918 | Bacteria | 365286 |
| 426 | Ga0496115_0001466 | 3300048918 | Bacteria | 16927 |
| 427 | Ga0496116_0006867 | 3300048919 | Bacteria | 10221 |
| 428 | Ga0496116_0050117 | 3300048919 | Bacteria | 2784 |
| 429 | Ga0496117_0000065 | 3300048920 | Bacteria | 254215 |
| 430 | Ga0496117_0000132 | 3300048920 | Bacteria | 162117 |
| 431 | Ga0496117_0005145 | 3300048920 | Bacteria | 13954 |
| 432 | Ga0496117_0005767 | 3300048920 | Bacteria | 12864 |
| 433 | Ga0496118_0000033 | 3300048921 | Bacteria | 326357 |
| 434 | Ga0496118_0000099 | 3300048921 | Bacteria | 160412 |
| 435 | Ga0496118_0001414 | 3300048921 | Bacteria | 36205 |
| 436 | Ga0496118_0002596 | 3300048921 | Bacteria | 24061 |
| 437 | Ga0496118_0012948 | 3300048921 | Bacteria | 7941 |
| 438 | Ga0496118_0019844 | 3300048921 | Bacteria | 5991 |
| 439 | Ga0496119_0000632 | 3300048922 | Bacteria | 47533 |
| 440 | Ga0496120_0000204 | 3300048923 | Bacteria | 101626 |
| 441 | Ga0496121_0010790 | 3300048924 | Bacteria | 10239 |
| 442 | Ga0496121_0014412 | 3300048924 | Bacteria | 8392 |
| 443 | Ga0496121_0016990 | 3300048924 | Bacteria | 7469 |
| 444 | Ga0496121_0020731 | 3300048924 | Bacteria | 6482 |
| 445 | Ga0496121_0022148 | 3300048924 | Bacteria | 6181 |
| 446 | Ga0496121_0036345 | 3300048924 | Bacteria | 4390 |
| 447 | Ga0496121_0064268 | 3300048924 | Bacteria | 2993 |
| 448 | Ga0496122_0000988 | 3300048925 | Bacteria | 50798 |
| 449 | Ga0496122_0004429 | 3300048925 | Bacteria | 17454 |
| 450 | Ga0496122_0006616 | 3300048925 | Bacteria | 13219 |
| 451 | Ga0496122_0007439 | 3300048925 | Bacteria | 12169 |
| 452 | Ga0496122_0008475 | 3300048925 | Bacteria | 11078 |
| 453 | Ga0496122_0022864 | 3300048925 | Bacteria | 5536 |
| 454 | Ga0496122_0029656 | 3300048925 | Bacteria | 4607 |
| 455 | Ga0496122_0080849 | 3300048925 | Bacteria | 2264 |
| 456 | Ga0496123_0000198 | 3300048926 | Bacteria | 122508 |
| 457 | Ga0496123_0002480 | 3300048926 | Bacteria | 22780 |
| 458 | Ga0496123_0005655 | 3300048926 | Bacteria | 12483 |
| 459 | Ga0496123_0009138 | 3300048926 | Bacteria | 8966 |
| 460 | Ga0496123_0010362 | 3300048926 | Bacteria | 8251 |
| 461 | Ga0496123_0010932 | 3300048926 | Bacteria | 7941 |
| 462 | Ga0496123_0016750 | 3300048926 | Bacteria | 5931 |
| 463 | Ga0496124_0000056 | 3300048927 | Bacteria | 250907 |
| 464 | Ga0496124_0003538 | 3300048927 | Bacteria | 19006 |
| 465 | Ga0496124_0010857 | 3300048927 | Bacteria | 9170 |
| 466 | Ga0496124_0010977 | 3300048927 | Bacteria | 9105 |
| 467 | Ga0496124_0012500 | 3300048927 | Bacteria | 8372 |
| 468 | Ga0496124_0065735 | 3300048927 | Bacteria | 3023 |
| 469 | Ga0496124_0094045 | 3300048927 | Bacteria | 2439 |
| 470 | Ga0496124_0145162 | 3300048927 | Bacteria | 1868 |
| 471 | Ga0496125_0000132 | 3300048928 | Bacteria | 162176 |
| 472 | Ga0496125_0001680 | 3300048928 | Bacteria | 30949 |
| 473 | Ga0496125_0007623 | 3300048928 | Bacteria | 11483 |
| 474 | Ga0496125_0009473 | 3300048928 | Bacteria | 9998 |
| 475 | Ga0496125_0016718 | 3300048928 | Bacteria | 7034 |
| 476 | Ga0496125_0018243 | 3300048928 | Bacteria | 6669 |
| 477 | Ga0496125_0099301 | 3300048928 | Bacteria | 2151 |
| 478 | Ga0496126_0000052 | 3300048929 | Bacteria | 312383 |
| 479 | Ga0496126_0000331 | 3300048929 | Bacteria | 100914 |
| 480 | Ga0496126_0010423 | 3300048929 | Bacteria | 9742 |
| 481 | Ga0496126_0019753 | 3300048929 | Bacteria | 6630 |
| 482 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 483 | Ga0495678_000070 | 3300049459 | Bacteria | 131437 |
| 484 | Ga0495678_000105 | 3300049459 | Bacteria | 103599 |
| 485 | Ga0495678_000313 | 3300049459 | Bacteria | 51964 |
| 486 | Ga0495678_001671 | 3300049459 | Bacteria | 16865 |
| 487 | Ga0495678_001884 | 3300049459 | Bacteria | 15250 |
| 488 | Ga0495682_0001637 | 3300049460 | Bacteria | 11532 |
| 489 | Ga0495682_0003245 | 3300049460 | Bacteria | 7292 |
| 490 | Ga0495682_0022451 | 3300049460 | Bacteria | 2359 |
| 491 | Ga0501031_0015989 | 3300049568 | Bacteria | 4872 |
| 492 | Ga0501031_0018350 | 3300049568 | Bacteria | 4555 |
| 493 | Ga0501032_0032701 | 3300049569 | Bacteria | 3564 |
| 494 | Ga0501032_0036064 | 3300049569 | Bacteria | 3377 |
| 495 | Ga0501033_0035695 | 3300049570 | Bacteria | 3727 |
| 496 | Ga0501034_0000045 | 3300049571 | Bacteria | 226186 |
| 497 | Ga0501034_0002724 | 3300049571 | Bacteria | 20800 |
| 498 | Ga0501036_0003405 | 3300049572 | Bacteria | 12711 |
| 499 | Ga0501037_0002556 | 3300049573 | Bacteria | 13155 |
| 500 | Ga0501038_0004389 | 3300049574 | Bacteria | 13121 |
| 501 | Ga0501043_0001464 | 3300049579 | Bacteria | 20639 |
| 502 | Ga0501043_0075041 | 3300049579 | Bacteria | 2656 |
| 503 | Ga0501046_0000106 | 3300049580 | Bacteria | 89243 |
| 504 | Ga0501047_0000523 | 3300049581 | Bacteria | 41561 |
| 505 | Ga0501047_0371817 | 3300049581 | Bacteria | 1264 |
| 506 | Ga0501073_0000737 | 3300049589 | Bacteria | 23177 |
| 507 | Ga0501080_0011421 | 3300049742 | Bacteria | 8133 |
| 508 | Ga0501035_0038098 | 3300049822 | Bacteria | 4353 |
| 509 | Ga0501035_0212616 | 3300049822 | Bacteria | 1654 |
| 510 | nmdc:mga03683_818_c1 | 3300050489 | Bacteria | 8910 |
| 511 | nmdc:mga00v17_129_c1 | 3300050491 | Bacteria | 44201 |
| 512 | nmdc:mga00v17_5685_c1 | 3300050491 | Bacteria | 6584 |
| 513 | nmdc:mga00v17_7470_c1 | 3300050491 | Bacteria | 5834 |
| 514 | nmdc:mga0yw44_33685_c1 | 3300050492 | Bacteria | 2995 |
| 515 | nmdc:mga0k408_10692_c1 | 3300050493 | Bacteria | 4972 |
| 516 | Ga0500659_0002064 | 3300053135 | Bacteria | 12308 |
| 517 | Ga0500586_000049 | 3300053145 | Bacteria | 20851 |
| 518 | Ga0500586_000607 | 3300053145 | Bacteria | 7277 |
| 519 | 2939634047 | 2939631187 | Bacteria | 6118131 |
| 520 | 2511377173 | 2511231024 | Bacteria | 5835885 |
| 521 | 2524610071 | 2524023250 | Bacteria | 5457705 |
| 522 | 2552746404 | 2551306352 | Bacteria | 3873115 |
| 523 | 2578458334 | 2576861471 | Bacteria | 4648976 |
| 524 | 2595315420 | 2593339198 | Bacteria | 7267884 |
| 525 | 2601670122 | 2600255292 | Bacteria | 6300551 |
| 526 | 2640733360 | 2639762793 | Bacteria | 3943681 |
| 527 | 2643834152 | 2643221563 | Bacteria | 4726935 |
| 528 | 2644031374 | 2643221603 | Bacteria | 6147767 |
| 529 | 2644055078 | 2643221608 | Bacteria | 4724829 |
| 530 | 2644251152 | 2643221645 | Bacteria | 7207331 |
| 531 | 2644354667 | 2643221664 | Bacteria | 7272945 |
| 532 | 2673821575 | 2671180694 | Bacteria | 7506943 |
| 533 | 2678230392 | 2675903507 | Bacteria | 3737791 |
| 534 | 2722881621 | 2721755523 | Bacteria | 6430384 |
| 535 | 2738716923 | 2738541276 | Bacteria | 4690596 |
| 536 | 2738739862 | 2738541280 | Bacteria | 6630198 |
| 537 | 2738829214 | 2738541297 | Bacteria | 6549566 |
| 538 | 2738844356 | 2738541300 | Bacteria | 6675882 |
| 539 | 2739153010 | 2738541357 | Bacteria | 6549408 |
| 540 | 2739194930 | 2738543003 | Bacteria | 6549560 |
| 541 | 2739274084 | 2738543018 | Bacteria | 6718814 |
| 542 | 2739321406 | 2738543026 | Bacteria | 6549408 |
| 543 | 2739340038 | 2738543029 | Bacteria | 6549249 |
| 544 | 2739343128 | 2738543030 | Bacteria | 6719714 |
| 545 | 2745161370 | 2744054655 | Bacteria | 3552603 |
| 546 | 2765584723 | 2765235841 | Bacteria | 6137024 |
| 547 | 2774389052 | 2773857761 | Bacteria | 3837365 |
| 548 | 2774439251 | 2773857770 | Bacteria | 3911866 |
| 549 | 2809146698 | 2808606418 | Bacteria | 6724496 |
| 550 | 2839144374 | 2839138175 | Bacteria | 6549354 |
| 551 | 2842717779 | 2842711865 | Bacteria | 7155354 |
| 552 | 2852650672 | 2852649853 | Bacteria | 4036942 |
| 553 | 2857443413 | 2857442823 | Bacteria | 4562550 |
| 554 | 2857552901 | 2857547612 | Bacteria | 6179999 |
| 555 | 2857554449 | 2857553236 | Bacteria | 6166726 |
| 556 | 2857576101 | 2857576091 | Bacteria | 5465855 |
| 557 | 2884218647 | 2884215851 | Bacteria | 4554841 |
| 558 | 2885081559 | 2885080285 | Bacteria | 6355622 |
| 559 | 2889049836 | 2889049205 | Bacteria | 7524325 |
| 560 | 2894024776 | 2894023352 | Bacteria | 5167372 |
| 561 | 2916701747 | 2916699645 | Bacteria | 3568996 |
| 562 | 2919185312 | 2919182534 | Bacteria | 3907101 |
| 563 | 2919514719 | 2919513703 | Bacteria | 3844312 |
| 564 | 2919676764 | 2919675420 | Bacteria | 3969095 |
| 565 | 2932413632 | 2932410948 | Bacteria | 6312192 |
| 566 | 2932417692 | 2932416698 | Bacteria | 6315112 |
| 567 | 2939591741 | 2939589442 | Bacteria | 4214238 |
| 568 | 2939623670 | 2939622612 | Bacteria | 4698046 |
| 569 | 2941475942 | 2941475908 | Bacteria | 4145589 |
| 570 | 2974308731 | 2974307012 | Bacteria | 4172388 |
| 571 | 2977249467 | 2977247770 | Bacteria | 4160543 |
| 572 | 2984516062 | 2984514374 | Bacteria | 4172479 |
| 573 | 2984572486 | 2984568884 | Bacteria | 3884413 |
| 574 | 3007319743 | 3007315729 | Bacteria | 5076637 |
| 575 | 8052496528 | 8052494512 | Bacteria | 5765634 |
| 576 | 8054930408 | 8054929484 | Bacteria | 5599761 |
| 577 | JGI24736J21556_1013011 | |||
| 578 | JGI25154J39366_1001065 | |||
| 579 | JGI25159J45721_1001688 | |||
| 580 | rootL2_10103549 | |||
| 581 | Ga0055526_1000973 | |||
| 582 | Ga0055537_1000440 | |||
| 583 | Ga0055536_1000444 | |||
| 584 | Ga0055536_1000543 | |||
| 585 | Ga0055536_1011470 | |||
| 586 | Ga0055536_1025964 | |||
| 587 | Ga0055528_1000860 | |||
| 588 | Ga0055530_10000021 | |||
| 589 | Ga0055530_10000323 | |||
| 590 | Ga0055531_10001266 | |||
| 591 | Ga0055531_10002303 | |||
| 592 | Ga0055531_10003871 | |||
| 593 | Ga0055531_10014955 | |||
| 594 | Ga0058692_1000014 | |||
| 595 | Ga0058692_1007691 | |||
| 596 | Ga0065165_1000005 | |||
| 597 | Ga0065165_1003002 | |||
| 598 | Ga0065703_1000120 | |||
| 599 | Ga0065704_10006065 | |||
| 600 | Ga0070658_10085130 | |||
| 601 | Ga0070683_100056176 | |||
| 602 | Ga0070670_100009223 | |||
| 603 | Ga0070666_10001416 | |||
| 604 | Ga0070666_10013299 | |||
| 605 | Ga0070668_100052987 | |||
| 606 | Ga0070711_100047669 | |||
| 607 | Ga0070663_100024233 | |||
| 608 | Ga0070662_100002992 | |||
| 609 | Ga0068867_100058751 | |||
| 610 | Ga0068867_100287819 | |||
| 611 | Ga0070685_10001399 | |||
| 612 | Ga0068853_100068815 | |||
| 613 | Ga0070693_100015318 | |||
| 614 | Ga0070665_100002074 | |||
| 615 | Ga0070665_100123098 | |||
| 616 | Ga0070665_100180444 | |||
| 617 | Ga0068855_100219355 | |||
| 618 | Ga0068854_100001668 | |||
| 619 | Ga0068856_100163854 | |||
| 620 | Ga0068852_100021482 | |||
| 621 | Ga0068852_100294492 | |||
| 622 | Ga0068859_100105454 | |||
| 623 | Ga0068864_100170091 | |||
| 624 | Ga0068851_10007699 | |||
| 625 | Ga0068858_100011561 | |||
| 626 | Ga0068860_100006646 | |||
| 627 | Ga0075365_10033667 | |||
| 628 | Ga0075364_10008169 | |||
| 629 | Ga0075364_10010115 | |||
| 630 | Ga0075364_10063113 | |||
| 631 | Ga0075362_10003784 | |||
| 632 | Ga0097621_100098237 | |||
| 633 | Ga0068871_100120401 | |||
| 634 | Ga0068865_100052282 | |||
| 635 | Ga0099823_1000097 | |||
| 636 | Ga0079104_1000167 | |||
| 637 | Ga0079104_1010157 | |||
| 638 | Ga0105251_10027421 | |||
| 639 | Ga0105244_10000377 | |||
| 640 | Ga0105244_10045369 | |||
| 641 | Ga0105244_10102552 | |||
| 642 | Ga0105250_10000700 | |||
| 643 | Ga0105250_10009178 | |||
| 644 | Ga0105240_10001002 | |||
| 645 | Ga0105240_10010295 | |||
| 646 | Ga0105240_10155309 | |||
| 647 | Ga0105240_10255603 | |||
| 648 | Ga0105247_10000502 | |||
| 649 | Ga0105243_10000163 | |||
| 650 | Ga0105243_10009598 | |||
| 651 | Ga0105241_10010307 | |||
| 652 | Ga0105242_10006291 | |||
| 653 | Ga0105242_10107905 | |||
| 654 | Ga0105248_10071149 | |||
| 655 | Ga0105248_10402198 | |||
| 656 | Ga0105237_10078783 | |||
| 657 | Ga0105237_10142936 | |||
| 658 | Ga0105238_10027161 | |||
| 659 | Ga0105238_10030988 | |||
| 660 | Ga0105249_10012965 | |||
| 661 | Ga0105239_10051630 | |||
| 662 | Ga0157371_10000022 | |||
| 663 | Ga0157371_10037745 | |||
| 664 | Ga0157370_10005813 | |||
| 665 | Ga0157369_10000653 | |||
| 666 | Ga0163162_10025637 | |||
| 667 | Ga0163162_10035513 | |||
| 668 | Ga0163162_10062232 | |||
| 669 | Ga0157372_10123800 | |||
| 670 | Ga0157375_10000107 | |||
| 671 | Ga0163163_10003683 | |||
| 672 | Ga0182008_10000013 | |||
| 673 | Ga0182008_10000390 | |||
| 674 | Ga0182008_10010135 | |||
| 675 | Ga0157376_10016081 | |||
| 676 | Ga0157376_10066806 | |||
| 677 | Ga0157376_10139449 | |||
| 678 | Ga0182006_1000026 | |||
| 679 | Ga0182006_1000097 | |||
| 680 | Ga0182006_1005529 | |||
| 681 | Ga0182007_10000004 | |||
| 682 | Ga0182007_10000095 | |||
| 683 | Ga0182005_1000007 | |||
| 684 | Ga0182005_1000038 | |||
| 685 | Ga0163161_10001217 | |||
| 686 | Ga0163161_10006939 | |||
| 687 | Ga0163161_10016788 | |||
| 688 | Ga0163161_10026647 | |||
| 689 | Ga0213872_10029947 | |||
| 690 | Ga0209646_1000010 | |||
| 691 | Ga0209233_1000759 | |||
| 692 | Ga0209565_1000024 | |||
| 693 | Ga0209673_1000413 | |||
| 694 | Ga0209130_1000046 | |||
| 695 | Ga0209675_1000039 | |||
| 696 | Ga0209676_1000011 | |||
| 697 | Ga0209676_1000650 | |||
| 698 | Ga0209676_1000655 | |||
| 699 | Ga0209676_1000724 | |||
| 700 | Ga0209676_1012468 | |||
| 701 | Ga0209564_1000068 | |||
| 702 | Ga0209564_1000411 | |||
| 703 | Ga0209050_1000032 | |||
| 704 | Ga0209050_1000069 | |||
| 705 | Ga0209050_1006468 | |||
| 706 | Ga0209256_1006758 | |||
| 707 | Ga0209257_1000014 | |||
| 708 | Ga0209257_1000858 | |||
| 709 | Ga0209257_1003880 | |||
| 710 | Ga0209257_1007359 | |||
| 711 | Ga0207696_1001811 | |||
| 712 | Ga0207696_1002185 | |||
| 713 | Ga0207696_1002705 | |||
| 714 | Ga0207655_1000646 | |||
| 715 | Ga0207655_1000822 | |||
| 716 | Ga0207655_1001110 | |||
| 717 | Ga0207713_1002154 | |||
| 718 | Ga0207713_1008819 | |||
| 719 | Ga0207713_1023376 | |||
| 720 | Ga0207710_10000009 | |||
| 721 | Ga0207680_10145788 | |||
| 722 | Ga0207647_10000269 | |||
| 723 | Ga0207654_10023484 | |||
| 724 | Ga0207695_10000040 | |||
| 725 | Ga0207695_10004908 | |||
| 726 | Ga0207695_10006253 | |||
| 727 | Ga0207695_10021399 | |||
| 728 | Ga0207695_10054758 | |||
| 729 | Ga0207671_10006578 | |||
| 730 | Ga0207671_10042268 | |||
| 731 | Ga0207671_10081813 | |||
| 732 | Ga0207649_10071702 | |||
| 733 | Ga0207681_10001205 | |||
| 734 | Ga0207694_10006754 | |||
| 735 | Ga0207694_10016455 | |||
| 736 | Ga0207694_10296854 | |||
| 737 | Ga0207650_10248764 | |||
| 738 | Ga0207706_10003257 | |||
| 739 | Ga0207709_10000001 | |||
| 740 | Ga0207709_10000143 | |||
| 741 | Ga0207711_10080412 | |||
| 742 | Ga0207689_10251638 | |||
| 743 | Ga0207667_10074390 | |||
| 744 | Ga0207667_10135978 | |||
| 745 | Ga0207712_10000364 | |||
| 746 | Ga0207658_10001525 | |||
| 747 | Ga0207677_10134254 | |||
| 748 | Ga0207703_10002227 | |||
| 749 | Ga0207639_10000308 | |||
| 750 | Ga0207639_10005209 | |||
| 751 | Ga0207678_10006904 | |||
| 752 | Ga0207702_10016777 | |||
| 753 | Ga0207648_10029800 | |||
| 754 | Ga0207648_10076713 | |||
| 755 | Ga0207674_10054318 | |||
| 756 | Ga0207683_10017243 | |||
| 757 | Ga0207698_10009909 | |||
| 758 | Ga0209281_1000017 | |||
| 759 | Ga0209281_1003314 | |||
| 760 | Ga0209389_1000013 | |||
| 761 | Ga0209371_1000040 | |||
| 762 | Ga0209371_1000095 | |||
| 763 | Ga0209971_1009826 | |||
| 764 | Ga0268266_10000008 | |||
| 765 | Ga0268264_10040409 | |||
| 766 | Ga0268256_1000041 | |||
| 767 | Ga0268256_1000116 | |||
| 768 | Ga0316176_1172566 | |||
| 769 | Ga0265327_10001037 | |||
| 770 | Ga0265316_10042875 | |||
| 771 | Ga0307408_100002587 | |||
| 772 | Ga0307508_10052854 | |||
| 773 | Ga0265314_10019230 | |||
| 774 | Ga0307412_10064926 | |||
| 775 | Ga0307414_10004927 | |||
| 776 | Ga0373937_0029112 | |||
| 777 | Ga0395899_0038892 | |||
| 778 | Ga0395905_0016308 | |||
| 779 | Ga0395905_0085602 | |||
| 780 | Ga0436361_0010019 | |||
| 781 | Ga0436361_0915026 | |||
| 782 | Ga0439466_0036358 | |||
| 783 | Ga0439432_007006 | |||
| 784 | Ga0450904_000075 | |||
| 785 | Ga0450905_006046 | |||
| 786 | Ga0495617_000002 | |||
| 787 | Ga0495617_000041 | |||
| 788 | Ga0495627_000007 | |||
| 789 | Ga0495627_002837 | |||
| 790 | Ga0495627_006326 | |||
| 791 | Ga0495603_0010538 | |||
| 792 | Ga0495590_0000025 | |||
| 793 | Ga0495590_0002397 | |||
| 794 | Ga0495591_004009 | |||
| 795 | Ga0495591_010207 | |||
| 796 | Ga0495638_0000711 | |||
| 797 | Ga0495638_0010587 | |||
| 798 | Ga0495638_0018141 | |||
| 799 | Ga0495638_0044745 | |||
| 800 | Ga0495638_0047547 | |||
| 801 | Ga0495653_0025046 | |||
| 802 | Ga0495650_0000156 | |||
| 803 | Ga0495650_0017029 | |||
| 804 | Ga0495580_0023251 | |||
| 805 | Ga0495580_0027938 | |||
| 806 | Ga0495582_0011407 | |||
| 807 | Ga0495582_0027916 | |||
| 808 | Ga0495582_0033012 | |||
| 809 | Ga0495605_0005636 | |||
| 810 | Ga0495605_0006745 | |||
| 811 | Ga0495639_0022458 | |||
| 812 | Ga0495584_0000238 | |||
| 813 | Ga0495584_0009414 | |||
| 814 | Ga0495584_0014400 | |||
| 815 | Ga0495584_0036003 | |||
| 816 | Ga0495585_0000812 | |||
| 817 | Ga0495585_0000946 | |||
| 818 | Ga0495585_0002065 | |||
| 819 | Ga0495585_0036784 | |||
| 820 | Ga0495585_0107215 | |||
| 821 | Ga0495594_0007313 | |||
| 822 | Ga0495596_0002512 | |||
| 823 | Ga0495596_0005819 | |||
| 824 | Ga0495596_0006752 | |||
| 825 | Ga0495596_0007102 | |||
| 826 | Ga0495596_0008228 | |||
| 827 | Ga0495596_0024858 | |||
| 828 | Ga0495607_0000811 | |||
| 829 | Ga0495607_0011620 | |||
| 830 | Ga0495583_0000520 | |||
| 831 | Ga0495583_0006505 | |||
| 832 | Ga0495583_0010415 | |||
| 833 | Ga0495606_0000777 | |||
| 834 | Ga0495606_0005924 | |||
| 835 | Ga0495606_0051981 | |||
| 836 | Ga0495610_0000003 | |||
| 837 | Ga0495610_0001963 | |||
| 838 | Ga0495610_0004467 | |||
| 839 | Ga0495610_0004537 | |||
| 840 | Ga0495610_0005886 | |||
| 841 | Ga0495616_0004348 | |||
| 842 | Ga0495616_0035503 | |||
| 843 | Ga0495616_0062265 | |||
| 844 | Ga0495630_0027991 | |||
| 845 | Ga0495631_0000128 | |||
| 846 | Ga0495631_0000871 | |||
| 847 | Ga0495631_0006308 | |||
| 848 | Ga0495631_0006728 | |||
| 849 | Ga0495631_0008825 | |||
| 850 | Ga0495631_0014922 | |||
| 851 | Ga0495631_0058772 | |||
| 852 | Ga0495632_0000068 | |||
| 853 | Ga0495632_0003587 | |||
| 854 | Ga0495632_0045572 | |||
| 855 | Ga0495637_0000019 | |||
| 856 | Ga0495643_0000123 | |||
| 857 | Ga0495643_0000612 | |||
| 858 | Ga0495643_0010698 | |||
| 859 | Ga0495643_0011229 | |||
| 860 | Ga0495643_0027735 | |||
| 861 | Ga0495643_0080484 | |||
| 862 | Ga0495644_0003419 | |||
| 863 | Ga0495644_0021512 | |||
| 864 | Ga0495648_0000193 | |||
| 865 | Ga0495648_0001612 | |||
| 866 | Ga0495648_0009406 | |||
| 867 | Ga0495648_0010068 | |||
| 868 | Ga0495648_0027319 | |||
| 869 | Ga0495663_0002101 | |||
| 870 | Ga0495666_0094449 | |||
| 871 | Ga0495642_0002275 | |||
| 872 | Ga0495642_0002852 | |||
| 873 | Ga0495642_0004437 | |||
| 874 | Ga0495642_0006340 | |||
| 875 | Ga0495642_0009593 | |||
| 876 | Ga0495654_0004469 | |||
| 877 | Ga0495654_0005433 | |||
| 878 | Ga0495654_0006835 | |||
| 879 | Ga0495654_0009350 | |||
| 880 | Ga0495654_0014693 | |||
| 881 | Ga0495609_0000380 | |||
| 882 | Ga0495609_0002456 | |||
| 883 | Ga0495609_0003906 | |||
| 884 | Ga0495609_0081175 | |||
| 885 | Ga0495597_0000067 | |||
| 886 | Ga0495597_0000738 | |||
| 887 | Ga0495597_0001580 | |||
| 888 | Ga0495597_0002866 | |||
| 889 | Ga0495597_0004500 | |||
| 890 | Ga0495597_0085746 | |||
| 891 | Ga0495633_0000528 | |||
| 892 | Ga0495633_0001592 | |||
| 893 | Ga0495633_0003379 | |||
| 894 | Ga0495633_0004064 | |||
| 895 | Ga0495633_0004095 | |||
| 896 | Ga0495633_0006212 | |||
| 897 | Ga0495633_0037345 | |||
| 898 | Ga0495668_0000001 | |||
| 899 | Ga0495668_0000718 | |||
| 900 | Ga0495668_0002188 | |||
| 901 | Ga0495668_0005410 | |||
| 902 | Ga0495668_0006070 | |||
| 903 | Ga0495668_0010723 | |||
| 904 | Ga0495668_0017490 | |||
| 905 | Ga0495668_0030721 | |||
| 906 | Ga0495634_0070630 | |||
| 907 | Ga0495611_0000724 | |||
| 908 | Ga0495611_0008372 | |||
| 909 | Ga0495611_0017878 | |||
| 910 | Ga0495611_0037631 | |||
| 911 | Ga0495625_0003436 | |||
| 912 | Ga0495625_0006578 | |||
| 913 | Ga0495625_0016791 | |||
| 914 | Ga0495625_0019641 | |||
| 915 | Ga0495625_0020788 | |||
| 916 | Ga0495659_0041617 | |||
| 917 | Ga0495661_0000602 | |||
| 918 | Ga0495661_0001847 | |||
| 919 | Ga0495661_0047386 | |||
| 920 | Ga0495661_0083799 | |||
| 921 | Ga0495623_0003901 | |||
| 922 | Ga0495658_0033448 | |||
| 923 | Ga0495669_0001110 | |||
| 924 | Ga0495669_0002499 | |||
| 925 | Ga0495669_0008965 | |||
| 926 | Ga0495669_0009574 | |||
| 927 | Ga0495669_0039753 | |||
| 928 | Ga0495613_0022795 | |||
| 929 | Ga0495670_0004077 | |||
| 930 | Ga0495670_0074271 | |||
| 931 | Ga0495671_0000001 | |||
| 932 | Ga0495671_0000331 | |||
| 933 | Ga0495671_0004188 | |||
| 934 | Ga0495671_0004504 | |||
| 935 | Ga0495671_0005746 | |||
| 936 | Ga0495671_0007451 | |||
| 937 | Ga0495671_0049342 | |||
| 938 | Ga0495649_0000196 | |||
| 939 | Ga0495649_0041514 | |||
| 940 | Ga0495589_0000079 | |||
| 941 | Ga0495589_0012412 | |||
| 942 | Ga0495589_0039330 | |||
| 943 | Ga0495660_0000496 | |||
| 944 | Ga0495660_0003195 | |||
| 945 | Ga0495660_0004248 | |||
| 946 | Ga0495660_0005828 | |||
| 947 | Ga0495660_0006150 | |||
| 948 | Ga0495660_0007544 | |||
| 949 | Ga0495660_0012326 | |||
| 950 | Ga0495581_0010853 | |||
| 951 | Ga0495604_0011550 | |||
| 952 | Ga0495604_0017522 | |||
| 953 | Ga0495672_0000006 | |||
| 954 | Ga0495672_0000041 | |||
| 955 | Ga0495672_0000429 | |||
| 956 | Ga0495672_0006417 | |||
| 957 | Ga0495672_0016377 | |||
| 958 | Ga0495676_0000092 | |||
| 959 | Ga0495683_0001072 | |||
| 960 | Ga0495683_0011492 | |||
| 961 | Ga0495683_0097806 | |||
| 962 | Ga0495687_000133 | |||
| 963 | Ga0495687_000537 | |||
| 964 | Ga0495687_011570 | |||
| 965 | Ga0495675_0004233 | |||
| 966 | Ga0495677_0000367 | |||
| 967 | Ga0495677_0001844 | |||
| 968 | Ga0495677_0011833 | |||
| 969 | Ga0495677_0030502 | |||
| 970 | Ga0495679_013486 | |||
| 971 | Ga0495679_030806 | |||
| 972 | Ga0495679_032135 | |||
| 973 | Ga0495685_001039 | |||
| 974 | Ga0495685_022108 | |||
| 975 | Ga0495673_0000016 | |||
| 976 | Ga0495681_0002000 | |||
| 977 | Ga0495681_0006542 | |||
| 978 | Ga0495681_0011916 | |||
| 979 | Ga0495686_0000006 | |||
| 980 | Ga0495686_0000279 | |||
| 981 | Ga0495686_0000479 | |||
| 982 | Ga0495686_0001600 | |||
| 983 | Ga0495686_0002005 | |||
| 984 | Ga0495686_0019374 | |||
| 985 | Ga0495614_0002457 | |||
| 986 | Ga0495626_0004630 | |||
| 987 | Ga0495626_0005307 | |||
| 988 | Ga0495626_0009099 | |||
| 989 | Ga0496101_0063990 | |||
| 990 | Ga0496102_0178071 | |||
| 991 | Ga0496103_0073604 | |||
| 992 | Ga0496104_0000005 | |||
| 993 | Ga0496104_0000039 | |||
| 994 | Ga0496104_0162562 | |||
| 995 | Ga0496105_0000084 | |||
| 996 | Ga0496105_0138863 | |||
| 997 | Ga0496107_0126992 | |||
| 998 | Ga0496110_0014675 | |||
| 999 | Ga0496111_0243464 | |||
| 1000 | Ga0496112_0183096 | |||
| 1001 | Ga0496115_0000002 | |||
| 1002 | Ga0496115_0001466 | |||
| 1003 | Ga0496116_0006867 | |||
| 1004 | Ga0496116_0050117 | |||
| 1005 | Ga0496117_0000065 | |||
| 1006 | Ga0496117_0000132 | |||
| 1007 | Ga0496117_0005145 | |||
| 1008 | Ga0496117_0005767 | |||
| 1009 | Ga0496118_0000033 | |||
| 1010 | Ga0496118_0000099 | |||
| 1011 | Ga0496118_0001414 | |||
| 1012 | Ga0496118_0002596 | |||
| 1013 | Ga0496118_0012948 | |||
| 1014 | Ga0496118_0019844 | |||
| 1015 | Ga0496119_0000632 | |||
| 1016 | Ga0496120_0000204 | |||
| 1017 | Ga0496121_0010790 | |||
| 1018 | Ga0496121_0014412 | |||
| 1019 | Ga0496121_0016990 | |||
| 1020 | Ga0496121_0020731 | |||
| 1021 | Ga0496121_0022148 | |||
| 1022 | Ga0496121_0036345 | |||
| 1023 | Ga0496121_0064268 | |||
| 1024 | Ga0496122_0000988 | |||
| 1025 | Ga0496122_0004429 | |||
| 1026 | Ga0496122_0006616 | |||
| 1027 | Ga0496122_0007439 | |||
| 1028 | Ga0496122_0008475 | |||
| 1029 | Ga0496122_0022864 | |||
| 1030 | Ga0496122_0029656 | |||
| 1031 | Ga0496122_0080849 | |||
| 1032 | Ga0496123_0000198 | |||
| 1033 | Ga0496123_0002480 | |||
| 1034 | Ga0496123_0005655 | |||
| 1035 | Ga0496123_0009138 | |||
| 1036 | Ga0496123_0010362 | |||
| 1037 | Ga0496123_0010932 | |||
| 1038 | Ga0496123_0016750 | |||
| 1039 | Ga0496124_0000056 | |||
| 1040 | Ga0496124_0003538 | |||
| 1041 | Ga0496124_0010857 | |||
| 1042 | Ga0496124_0010977 | |||
| 1043 | Ga0496124_0012500 | |||
| 1044 | Ga0496124_0065735 | |||
| 1045 | Ga0496124_0094045 | |||
| 1046 | Ga0496124_0145162 | |||
| 1047 | Ga0496125_0000132 | |||
| 1048 | Ga0496125_0001680 | |||
| 1049 | Ga0496125_0007623 | |||
| 1050 | Ga0496125_0009473 | |||
| 1051 | Ga0496125_0016718 | |||
| 1052 | Ga0496125_0018243 | |||
| 1053 | Ga0496125_0099301 | |||
| 1054 | Ga0496126_0000052 | |||
| 1055 | Ga0496126_0000331 | |||
| 1056 | Ga0496126_0010423 | |||
| 1057 | Ga0496126_0019753 | |||
| 1058 | Ga0495678_000004 | |||
| 1059 | Ga0495678_000070 | |||
| 1060 | Ga0495678_000105 | |||
| 1061 | Ga0495678_000313 | |||
| 1062 | Ga0495678_001671 | |||
| 1063 | Ga0495678_001884 | |||
| 1064 | Ga0495682_0001637 | |||
| 1065 | Ga0495682_0003245 | |||
| 1066 | Ga0495682_0022451 | |||
| 1067 | Ga0501031_0015989 | |||
| 1068 | Ga0501031_0018350 | |||
| 1069 | Ga0501032_0032701 | |||
| 1070 | Ga0501032_0036064 | |||
| 1071 | Ga0501033_0035695 | |||
| 1072 | Ga0501034_0000045 | |||
| 1073 | Ga0501034_0002724 | |||
| 1074 | Ga0501036_0003405 | |||
| 1075 | Ga0501037_0002556 | |||
| 1076 | Ga0501038_0004389 | |||
| 1077 | Ga0501043_0001464 | |||
| 1078 | Ga0501043_0075041 | |||
| 1079 | Ga0501046_0000106 | |||
| 1080 | Ga0501047_0000523 | |||
| 1081 | Ga0501047_0371817 | |||
| 1082 | Ga0501073_0000737 | |||
| 1083 | Ga0501080_0011421 | |||
| 1084 | Ga0501035_0038098 | |||
| 1085 | Ga0501035_0212616 | |||
| 1086 | nmdc:mga03683_818_c1 | |||
| 1087 | nmdc:mga00v17_129_c1 | |||
| 1088 | nmdc:mga00v17_5685_c1 | |||
| 1089 | nmdc:mga00v17_7470_c1 | |||
| 1090 | nmdc:mga0yw44_33685_c1 | |||
| 1091 | nmdc:mga0k408_10692_c1 | |||
| 1092 | Ga0500659_0002064 | |||
| 1093 | Ga0500586_000049 | |||
| 1094 | Ga0500586_000607 | |||
| 1095 | 2939634047 | |||
| 1096 | 2511377173 | |||
| 1097 | 2524610071 | |||
| 1098 | 2552746404 | |||
| 1099 | 2578458334 | |||
| 1100 | 2595315420 | |||
| 1101 | 2601670122 | |||
| 1102 | 2640733360 | |||
| 1103 | 2643834152 | |||
| 1104 | 2644031374 | |||
| 1105 | 2644055078 | |||
| 1106 | 2644251152 | |||
| 1107 | 2644354667 | |||
| 1108 | 2673821575 | |||
| 1109 | 2678230392 | |||
| 1110 | 2722881621 | |||
| 1111 | 2738716923 | |||
| 1112 | 2738739862 | |||
| 1113 | 2738829214 | |||
| 1114 | 2738844356 | |||
| 1115 | 2739153010 | |||
| 1116 | 2739194930 | |||
| 1117 | 2739274084 | |||
| 1118 | 2739321406 | |||
| 1119 | 2739340038 | |||
| 1120 | 2739343128 | |||
| 1121 | 2745161370 | |||
| 1122 | 2765584723 | |||
| 1123 | 2774389052 | |||
| 1124 | 2774439251 | |||
| 1125 | 2809146698 | |||
| 1126 | 2839144374 | |||
| 1127 | 2842717779 | |||
| 1128 | 2852650672 | |||
| 1129 | 2857443413 | |||
| 1130 | 2857552901 | |||
| 1131 | 2857554449 | |||
| 1132 | 2857576101 | |||
| 1133 | 2884218647 | |||
| 1134 | 2885081559 | |||
| 1135 | 2889049836 | |||
| 1136 | 2894024776 | |||
| 1137 | 2916701747 | |||
| 1138 | 2919185312 | |||
| 1139 | 2919514719 | |||
| 1140 | 2919676764 | |||
| 1141 | 2932413632 | |||
| 1142 | 2932417692 | |||
| 1143 | 2939591741 | |||
| 1144 | 2939623670 | |||
| 1145 | 2941475942 | |||
| 1146 | 2974308731 | |||
| 1147 | 2977249467 | |||
| 1148 | 2984516062 | |||
| 1149 | 2984572486 | |||
| 1150 | 3007319743 | |||
| 1151 | 8052496528 | |||
| 1152 | 8054930408 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kki-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation | 0.8508 | 23 | 398 |
| 6kkl-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) | 0.8424 | 23 | 398 |
| 8hpk-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form | 0.8387 | 20 | 406 |
| 6kki-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation | 0.8293 | 23 | 398 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8266 | 26 | 398 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52067_222_406_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9936 | 221 | 401 | 1.20.1250.20 |
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9793 | 22 | 206 | 1.20.1250.20 |
| af_P52067_222_406_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.967 | 221 | 401 | 1.20.1250.20 |
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.949 | 22 | 206 | 1.20.1250.20 |
| af_Q01818_292_487_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9245 | 26 | 198 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T5Y5H1-F1-model_v4 | deleted | 0.9761 | 24 | 403 |
|
| AF-A0A3A9JEU6-F1-model_v4 | MFS transporter | 0.9752 | 24 | 405 |
GO:0005886
GO:0022857 |
| AF-R7H0R1-F1-model_v4 | Fosmidomycin resistance protein | 0.9725 | 24 | 400 |
GO:0005886
GO:0022857 |
| AF-A0A0M8MHA8-F1-model_v4 | Fosmidomycin resistance protein | 0.9719 | 24 | 401 |
GO:0005886
GO:0022857 |
| AF-W0Q9S4-F1-model_v4 | Antibiotic MFS transporter | 0.9697 | 24 | 400 |
GO:0005886
GO:0022857 |