F465595

General Info

Members Datasets Scaffolds Average Seq Length
577 223 572 322

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100138337|Ga0068862_1001383372
Length 361
Sequence LLAKVREGSYEKVNFRKRPFRARGLSLLLVMKVYRSIEQLPPFRNAVITIGTFDGVHEGHRKIIAHLKQEAEVINGETVIITFHPHPRKVVSSPILGIRLINTLDEKIELLRDAGIDHLVIIPFTEVFANQSAEDYIQDFLIKNFHPHTIITGYDHRFGKDRLGDYRLLEKMAPVLNYVLKEIPKHVLDEIAISSTNIREAIIHSDIETANKLLGYDFFFEGTVVDGDKLGRKLGYPTANLKMTDEEKIVLGNGIYAVYVETASGKSKEAREESTSHNTSXSPFTXXXXPYKGMMSIGFRPTVDGKKKVIEVNIFDFDNEIYGETIRVYVKKYLRPEIKFNDLDELVKQIDQDKIESLKVL

Samples

Sample ID Description Type Environment
1 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
2 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
3 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
4 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
5 2914759650 Rhizosphaericola mali Isolate Rhizosphere
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
183 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
205 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0
Rhizoplane 1.04
Rhizosphere 94.11
Stem 0
Stem Tuber 0
Unclassified 1.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1002612 3300000545 Bacteria 1254
2 JGI24740J21852_10021588 3300001979 Bacteria 2230
3 JGI24739J22299_10001051 3300001989 Bacteria 10260
4 JGI25406J46586_10004023 3300003203 Bacteria 6878
5 rootH2_10144348 3300003320 Bacteria 3277
6 rootL2_10141763 3300003322 Bacteria 1793
7 rootL2_10270037 3300003322 Bacteria 1506
8 rootH1_10062595 3300003323 Bacteria 1165
9 rootH1_10070881 3300003323 Bacteria 1170
10 rootH1_10272894 3300003323 Bacteria 2400
11 JGI25160J50197_1003284 3300003354 Bacteria 7286
12 Ga0055528_1000904 3300003790 Bacteria 20018
13 Ga0055530_10000546 3300003791 Bacteria 32621
14 Ga0065165_1000725 3300005262 Bacteria 46083
15 Ga0065712_10001839 3300005290 Bacteria 5206
16 Ga0065712_10002727 3300005290 Bacteria 5996
17 Ga0065712_10099709 3300005290 Bacteria 2074
18 Ga0065715_10001847 3300005293 Bacteria 5490
19 Ga0065715_10199576 3300005293 Bacteria 1369
20 Ga0065707_10112608 3300005295 Bacteria 2355
21 Ga0070658_10350387 3300005327 Bacteria 1264
22 Ga0070683_100004984 3300005329 Bacteria 11025
23 Ga0070683_100017759 3300005329 Bacteria 6286
24 Ga0070683_100033936 3300005329 Bacteria 4657
25 Ga0070690_100009378 3300005330 Bacteria 5668
26 Ga0070670_100027116 3300005331 Bacteria 4927
27 Ga0070670_100089346 3300005331 Bacteria 2648
28 Ga0070670_100094363 3300005331 Bacteria 2573
29 Ga0070670_100165707 3300005331 Bacteria 1916
30 Ga0070670_100172272 3300005331 Bacteria 1877
31 Ga0070670_100194957 3300005331 Bacteria 1760
32 Ga0070670_100200101 3300005331 Bacteria 1736
33 Ga0070670_100267079 3300005331 Bacteria 1492
34 Ga0070670_100355711 3300005331 Bacteria 1287
35 Ga0070677_10141132 3300005333 Unclassified 1111
36 Ga0068869_100001176 3300005334 Bacteria 15356
37 Ga0068869_100006720 3300005334 Bacteria 7310
38 Ga0068869_100007688 3300005334 Bacteria 6904
39 Ga0068869_100016653 3300005334 Bacteria 4958
40 Ga0068869_100022268 3300005334 Bacteria 4365
41 Ga0068869_100255719 3300005334 Unclassified 1400
42 Ga0068869_100290299 3300005334 Bacteria 1318
43 Ga0070666_10017969 3300005335 Unclassified 4539
44 Ga0070666_10038981 3300005335 Bacteria 3164
45 Ga0070666_10104906 3300005335 Bacteria 1952
46 Ga0070682_100000530 3300005337 Bacteria 23808
47 Ga0070682_100252221 3300005337 Unclassified 1273
48 Ga0068868_100024837 3300005338 Bacteria 4550
49 Ga0068868_100065160 3300005338 Bacteria 2893
50 Ga0068868_100216039 3300005338 Bacteria 1604
51 Ga0070660_100271912 3300005339 Bacteria 1385
52 Ga0070689_100005879 3300005340 Bacteria 8432
53 Ga0070689_100053077 3300005340 Bacteria 3136
54 Ga0070689_100196397 3300005340 Bacteria 1645
55 Ga0070687_100103037 3300005343 Bacteria 1601
56 Ga0070661_100002662 3300005344 Bacteria 12227
57 Ga0070661_100003501 3300005344 Bacteria 10809
58 Ga0070661_100043761 3300005344 Bacteria 3271
59 Ga0070661_100121194 3300005344 Unclassified 1959
60 Ga0070668_100036860 3300005347 Bacteria 3732
61 Ga0070669_100017184 3300005353 Bacteria 5161
62 Ga0070669_100055302 3300005353 Bacteria 2908
63 Ga0070669_100124918 3300005353 Unclassified 1968
64 Ga0070669_100178639 3300005353 Bacteria 1659
65 Ga0070675_100069146 3300005354 Bacteria 2925
66 Ga0070675_100072978 3300005354 Bacteria 2849
67 Ga0070675_100094358 3300005354 Bacteria 2510
68 Ga0070675_100096378 3300005354 Bacteria 2485
69 Ga0070671_100012652 3300005355 Bacteria 6801
70 Ga0070671_100021831 3300005355 Bacteria 5228
71 Ga0070671_100119731 3300005355 Bacteria 2215
72 Ga0070674_100045639 3300005356 Bacteria 2994
73 Ga0070674_100077231 3300005356 Bacteria 2370
74 Ga0070673_100007991 3300005364 Bacteria 7008
75 Ga0070673_100060057 3300005364 Bacteria 3011
76 Ga0070673_100107882 3300005364 Unclassified 2304
77 Ga0070673_100301207 3300005364 Bacteria 1411
78 Ga0070688_100001664 3300005365 Bacteria 11122
79 Ga0070688_100017095 3300005365 Bacteria 4160
80 Ga0070688_100107249 3300005365 Bacteria 1851
81 Ga0070659_100014169 3300005366 Bacteria 5952
82 Ga0070659_100024593 3300005366 Bacteria 4617
83 Ga0070659_100044464 3300005366 Bacteria 3477
84 Ga0070659_100416570 3300005366 Unclassified 1136
85 Ga0070667_100005481 3300005367 Bacteria 10593
86 Ga0070667_100071916 3300005367 Bacteria 2946
87 Ga0070667_100079871 3300005367 Unclassified 2797
88 Ga0070667_100319218 3300005367 Bacteria 1401
89 Ga0070662_100006736 3300005457 Bacteria 7426
90 Ga0070662_100025381 3300005457 Unclassified 4091
91 Ga0070662_100025769 3300005457 Bacteria 4065
92 Ga0070662_100065336 3300005457 Bacteria 2667
93 Ga0070681_10150592 3300005458 Bacteria 2253
94 Ga0070681_10265363 3300005458 Bacteria 1628
95 Ga0068867_100027826 3300005459 Bacteria 4066
96 Ga0068867_100115299 3300005459 Bacteria 2069
97 Ga0068867_100170625 3300005459 Bacteria 1723
98 Ga0068867_100274013 3300005459 Bacteria 1381
99 Ga0068867_100322849 3300005459 Bacteria 1280
100 Ga0070685_10003936 3300005466 Bacteria 7503
101 Ga0070685_10083777 3300005466 Unclassified 1916
102 Ga0070698_100036456 3300005471 Bacteria 5079
103 Ga0070698_100038004 3300005471 Bacteria 4961
104 Ga0070679_100025468 3300005530 Bacteria 5805
105 Ga0070679_100227795 3300005530 Bacteria 1823
106 Ga0070684_100003098 3300005535 Bacteria 12410
107 Ga0070684_100008197 3300005535 Bacteria 8163
108 Ga0070684_100011744 3300005535 Bacteria 6985
109 Ga0070684_100022746 3300005535 Bacteria 5233
110 Ga0070684_100153418 3300005535 Bacteria 2088
111 Ga0070684_100187552 3300005535 Bacteria 1881
112 Ga0070684_100349442 3300005535 Bacteria 1360
113 Ga0068853_100000201 3300005539 Bacteria 41960
114 Ga0068853_100013079 3300005539 Bacteria 6769
115 Ga0068853_100038706 3300005539 Unclassified 4063
116 Ga0068853_100076147 3300005539 Bacteria 2929
117 Ga0068853_100193396 3300005539 Bacteria 1849
118 Ga0068853_100210948 3300005539 Unclassified 1770
119 Ga0070672_100014038 3300005543 Bacteria 5667
120 Ga0070672_100052949 3300005543 Bacteria 3171
121 Ga0070686_100034662 3300005544 Bacteria 3112
122 Ga0070704_100381696 3300005549 Bacteria 1197
123 Ga0068855_100002958 3300005563 Bacteria 20766
124 Ga0068855_100426474 3300005563 Unclassified 1450
125 Ga0068855_100610986 3300005563 Bacteria 1175
126 Ga0070664_100008104 3300005564 Bacteria 8492
127 Ga0070664_100011095 3300005564 Bacteria 7307
128 Ga0070664_100023111 3300005564 Bacteria 5132
129 Ga0070664_100136622 3300005564 Bacteria 2156
130 Ga0070664_100322969 3300005564 Bacteria 1399
131 Ga0070664_100459566 3300005564 Bacteria 1170
132 Ga0068857_100065357 3300005577 Unclassified 3234
133 Ga0068857_100066487 3300005577 Bacteria 3207
134 Ga0068857_100078978 3300005577 Bacteria 2937
135 Ga0068857_100085154 3300005577 Bacteria 2825
136 Ga0068857_100197365 3300005577 Bacteria 1834
137 Ga0068854_100026904 3300005578 Unclassified 3958
138 Ga0068854_100151946 3300005578 Bacteria 1786
139 Ga0068856_100255724 3300005614 Bacteria 1766
140 Ga0068852_100005706 3300005616 Bacteria 8928
141 Ga0068852_100035194 3300005616 Bacteria 4174
142 Ga0068852_100036183 3300005616 Unclassified 4128
143 Ga0068852_100036244 3300005616 Bacteria 4125
144 Ga0068852_100072214 3300005616 Bacteria 3033
145 Ga0068852_100182227 3300005616 Bacteria 1976
146 Ga0068852_100227132 3300005616 Bacteria 1778
147 Ga0068852_100323124 3300005616 Unclassified 1499
148 Ga0068859_100002930 3300005617 Bacteria 17331
149 Ga0068859_100015332 3300005617 Bacteria 7698
150 Ga0068859_100016969 3300005617 Bacteria 7308
151 Ga0068859_100090245 3300005617 Bacteria 3115
152 Ga0068859_100109829 3300005617 Bacteria 2819
153 Ga0068859_100320510 3300005617 Unclassified 1644
154 Ga0068859_100391553 3300005617 Bacteria 1485
155 Ga0068859_100418455 3300005617 Bacteria 1436
156 Ga0068864_100005892 3300005618 Bacteria 10045
157 Ga0068864_100040086 3300005618 Bacteria 4006
158 Ga0068864_100041065 3300005618 Bacteria 3957
159 Ga0068864_100391985 3300005618 Bacteria 1318
160 Ga0068866_10020651 3300005718 Unclassified 3021
161 Ga0068861_100001097 3300005719 Bacteria 16748
162 Ga0068861_100317677 3300005719 Bacteria 1355
163 Ga0068851_10061098 3300005834 Bacteria 1931
164 Ga0068851_10125335 3300005834 Bacteria 1384
165 Ga0068870_10006551 3300005840 Bacteria 5137
166 Ga0068870_10026129 3300005840 Bacteria 2908
167 Ga0068870_10084705 3300005840 Unclassified 1760
168 Ga0068863_100137942 3300005841 Bacteria 2330
169 Ga0068863_100144024 3300005841 Bacteria 2279
170 Ga0068863_100241039 3300005841 Bacteria 1745
171 Ga0068863_100265190 3300005841 Bacteria 1661
172 Ga0068863_100381953 3300005841 Bacteria 1375
173 Ga0068858_100042146 3300005842 Unclassified 4233
174 Ga0068858_100223204 3300005842 Bacteria 1785
175 Ga0068858_100506057 3300005842 Bacteria 1167
176 Ga0068860_100008600 3300005843 Bacteria 10177
177 Ga0068860_100092990 3300005843 Bacteria 2874
178 Ga0068860_100106598 3300005843 Bacteria 2677
179 Ga0068860_100127794 3300005843 Unclassified 2436
180 Ga0068862_100013234 3300005844 Bacteria 6824
181 Ga0068862_100019125 3300005844 Bacteria 5711
182 Ga0068862_100138337 3300005844 Bacteria 2160
183 Ga0068862_100202447 3300005844 Bacteria 1791
184 Ga0068862_100214170 3300005844 Bacteria 1741
185 Ga0068862_100428146 3300005844 Bacteria 1243
186 Ga0081539_10000885 3300005985 Bacteria 57257
187 Ga0081539_10047345 3300005985 Bacteria 2456
188 Ga0075366_10011979 3300006195 Bacteria 4911
189 Ga0097621_100000027 3300006237 Bacteria 71873
190 Ga0097621_100107861 3300006237 Bacteria 2350
191 Ga0097621_100448995 3300006237 Unclassified 1161
192 Ga0097621_100524620 3300006237 Unclassified 1075
193 Ga0068871_100000107 3300006358 Bacteria 50575
194 Ga0068871_100050973 3300006358 Bacteria 3350
195 Ga0068871_100062854 3300006358 Unclassified 3035
196 Ga0068871_100109321 3300006358 Unclassified 2324
197 Ga0068871_100447107 3300006358 Unclassified 1158
198 Ga0075428_100011686 3300006844 Bacteria 9771
199 Ga0075428_100182477 3300006844 Bacteria 2271
200 Ga0075428_100529151 3300006844 Bacteria 1261
201 Ga0075430_100166075 3300006846 Bacteria 1836
202 Ga0075431_100022672 3300006847 Bacteria 6419
203 Ga0075429_100004950 3300006880 Bacteria 11474
204 Ga0075429_100033563 3300006880 Bacteria 4460
205 Ga0068865_100076124 3300006881 Bacteria 2394
206 Ga0068865_100394360 3300006881 Bacteria 1132
207 Ga0097620_100002930 3300006931 Bacteria 17331
208 Ga0097620_100015332 3300006931 Bacteria 7698
209 Ga0097620_100016969 3300006931 Bacteria 7308
210 Ga0097620_100090242 3300006931 Bacteria 3115
211 Ga0097620_100109831 3300006931 Bacteria 2819
212 Ga0097620_100320543 3300006931 Unclassified 1644
213 Ga0097620_100391562 3300006931 Bacteria 1485
214 Ga0097620_100418432 3300006931 Bacteria 1436
215 Ga0105240_10000715 3300009093 Bacteria 60725
216 Ga0105240_10001801 3300009093 Bacteria 36072
217 Ga0105240_10003107 3300009093 Bacteria 26115
218 Ga0105240_10065737 3300009093 Unclassified 4501
219 Ga0111539_10005231 3300009094 Bacteria 16809
220 Ga0111539_10788776 3300009094 Unclassified 1106
221 Ga0105241_10017098 3300009174 Bacteria 5326
222 Ga0105241_10037087 3300009174 Bacteria 3672
223 Ga0105241_10214768 3300009174 Unclassified 1613
224 Ga0105241_10345312 3300009174 Bacteria 1291
225 Ga0105242_10050519 3300009176 Bacteria 3386
226 Ga0105242_10063027 3300009176 Bacteria 3053
227 Ga0105242_10104147 3300009176 Unclassified 2408
228 Ga0105242_10239016 3300009176 Unclassified 1632
229 Ga0105242_10265205 3300009176 Bacteria 1553
230 Ga0105248_10038219 3300009177 Bacteria 5371
231 Ga0105248_10539004 3300009177 Bacteria 1316
232 Ga0105237_10003306 3300009545 Bacteria 19208
233 Ga0105237_10006269 3300009545 Bacteria 13232
234 Ga0105237_10032139 3300009545 Bacteria 5314
235 Ga0105237_10035230 3300009545 Bacteria 5066
236 Ga0105249_10002821 3300009553 Bacteria 14998
237 Ga0105249_10007683 3300009553 Bacteria 9397
238 Ga0105249_10011560 3300009553 Bacteria 7757
239 Ga0105249_10026124 3300009553 Bacteria 5259
240 Ga0105249_10318462 3300009553 Unclassified 1566
241 Ga0105249_10489185 3300009553 Bacteria 1274
242 Ga0105239_10000591 3300010375 Bacteria 51658
243 Ga0105239_10001963 3300010375 Bacteria 26754
244 Ga0105239_10010402 3300010375 Bacteria 10409
245 Ga0105239_10104155 3300010375 Bacteria 3141
246 Ga0105239_10168505 3300010375 Unclassified 2449
247 Ga0105239_10302718 3300010375 Bacteria 1800
248 Ga0105239_10341619 3300010375 Bacteria 1689
249 Ga0105239_10364367 3300010375 Unclassified 1633
250 Ga0105246_10040932 3300011119 Bacteria 3130
251 Ga0105246_10425986 3300011119 Unclassified 1109
252 Ga0157373_10007038 3300013100 Bacteria 8383
253 Ga0157373_10024428 3300013100 Bacteria 4377
254 Ga0157373_10087546 3300013100 Bacteria 2194
255 Ga0157371_10129609 3300013102 Bacteria 1794
256 Ga0157371_10148510 3300013102 Unclassified 1671
257 Ga0157371_10236763 3300013102 Bacteria 1313
258 Ga0157370_10000405 3300013104 Bacteria 54383
259 Ga0157370_10007210 3300013104 Bacteria 12134
260 Ga0157369_10034266 3300013105 Bacteria 5574
261 Ga0157369_10054490 3300013105 Bacteria 4318
262 Ga0157369_10254108 3300013105 Bacteria 1834
263 Ga0157374_10003864 3300013296 Bacteria 12575
264 Ga0157374_10020194 3300013296 Bacteria 5908
265 Ga0157374_10021178 3300013296 Bacteria 5780
266 Ga0157374_10023165 3300013296 Bacteria 5549
267 Ga0157374_10037787 3300013296 Bacteria 4434
268 Ga0157374_10131846 3300013296 Unclassified 2419
269 Ga0157374_10148574 3300013296 Bacteria 2278
270 Ga0157374_10444142 3300013296 Bacteria 1298
271 Ga0157378_10040240 3300013297 Bacteria 4144
272 Ga0157378_10079032 3300013297 Bacteria 2969
273 Ga0157378_10113056 3300013297 Bacteria 2492
274 Ga0157378_10175409 3300013297 Bacteria 2013
275 Ga0157378_10405882 3300013297 Bacteria 1344
276 Ga0163162_10002356 3300013306 Bacteria 17749
277 Ga0163162_10004527 3300013306 Bacteria 13386
278 Ga0163162_10005339 3300013306 Bacteria 12402
279 Ga0163162_10016350 3300013306 Bacteria 7252
280 Ga0163162_10026859 3300013306 Bacteria 5693
281 Ga0163162_10030873 3300013306 Bacteria 5311
282 Ga0163162_10227566 3300013306 Unclassified 1995
283 Ga0163162_10297035 3300013306 Unclassified 1747
284 Ga0163162_10305865 3300013306 Unclassified 1722
285 Ga0163162_10494183 3300013306 Bacteria 1354
286 Ga0157372_10000666 3300013307 Bacteria 37795
287 Ga0157372_10016187 3300013307 Bacteria 8001
288 Ga0157372_10036103 3300013307 Bacteria 5446
289 Ga0157372_10052647 3300013307 Bacteria 4533
290 Ga0157372_10079562 3300013307 Unclassified 3707
291 Ga0157372_10236288 3300013307 Unclassified 2120
292 Ga0157372_10251697 3300013307 Bacteria 2051
293 Ga0157372_10311560 3300013307 Bacteria 1832
294 Ga0157372_10341964 3300013307 Bacteria 1743
295 Ga0157372_10413585 3300013307 Bacteria 1572
296 Ga0157372_10601953 3300013307 Unclassified 1281
297 Ga0157372_10807199 3300013307 Bacteria 1090
298 Ga0157375_10000336 3300013308 Bacteria 42479
299 Ga0157375_10026145 3300013308 Bacteria 5436
300 Ga0157375_10080546 3300013308 Bacteria 3295
301 Ga0157375_10945055 3300013308 Bacteria 1004
302 Ga0163163_10000193 3300014325 Bacteria 62699
303 Ga0163163_10000638 3300014325 Bacteria 30140
304 Ga0163163_10023026 3300014325 Bacteria 5906
305 Ga0163163_10085000 3300014325 Bacteria 3172
306 Ga0163163_10096374 3300014325 Unclassified 2978
307 Ga0163163_10579124 3300014325 Unclassified 1185
308 Ga0157380_10001611 3300014326 Bacteria 14871
309 Ga0157380_10093735 3300014326 Bacteria 2484
310 Ga0157380_10138567 3300014326 Bacteria 2087
311 Ga0157377_10002511 3300014745 Bacteria 8128
312 Ga0157377_10036842 3300014745 Unclassified 2692
313 Ga0157377_10070579 3300014745 Bacteria 2018
314 Ga0157377_10088490 3300014745 Bacteria 1824
315 Ga0157377_10146796 3300014745 Bacteria 1455
316 Ga0157379_10009216 3300014968 Bacteria 8596
317 Ga0157379_10219620 3300014968 Bacteria 1722
318 Ga0157376_10000885 3300014969 Bacteria 19631
319 Ga0157376_10062575 3300014969 Unclassified 3132
320 Ga0157376_10123010 3300014969 Bacteria 2303
321 Ga0157376_10200483 3300014969 Bacteria 1836
322 Ga0157376_10225317 3300014969 Bacteria 1739
323 Ga0157376_10272136 3300014969 Unclassified 1592
324 Ga0163161_10004394 3300017792 Bacteria 9832
325 Ga0163161_10034459 3300017792 Unclassified 3623
326 Ga0163161_10115469 3300017792 Bacteria 2012
327 Ga0163161_10125944 3300017792 Bacteria 1929
328 Ga0163161_10332476 3300017792 Bacteria 1204
329 Ga0213876_10005408 3300021384 Bacteria 7030
330 Ga0209673_1000194 3300025273 Bacteria 122640
331 Ga0209758_1010355 3300025297 Bacteria 5594
332 Ga0209050_1000658 3300025298 Bacteria 53407
333 Ga0207426_1000052 3300025302 Bacteria 389825
334 Ga0207426_1002176 3300025302 Bacteria 13256
335 Ga0209257_1001487 3300025304 Bacteria 27514
336 Ga0207697_10027369 3300025315 Bacteria 2331
337 Ga0207656_10032473 3300025321 Bacteria 2169
338 Ga0207682_10092343 3300025893 Unclassified 1314
339 Ga0207642_10100082 3300025899 Unclassified 1453
340 Ga0207688_10047747 3300025901 Bacteria 2391
341 Ga0207647_10000631 3300025904 Bacteria 27434
342 Ga0207647_10016689 3300025904 Bacteria 5005
343 Ga0207685_10036362 3300025905 Unclassified 1805
344 Ga0207645_10023675 3300025907 Unclassified 3987
345 Ga0207643_10002603 3300025908 Bacteria 9759
346 Ga0207707_10159040 3300025912 Bacteria 1975
347 Ga0207695_10000327 3300025913 Bacteria 113436
348 Ga0207695_10000486 3300025913 Bacteria 84856
349 Ga0207695_10000681 3300025913 Bacteria 66668
350 Ga0207695_10055862 3300025913 Bacteria 4112
351 Ga0207671_10001641 3300025914 Bacteria 25464
352 Ga0207671_10128280 3300025914 Bacteria 1945
353 Ga0207662_10032143 3300025918 Bacteria 3053
354 Ga0207649_10006490 3300025920 Bacteria 6352
355 Ga0207649_10007419 3300025920 Bacteria 5963
356 Ga0207649_10016515 3300025920 Bacteria 4166
357 Ga0207681_10023072 3300025923 Bacteria 3975
358 Ga0207650_10016642 3300025925 Bacteria 5140
359 Ga0207650_10047129 3300025925 Bacteria 3175
360 Ga0207650_10092903 3300025925 Unclassified 2309
361 Ga0207650_10229809 3300025925 Bacteria 1496
362 Ga0207650_10306783 3300025925 Bacteria 1297
363 Ga0207659_10029866 3300025926 Bacteria 3719
364 Ga0207659_10062694 3300025926 Bacteria 2684
365 Ga0207659_10118638 3300025926 Bacteria 2024
366 Ga0207644_10288773 3300025931 Bacteria 1318
367 Ga0207690_10057401 3300025932 Bacteria 2630
368 Ga0207690_10189293 3300025932 Bacteria 1555
369 Ga0207706_10010694 3300025933 Bacteria 8383
370 Ga0207706_10011827 3300025933 Bacteria 7946
371 Ga0207706_10013284 3300025933 Bacteria 7490
372 Ga0207706_10021553 3300025933 Bacteria 5784
373 Ga0207706_10114680 3300025933 Bacteria 2370
374 Ga0207686_10044032 3300025934 Bacteria 2738
375 Ga0207686_10064806 3300025934 Bacteria 2327
376 Ga0207686_10093936 3300025934 Unclassified 1987
377 Ga0207670_10015317 3300025936 Bacteria 4579
378 Ga0207670_10018966 3300025936 Bacteria 4193
379 Ga0207670_10108833 3300025936 Bacteria 1993
380 Ga0207669_10056107 3300025937 Bacteria 2390
381 Ga0207704_10170741 3300025938 Bacteria 1560
382 Ga0207704_10248697 3300025938 Bacteria 1333
383 Ga0207691_10007756 3300025940 Bacteria 10334
384 Ga0207691_10012179 3300025940 Bacteria 8246
385 Ga0207691_10155682 3300025940 Bacteria 2007
386 Ga0207689_10004331 3300025942 Bacteria 12928
387 Ga0207689_10011366 3300025942 Bacteria 7632
388 Ga0207689_10012162 3300025942 Bacteria 7365
389 Ga0207689_10030895 3300025942 Bacteria 4462
390 Ga0207689_10043516 3300025942 Bacteria 3712
391 Ga0207689_10051384 3300025942 Bacteria 3398
392 Ga0207689_10073372 3300025942 Bacteria 2811
393 Ga0207689_10101535 3300025942 Bacteria 2363
394 Ga0207689_10173821 3300025942 Bacteria 1776
395 Ga0207661_10009151 3300025944 Bacteria 7101
396 Ga0207661_10017540 3300025944 Bacteria 5300
397 Ga0207661_10017757 3300025944 Bacteria 5272
398 Ga0207661_10048477 3300025944 Bacteria 3376
399 Ga0207661_10141750 3300025944 Bacteria 2069
400 Ga0207679_10001246 3300025945 Bacteria 16165
401 Ga0207679_10004377 3300025945 Bacteria 8792
402 Ga0207679_10205330 3300025945 Bacteria 1649
403 Ga0207679_10286722 3300025945 Bacteria 1414
404 Ga0207679_10394793 3300025945 Bacteria 1216
405 Ga0207667_10000340 3300025949 Bacteria 63904
406 Ga0207667_10363910 3300025949 Bacteria 1475
407 Ga0207651_10042167 3300025960 Bacteria 3035
408 Ga0207651_10085747 3300025960 Bacteria 2286
409 Ga0207651_10292994 3300025960 Bacteria 1350
410 Ga0207712_10003851 3300025961 Bacteria 9476
411 Ga0207712_10120836 3300025961 Bacteria 1982
412 Ga0207712_10337945 3300025961 Unclassified 1248
413 Ga0207712_10364722 3300025961 Bacteria 1204
414 Ga0207668_10057234 3300025972 Bacteria 2719
415 Ga0207640_10092961 3300025981 Bacteria 2094
416 Ga0207658_10114101 3300025986 Bacteria 2142
417 Ga0207658_10163799 3300025986 Bacteria 1825
418 Ga0207677_10018590 3300026023 Unclassified 4174
419 Ga0207677_10038453 3300026023 Unclassified 3137
420 Ga0207677_10102578 3300026023 Bacteria 2110
421 Ga0207677_10217216 3300026023 Unclassified 1531
422 Ga0207703_10040068 3300026035 Unclassified 3747
423 Ga0207703_10107676 3300026035 Bacteria 2373
424 Ga0207703_10209060 3300026035 Bacteria 1739
425 Ga0207703_10410104 3300026035 Bacteria 1259
426 Ga0207639_10002892 3300026041 Bacteria 11542
427 Ga0207639_10010742 3300026041 Bacteria 6344
428 Ga0207639_10081134 3300026041 Bacteria 2568
429 Ga0207639_10253107 3300026041 Bacteria 1537
430 Ga0207678_10083692 3300026067 Bacteria 2729
431 Ga0207702_10043159 3300026078 Unclassified 3785
432 Ga0207641_10001393 3300026088 Bacteria 23812
433 Ga0207641_10087315 3300026088 Bacteria 2721
434 Ga0207641_10101689 3300026088 Bacteria 2533
435 Ga0207648_10002286 3300026089 Bacteria 20689
436 Ga0207648_10058993 3300026089 Bacteria 3347
437 Ga0207648_10181500 3300026089 Bacteria 1863
438 Ga0207648_10237821 3300026089 Bacteria 1621
439 Ga0207648_10253749 3300026089 Unclassified 1568
440 Ga0207648_10478277 3300026089 Bacteria 1137
441 Ga0207676_10001837 3300026095 Bacteria 15555
442 Ga0207676_10026723 3300026095 Bacteria 4293
443 Ga0207676_10029265 3300026095 Bacteria 4122
444 Ga0207676_10142298 3300026095 Bacteria 2055
445 Ga0207676_10356953 3300026095 Bacteria 1353
446 Ga0207676_10361117 3300026095 Bacteria 1346
447 Ga0207674_10003775 3300026116 Bacteria 18479
448 Ga0207674_10012222 3300026116 Bacteria 9604
449 Ga0207674_10054940 3300026116 Bacteria 4051
450 Ga0207674_10063967 3300026116 Bacteria 3711
451 Ga0207674_10064875 3300026116 Bacteria 3683
452 Ga0207674_10220530 3300026116 Bacteria 1844
453 Ga0207674_10271940 3300026116 Bacteria 1642
454 Ga0207674_10316382 3300026116 Unclassified 1510
455 Ga0207675_100003516 3300026118 Bacteria 15294
456 Ga0207675_100012696 3300026118 Bacteria 7872
457 Ga0207675_100072937 3300026118 Bacteria 3211
458 Ga0207675_100233818 3300026118 Bacteria 1774
459 Ga0207683_10006181 3300026121 Bacteria 10261
460 Ga0207683_10029087 3300026121 Bacteria 4782
461 Ga0207683_10151742 3300026121 Bacteria 2091
462 Ga0207698_10029031 3300026142 Bacteria 3955
463 Ga0207698_10050265 3300026142 Bacteria 3179
464 Ga0207698_10082517 3300026142 Bacteria 2599
465 Ga0207698_10147067 3300026142 Bacteria 2039
466 Ga0207698_10189261 3300026142 Bacteria 1831
467 Ga0207698_10201333 3300026142 Bacteria 1783
468 Ga0268266_10107462 3300028379 Bacteria 2468
469 Ga0268265_10029226 3300028380 Bacteria 3954
470 Ga0268265_10100582 3300028380 Bacteria 2334
471 Ga0268265_10353065 3300028380 Bacteria 1343
472 Ga0268264_10017541 3300028381 Bacteria 5863
473 Ga0268264_10018648 3300028381 Bacteria 5673
474 Ga0268264_10070723 3300028381 Bacteria 2954
475 Ga0268264_10134601 3300028381 Bacteria 2195
476 Ga0268264_10291547 3300028381 Bacteria 1533
477 Ga0268264_10514050 3300028381 Bacteria 1170
478 Ga0307515_10000001 3300028794 Bacteria 4259510
479 Ga0265327_10000031 3300031251 Bacteria 325718
480 Ga0265327_10000196 3300031251 Bacteria 127325
481 Ga0265327_10011274 3300031251 Bacteria 6179
482 Ga0265327_10054793 3300031251 Bacteria 2062
483 Ga0307516_10000749 3300031730 Bacteria 44209
484 Ga0307414_10259758 3300032004 Bacteria 1449
485 Ga0373937_0059595 3300036401 Unclassified 3508
486 Ga0395905_0058646 3300037471 Bacteria 3599
487 Ga0395905_0066358 3300037471 Unclassified 3380
488 Ga0395905_0179461 3300037471 Bacteria 1988
489 Ga0436365_1046759 3300039437 Bacteria 1478
490 Ga0436365_1293977 3300039437 Bacteria 1661
491 Ga0439433_0017655 3300041999 Bacteria 1585
492 Ga0439448_0049028 3300042005 Unclassified 1380
493 Ga0450899_010178 3300042135 Bacteria 1042
494 Ga0439434_0003068 3300042435 Bacteria 4901
495 Ga0453684_0027891 3300044712 Bacteria 8078
496 Ga0453684_0415837 3300044712 Bacteria 1503
497 Ga0453684_0420599 3300044712 Bacteria 1493
498 Ga0466959_0326766 3300045049 Bacteria 1048
499 Ga0495650_0026671 3300046471 Unclassified 2682
500 Ga0495622_0029415 3300046557 Bacteria 2567
501 Ga0495668_0009083 3300046616 Bacteria 6134
502 Ga0495636_0000016 3300047318 Bacteria 78995
503 Ga0495672_0056414 3300047320 Bacteria 2286
504 Ga0495672_0130052 3300047320 Bacteria 1326
505 Ga0495672_0177258 3300047320 Unclassified 1082
506 Ga0495686_0045848 3300047472 Bacteria 2765
507 Ga0495686_0049682 3300047472 Unclassified 2638
508 Ga0496101_0010216 3300048904 Bacteria 6195
509 Ga0496104_0311460 3300048907 Unclassified 1487
510 Ga0496110_0347520 3300048913 Bacteria 1351
511 Ga0496111_0150525 3300048914 Bacteria 1726
512 Ga0496111_0255247 3300048914 Bacteria 1301
513 Ga0496115_0003089 3300048918 Bacteria 11957
514 Ga0501292_007498 3300049515 Bacteria 1578
515 Ga0501298_000252 3300049521 Bacteria 6956
516 Ga0501031_0252524 3300049568 Bacteria 1146
517 Ga0501032_0008747 3300049569 Bacteria 7375
518 Ga0501032_0067528 3300049569 Bacteria 2388
519 Ga0501033_0234380 3300049570 Bacteria 1303
520 Ga0501034_0001294 3300049571 Bacteria 33843
521 Ga0501034_0033713 3300049571 Bacteria 5191
522 Ga0501036_0007961 3300049572 Bacteria 8674
523 Ga0501036_0036133 3300049572 Bacteria 4180
524 Ga0501036_0067127 3300049572 Bacteria 3034
525 Ga0501037_0001516 3300049573 Bacteria 16965
526 Ga0501037_0026024 3300049573 Bacteria 4323
527 Ga0501038_0023118 3300049574 Bacteria 5562
528 Ga0501039_0022218 3300049575 Bacteria 4870
529 Ga0501039_0029105 3300049575 Bacteria 4253
530 Ga0501039_0039796 3300049575 Bacteria 3630
531 Ga0501043_0004347 3300049579 Bacteria 11527
532 Ga0501043_0009037 3300049579 Bacteria 7840
533 Ga0501043_0069700 3300049579 Bacteria 2762
534 Ga0501046_0107677 3300049580 Unclassified 2132
535 Ga0501047_0009501 3300049581 Bacteria 9190
536 Ga0501047_0023491 3300049581 Bacteria 5918
537 Ga0501047_0209324 3300049581 Bacteria 1809
538 Ga0501048_0026380 3300049582 Bacteria 4230
539 Ga0501067_0137011 3300049583 Unclassified 1363
540 Ga0501070_0037801 3300049586 Bacteria 4029
541 Ga0501074_0020734 3300049590 Bacteria 4774
542 Ga0501198_001479 3300049649 Unclassified 3077
543 Ga0501202_000541 3300049652 Bacteria 5465
544 Ga0501211_003558 3300049658 Bacteria 1603
545 Ga0501217_000507 3300049661 Bacteria 6457
546 Ga0501223_019066 3300049663 Bacteria 1348
547 Ga0501227_011147 3300049665 Bacteria 1956
548 Ga0501243_000546 3300049675 Bacteria 5049
549 Ga0501257_011116 3300049686 Unclassified 2052
550 Ga0501259_000140 3300049688 Bacteria 10848
551 Ga0501221_000102 3300049704 Bacteria 10239
552 Ga0501225_0000356 3300049705 Bacteria 14440
553 Ga0501225_0032501 3300049705 Bacteria 1435
554 Ga0501234_000586 3300049707 Bacteria 5588
555 Ga0501245_001040 3300049708 Bacteria 3568
556 Ga0501083_0004219 3300049744 Bacteria 10121
557 Ga0501035_0008435 3300049822 Bacteria 9595
558 Ga0501035_0058100 3300049822 Bacteria 3448
559 Ga0501035_0075783 3300049822 Bacteria 2975
560 Ga0501044_0005653 3300049823 Bacteria 13866
561 Ga0501044_0008916 3300049823 Bacteria 10964
562 Ga0501044_0030734 3300049823 Bacteria 5658
563 nmdc:mga0k408_12083_c1 3300050493 Bacteria 4715
564 nmdc:mga0k408_3093_c1 3300050493 Bacteria 8815
565 nmdc:mga09592_168661_c1 3300050508 Bacteria 1893
566 nmdc:mga0qj67_9187_c1 3300050509 Bacteria 7342
567 Ga0500646_0001766 3300053090 Bacteria 5691
568 Ga0500641_0036075 3300053096 Bacteria 1977
569 Ga0500568_0001874 3300053139 Bacteria 12955
570 Ga0500611_000011 3300053727 Bacteria 141259
571 Ga0501084_0096258 3300054114 Bacteria 2486
572 Ga0501082_0377432 3300060353 Unclassified 1237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0010216 Ga0496101_0010216_5379_6176 256
2 3300013104 Ga0157370_10000405 Ga0157370_100004053 276
3 3300001979 JGI24740J21852_10021588 JGI24740J21852_100215883 278
4 3300003203 JGI25406J46586_10004023 JGI25406J46586_100040235 280
5 3300005985 Ga0081539_10000885 Ga0081539_1000088534 280
6 3300005344 Ga0070661_100121194 Ga0070661_1001211942 294
7 3300005366 Ga0070659_100014169 Ga0070659_1000141691 294
8 3300005530 Ga0070679_100227795 Ga0070679_1002277952 294
9 3300005563 Ga0068855_100426474 Ga0068855_1004264742 294
10 3300025904 Ga0207647_10000631 Ga0207647_100006315 294
11 3300025932 Ga0207690_10189293 Ga0207690_101892931 294
12 3300026142 Ga0207698_10029031 Ga0207698_100290312 294
13 3300005616 Ga0068852_100005706 Ga0068852_1000057066 295
14 3300031251 Ga0265327_10000196 Ga0265327_1000019656 296
15 3300031251 Ga0265327_10011274 Ga0265327_100112743 296
16 3300047472 Ga0495686_0049682 Ga0495686_0049682_47_940 296
17 3300049521 Ga0501298_000252 Ga0501298_000252_4064_4984 296
18 3300049649 Ga0501198_001479 Ga0501198_001479_39_959 296
19 3300049652 Ga0501202_000541 Ga0501202_000541_2708_3628 296
20 3300049658 Ga0501211_003558 Ga0501211_003558_541_1461 296
21 3300049661 Ga0501217_000507 Ga0501217_000507_18_938 296
22 3300049665 Ga0501227_011147 Ga0501227_011147_136_1056 296
23 3300049675 Ga0501243_000546 Ga0501243_000546_2642_3562 296
24 3300049686 Ga0501257_011116 Ga0501257_011116_87_1007 296
25 3300049688 Ga0501259_000140 Ga0501259_000140_2919_3839 296
26 3300049704 Ga0501221_000102 Ga0501221_000102_1739_2659 296
27 3300049705 Ga0501225_0000356 Ga0501225_0000356_11174_12094 296
28 3300049708 Ga0501245_001040 Ga0501245_001040_451_1371 296
29 3300026095 Ga0207676_10361117 Ga0207676_103611172 297
30 iso_pu_bacteria 2887375801 2887377105 297
31 3300005841 Ga0068863_100144024 Ga0068863_1001440241 300
32 3300026088 Ga0207641_10101689 Ga0207641_101016893 300
33 3300005331 Ga0070670_100200101 Ga0070670_1002001012 301
34 3300005353 Ga0070669_100055302 Ga0070669_1000553021 301
35 3300005617 Ga0068859_100002930 Ga0068859_1000029305 301
36 3300005618 Ga0068864_100040086 Ga0068864_1000400864 301
37 3300005843 Ga0068860_100008600 Ga0068860_1000086004 301
38 3300006931 Ga0097620_100002930 Ga0097620_1000029305 301
39 3300009553 Ga0105249_10011560 Ga0105249_100115606 301
40 3300025923 Ga0207681_10023072 Ga0207681_100230724 301
41 3300025961 Ga0207712_10003851 Ga0207712_100038515 301
42 3300026095 Ga0207676_10026723 Ga0207676_100267234 301
43 3300028381 Ga0268264_10018648 Ga0268264_100186481 301
44 3300049705 Ga0501225_0032501 Ga0501225_0032501_138_1058 301
45 3300006358 Ga0068871_100109321 Ga0068871_1001093212 302
46 3300009094 Ga0111539_10788776 Ga0111539_107887761 302
47 3300010375 Ga0105239_10000591 Ga0105239_1000059135 302
48 3300005327 Ga0070658_10350387 Ga0070658_103503871 303
49 3300005335 Ga0070666_10104906 Ga0070666_101049062 303
50 3300005338 Ga0068868_100065160 Ga0068868_1000651603 303
51 3300005354 Ga0070675_100069146 Ga0070675_1000691462 303
52 3300005355 Ga0070671_100119731 Ga0070671_1001197312 303
53 3300005364 Ga0070673_100007991 Ga0070673_1000079912 303
54 3300005366 Ga0070659_100044464 Ga0070659_1000444643 303
55 3300005457 Ga0070662_100065336 Ga0070662_1000653362 303
56 3300005458 Ga0070681_10150592 Ga0070681_101505922 303
57 3300005535 Ga0070684_100153418 Ga0070684_1001534182 303
58 3300005539 Ga0068853_100076147 Ga0068853_1000761472 303
59 3300005614 Ga0068856_100255724 Ga0068856_1002557241 303
60 3300005616 Ga0068852_100036244 Ga0068852_1000362443 303
61 3300005842 Ga0068858_100506057 Ga0068858_1005060571 303
62 3300005843 Ga0068860_100092990 Ga0068860_1000929902 303
63 3300006237 Ga0097621_100107861 Ga0097621_1001078612 303
64 3300006358 Ga0068871_100050973 Ga0068871_1000509734 303
65 3300013100 Ga0157373_10024428 Ga0157373_100244284 303
66 3300013105 Ga0157369_10054490 Ga0157369_100544902 303
67 3300013296 Ga0157374_10020194 Ga0157374_100201945 303
68 3300013297 Ga0157378_10079032 Ga0157378_100790322 303
69 3300013308 Ga0157375_10945055 Ga0157375_109450551 303
70 3300014969 Ga0157376_10225317 Ga0157376_102253172 303
71 3300025926 Ga0207659_10062694 Ga0207659_100626942 303
72 3300025933 Ga0207706_10010694 Ga0207706_100106945 303
73 3300025944 Ga0207661_10141750 Ga0207661_101417502 303
74 3300025960 Ga0207651_10085747 Ga0207651_100857471 303
75 3300026078 Ga0207702_10043159 Ga0207702_100431592 303
76 3300026089 Ga0207648_10237821 Ga0207648_102378211 303
77 3300026116 Ga0207674_10063967 Ga0207674_100639672 303
78 3300026142 Ga0207698_10201333 Ga0207698_102013332 303
79 3300028381 Ga0268264_10017541 Ga0268264_100175413 303
80 iso_pu_bacteria 2883068021 2883073009 303
81 iso_pu_bacteria 2914759650 2914762289 303
82 3300001989 JGI24739J22299_10001051 JGI24739J22299_100010512 304
83 3300003790 Ga0055528_1000904 Ga0055528_100090416 304
84 3300003791 Ga0055530_10000546 Ga0055530_1000054626 304
85 3300005262 Ga0065165_1000725 Ga0065165_100072535 304
86 3300005331 Ga0070670_100094363 Ga0070670_1000943633 304
87 3300005355 Ga0070671_100012652 Ga0070671_1000126521 304
88 3300005367 Ga0070667_100005481 Ga0070667_1000054816 304
89 3300005618 Ga0068864_100391985 Ga0068864_1003919851 304
90 3300005841 Ga0068863_100137942 Ga0068863_1001379422 304
91 3300005842 Ga0068858_100223204 Ga0068858_1002232042 304
92 3300006237 Ga0097621_100000027 Ga0097621_10000002716 304
93 3300006358 Ga0068871_100000107 Ga0068871_10000010724 304
94 3300009174 Ga0105241_10345312 Ga0105241_103453121 304
95 3300009176 Ga0105242_10063027 Ga0105242_100630273 304
96 3300009177 Ga0105248_10038219 Ga0105248_100382193 304
97 3300009553 Ga0105249_10026124 Ga0105249_100261242 304
98 3300010375 Ga0105239_10001963 Ga0105239_1000196323 304
99 3300013297 Ga0157378_10040240 Ga0157378_100402401 304
100 3300013306 Ga0163162_10002356 Ga0163162_1000235612 304
101 3300013306 Ga0163162_10005339 Ga0163162_100053395 304
102 3300013306 Ga0163162_10494183 Ga0163162_104941831 304
103 3300013308 Ga0157375_10000336 Ga0157375_1000033612 304
104 3300014325 Ga0163163_10000193 Ga0163163_1000019333 304
105 3300014968 Ga0157379_10009216 Ga0157379_100092164 304
106 3300014969 Ga0157376_10000885 Ga0157376_100008855 304
107 3300014969 Ga0157376_10062575 Ga0157376_100625752 304
108 3300017792 Ga0163161_10004394 Ga0163161_100043945 304
109 3300025273 Ga0209673_1000194 Ga0209673_100019463 304
110 3300025297 Ga0209758_1010355 Ga0209758_10103553 304
111 3300025298 Ga0209050_1000658 Ga0209050_100065838 304
112 3300025302 Ga0207426_1002176 Ga0207426_10021767 304
113 3300025304 Ga0209257_1001487 Ga0209257_100148718 304
114 3300025931 Ga0207644_10288773 Ga0207644_102887731 304
115 3300025961 Ga0207712_10337945 Ga0207712_103379452 304
116 3300026035 Ga0207703_10209060 Ga0207703_102090602 304
117 3300026088 Ga0207641_10087315 Ga0207641_100873152 304
118 3300026089 Ga0207648_10058993 Ga0207648_100589932 304
119 3300026095 Ga0207676_10356953 Ga0207676_103569532 304
120 3300046557 Ga0495622_0029415 Ga0495622_0029415_618_1532 304
121 3300047318 Ga0495636_0000016 Ga0495636_0000016_77513_78445 304
122 3300048907 Ga0496104_0311460 Ga0496104_0311460_444_1385 304
123 3300048918 Ga0496115_0003089 Ga0496115_0003089_139_1065 304
124 3300053090 Ga0500646_0001766 Ga0500646_0001766_896_1810 304
125 3300013307 Ga0157372_10016187 Ga0157372_100161879 305
126 3300013307 Ga0157372_10413585 Ga0157372_104135852 305
127 3300014968 Ga0157379_10219620 Ga0157379_102196202 305
128 3300025986 Ga0207658_10114101 Ga0207658_101141012 305
129 3300003354 JGI25160J50197_1003284 JGI25160J50197_10032845 306
130 3300005329 Ga0070683_100033936 Ga0070683_1000339363 306
131 3300005331 Ga0070670_100027116 Ga0070670_1000271165 306
132 3300005344 Ga0070661_100043761 Ga0070661_1000437612 306
133 3300005353 Ga0070669_100124918 Ga0070669_1001249182 306
134 3300005459 Ga0068867_100274013 Ga0068867_1002740132 306
135 3300005535 Ga0070684_100008197 Ga0070684_1000081973 306
136 3300005564 Ga0070664_100011095 Ga0070664_1000110952 306
137 3300005577 Ga0068857_100065357 Ga0068857_1000653572 306
138 3300005616 Ga0068852_100035194 Ga0068852_1000351943 306
139 3300005616 Ga0068852_100036183 Ga0068852_1000361835 306
140 3300005719 Ga0068861_100317677 Ga0068861_1003176772 306
141 3300005841 Ga0068863_100265190 Ga0068863_1002651901 306
142 3300013100 Ga0157373_10007038 Ga0157373_100070382 306
143 3300013102 Ga0157371_10236763 Ga0157371_102367631 306
144 3300013105 Ga0157369_10254108 Ga0157369_102541081 306
145 3300013296 Ga0157374_10023165 Ga0157374_100231652 306
146 3300013296 Ga0157374_10131846 Ga0157374_101318463 306
147 3300013307 Ga0157372_10036103 Ga0157372_100361033 306
148 3300013307 Ga0157372_10052647 Ga0157372_100526473 306
149 3300013307 Ga0157372_10079562 Ga0157372_100795622 306
150 3300013307 Ga0157372_10251697 Ga0157372_102516972 306
151 3300013307 Ga0157372_10311560 Ga0157372_103115602 306
152 3300013307 Ga0157372_10807199 Ga0157372_108071992 306
153 3300014325 Ga0163163_10023026 Ga0163163_100230264 306
154 3300014745 Ga0157377_10070579 Ga0157377_100705792 306
155 3300025302 Ga0207426_1000052 Ga0207426_1000052118 306
156 3300025920 Ga0207649_10016515 Ga0207649_100165152 306
157 3300025925 Ga0207650_10016642 Ga0207650_100166422 306
158 3300025925 Ga0207650_10092903 Ga0207650_100929032 306
159 3300025940 Ga0207691_10155682 Ga0207691_101556822 306
160 3300025944 Ga0207661_10048477 Ga0207661_100484772 306
161 3300026023 Ga0207677_10217216 Ga0207677_102172162 306
162 3300026116 Ga0207674_10316382 Ga0207674_103163822 306
163 3300026142 Ga0207698_10050265 Ga0207698_100502652 306
164 3300032004 Ga0307414_10259758 Ga0307414_102597581 306
165 3300037471 Ga0395905_0058646 Ga0395905_0058646_1026_1955 306
166 3300037471 Ga0395905_0066358 Ga0395905_0066358_2197_3117 306
167 3300037471 Ga0395905_0179461 Ga0395905_0179461_185_1114 306
168 3300041999 Ga0439433_0017655 Ga0439433_0017655_398_1324 306
169 3300045049 Ga0466959_0326766 Ga0466959_0326766_78_998 306
170 3300049515 Ga0501292_007498 Ga0501292_007498_224_1144 306
171 3300049663 Ga0501223_019066 Ga0501223_019066_229_1149 306
172 3300049707 Ga0501234_000586 Ga0501234_000586_2449_3369 306
173 3300005334 Ga0068869_100016653 Ga0068869_1000166533 307
174 3300005337 Ga0070682_100000530 Ga0070682_10000053020 307
175 3300005347 Ga0070668_100036860 Ga0070668_1000368603 307
176 3300005354 Ga0070675_100096378 Ga0070675_1000963783 307
177 3300005539 Ga0068853_100038706 Ga0068853_1000387062 307
178 3300005544 Ga0070686_100034662 Ga0070686_1000346622 307
179 3300005617 Ga0068859_100016969 Ga0068859_1000169693 307
180 3300005834 Ga0068851_10125335 Ga0068851_101253352 307
181 3300006844 Ga0075428_100182477 Ga0075428_1001824772 307
182 3300006846 Ga0075430_100166075 Ga0075430_1001660752 307
183 3300006847 Ga0075431_100022672 Ga0075431_1000226722 307
184 3300006880 Ga0075429_100033563 Ga0075429_1000335635 307
185 3300006931 Ga0097620_100016969 Ga0097620_1000169694 307
186 3300013307 Ga0157372_10601953 Ga0157372_106019532 307
187 3300025926 Ga0207659_10118638 Ga0207659_101186381 307
188 3300025938 Ga0207704_10170741 Ga0207704_101707411 307
189 3300025942 Ga0207689_10030895 Ga0207689_100308953 307
190 3300025972 Ga0207668_10057234 Ga0207668_100572342 307
191 3300026041 Ga0207639_10081134 Ga0207639_100811342 307
192 3300026118 Ga0207675_100012696 Ga0207675_1000126963 307
193 3300028381 Ga0268264_10514050 Ga0268264_105140501 307
194 3300028794 Ga0307515_10000001 Ga0307515_10000001568 307
195 3300047320 Ga0495672_0056414 Ga0495672_0056414_1242_2165 307
196 3300049569 Ga0501032_0067528 Ga0501032_0067528_824_1747 307
197 3300049572 Ga0501036_0007961 Ga0501036_0007961_5975_6898 307
198 3300049573 Ga0501037_0026024 Ga0501037_0026024_1567_2490 307
199 3300049575 Ga0501039_0029105 Ga0501039_0029105_2318_3241 307
200 3300049579 Ga0501043_0009037 Ga0501043_0009037_5858_6781 307
201 3300049581 Ga0501047_0209324 Ga0501047_0209324_43_966 307
202 3300049822 Ga0501035_0058100 Ga0501035_0058100_24_947 307
203 3300049823 Ga0501044_0005653 Ga0501044_0005653_12111_13034 307
204 3300050508 nmdc:mga09592_168661_c1 nmdc:mga09592_168661_c1_721_1677 307
205 3300050509 nmdc:mga0qj67_9187_c1 nmdc:mga0qj67_9187_c1_5896_6852 307
206 3300053096 Ga0500641_0036075 Ga0500641_0036075_70_993 307
207 3300053139 Ga0500568_0001874 Ga0500568_0001874_8084_9007 307
208 3300005331 Ga0070670_100172272 Ga0070670_1001722721 308
209 3300005356 Ga0070674_100045639 Ga0070674_1000456392 308
210 3300005466 Ga0070685_10083777 Ga0070685_100837772 308
211 3300005577 Ga0068857_100085154 Ga0068857_1000851541 308
212 3300009176 Ga0105242_10050519 Ga0105242_100505193 308
213 3300010375 Ga0105239_10302718 Ga0105239_103027182 308
214 3300013104 Ga0157370_10007210 Ga0157370_100072108 308
215 3300013306 Ga0163162_10227566 Ga0163162_102275662 308
216 3300025925 Ga0207650_10306783 Ga0207650_103067831 308
217 3300025934 Ga0207686_10064806 Ga0207686_100648062 308
218 3300025937 Ga0207669_10056107 Ga0207669_100561072 308
219 3300026089 Ga0207648_10002286 Ga0207648_1000228611 308
220 3300026116 Ga0207674_10064875 Ga0207674_100648752 308
221 3300026118 Ga0207675_100233818 Ga0207675_1002338182 308
222 3300044712 Ga0453684_0027891 Ga0453684_0027891_2743_3705 308
223 3300044712 Ga0453684_0415837 Ga0453684_0415837_503_1429 308
224 3300049568 Ga0501031_0252524 Ga0501031_0252524_160_1113 308
225 3300049569 Ga0501032_0008747 Ga0501032_0008747_2841_3794 308
226 3300049570 Ga0501033_0234380 Ga0501033_0234380_215_1168 308
227 3300049571 Ga0501034_0033713 Ga0501034_0033713_3062_4015 308
228 3300049572 Ga0501036_0036133 Ga0501036_0036133_2724_3677 308
229 3300049573 Ga0501037_0001516 Ga0501037_0001516_13647_14600 308
230 3300049574 Ga0501038_0023118 Ga0501038_0023118_2319_3272 308
231 3300049575 Ga0501039_0022218 Ga0501039_0022218_2761_3714 308
232 3300049579 Ga0501043_0069700 Ga0501043_0069700_421_1374 308
233 3300049581 Ga0501047_0009501 Ga0501047_0009501_1598_2551 308
234 3300049822 Ga0501035_0075783 Ga0501035_0075783_1316_2269 308
235 3300049823 Ga0501044_0030734 Ga0501044_0030734_2617_3570 308
236 3300003320 rootH2_10144348 rootH2_101443482 309
237 3300005458 Ga0070681_10265363 Ga0070681_102653631 309
238 3300005841 Ga0068863_100241039 Ga0068863_1002410393 309
239 3300009174 Ga0105241_10017098 Ga0105241_100170982 309
240 3300009545 Ga0105237_10035230 Ga0105237_100352302 309
241 3300013100 Ga0157373_10087546 Ga0157373_100875462 309
242 3300013102 Ga0157371_10129609 Ga0157371_101296092 309
243 3300025912 Ga0207707_10159040 Ga0207707_101590402 309
244 3300025913 Ga0207695_10055862 Ga0207695_100558622 309
245 3300026142 Ga0207698_10189261 Ga0207698_101892612 309
246 3300046471 Ga0495650_0026671 Ga0495650_0026671_691_1632 309
247 3300049571 Ga0501034_0001294 Ga0501034_0001294_30590_31519 309
248 3300049572 Ga0501036_0067127 Ga0501036_0067127_807_1736 309
249 3300049575 Ga0501039_0039796 Ga0501039_0039796_292_1221 309
250 3300049579 Ga0501043_0004347 Ga0501043_0004347_2838_3767 309
251 3300049580 Ga0501046_0107677 Ga0501046_0107677_32_961 309
252 3300049581 Ga0501047_0023491 Ga0501047_0023491_1018_1947 309
253 3300049582 Ga0501048_0026380 Ga0501048_0026380_840_1769 309
254 3300049583 Ga0501067_0137011 Ga0501067_0137011_265_1194 309
255 3300049586 Ga0501070_0037801 Ga0501070_0037801_1388_2317 309
256 3300049590 Ga0501074_0020734 Ga0501074_0020734_1691_2620 309
257 3300049744 Ga0501083_0004219 Ga0501083_0004219_7961_8890 309
258 3300049822 Ga0501035_0008435 Ga0501035_0008435_8479_9408 309
259 3300054114 Ga0501084_0096258 Ga0501084_0096258_423_1352 309
260 3300060353 Ga0501082_0377432 Ga0501082_0377432_31_960 309
261 3300003323 rootH1_10062595 rootH1_100625951 310
262 3300005535 Ga0070684_100022746 Ga0070684_1000227462 310
263 3300005539 Ga0068853_100193396 Ga0068853_1001933962 310
264 3300005563 Ga0068855_100002958 Ga0068855_1000029588 310
265 3300009093 Ga0105240_10000715 Ga0105240_1000071514 310
266 3300009093 Ga0105240_10003107 Ga0105240_1000310720 310
267 3300009545 Ga0105237_10003306 Ga0105237_1000330614 310
268 3300009545 Ga0105237_10006269 Ga0105237_1000626913 310
269 3300009545 Ga0105237_10032139 Ga0105237_100321393 310
270 3300010375 Ga0105239_10104155 Ga0105239_101041554 310
271 3300010375 Ga0105239_10168505 Ga0105239_101685052 310
272 3300013105 Ga0157369_10034266 Ga0157369_100342664 310
273 3300013307 Ga0157372_10000666 Ga0157372_1000066617 310
274 3300013307 Ga0157372_10341964 Ga0157372_103419642 310
275 3300025913 Ga0207695_10000327 Ga0207695_1000032750 310
276 3300025913 Ga0207695_10000681 Ga0207695_1000068111 310
277 3300025914 Ga0207671_10001641 Ga0207671_1000164111 310
278 3300025914 Ga0207671_10128280 Ga0207671_101282802 310
279 3300025944 Ga0207661_10009151 Ga0207661_100091514 310
280 3300025949 Ga0207667_10000340 Ga0207667_1000034011 310
281 3300026041 Ga0207639_10253107 Ga0207639_102531072 310
282 3300042005 Ga0439448_0049028 Ga0439448_0049028_353_1303 310
283 3300010375 Ga0105239_10010402 Ga0105239_100104028 311
284 3300031251 Ga0265327_10000031 Ga0265327_10000031119 311
285 3300047320 Ga0495672_0130052 Ga0495672_0130052_230_1228 311
286 3300005338 Ga0068868_100216039 Ga0068868_1002160391 312
287 3300005367 Ga0070667_100079871 Ga0070667_1000798712 312
288 3300005617 Ga0068859_100109829 Ga0068859_1001098292 312
289 3300005843 Ga0068860_100106598 Ga0068860_1001065982 312
290 3300005844 Ga0068862_100013234 Ga0068862_1000132345 312
291 3300006195 Ga0075366_10011979 Ga0075366_100119794 312
292 3300006931 Ga0097620_100109831 Ga0097620_1001098312 312
293 3300014325 Ga0163163_10085000 Ga0163163_100850001 312
294 3300025942 Ga0207689_10173821 Ga0207689_101738212 312
295 3300026023 Ga0207677_10102578 Ga0207677_101025782 312
296 3300028380 Ga0268265_10029226 Ga0268265_100292263 312
297 3300028381 Ga0268264_10070723 Ga0268264_100707232 312
298 3300050493 nmdc:mga0k408_12083_c1 nmdc:mga0k408_12083_c1_3377_4318 312
299 3300005331 Ga0070670_100194957 Ga0070670_1001949571 313
300 3300005334 Ga0068869_100255719 Ga0068869_1002557191 313
301 3300005356 Ga0070674_100077231 Ga0070674_1000772312 313
302 3300005539 Ga0068853_100000201 Ga0068853_10000020129 313
303 3300005616 Ga0068852_100227132 Ga0068852_1002271322 313
304 3300006358 Ga0068871_100447107 Ga0068871_1004471071 313
305 3300009093 Ga0105240_10065737 Ga0105240_100657372 313
306 3300009174 Ga0105241_10037087 Ga0105241_100370874 313
307 3300025901 Ga0207688_10047747 Ga0207688_100477472 313
308 3300025938 Ga0207704_10248697 Ga0207704_102486971 313
309 3300025942 Ga0207689_10043516 Ga0207689_100435162 313
310 3300026041 Ga0207639_10002892 Ga0207639_1000289211 313
311 3300026118 Ga0207675_100072937 Ga0207675_1000729372 313
312 3300026121 Ga0207683_10006181 Ga0207683_100061816 313
313 3300047320 Ga0495672_0177258 Ga0495672_0177258_75_1016 313
314 3300047472 Ga0495686_0045848 Ga0495686_0045848_1309_2271 313
315 3300005335 Ga0070666_10038981 Ga0070666_100389813 314
316 3300005459 Ga0068867_100115299 Ga0068867_1001152991 314
317 3300005563 Ga0068855_100610986 Ga0068855_1006109862 314
318 3300005616 Ga0068852_100072214 Ga0068852_1000722143 314
319 3300005985 Ga0081539_10047345 Ga0081539_100473452 314
320 3300006237 Ga0097621_100448995 Ga0097621_1004489951 314
321 3300009553 Ga0105249_10002821 Ga0105249_100028218 314
322 3300013296 Ga0157374_10037787 Ga0157374_100377872 314
323 3300013306 Ga0163162_10026859 Ga0163162_100268598 314
324 3300014969 Ga0157376_10123010 Ga0157376_101230102 314
325 3300025936 Ga0207670_10018966 Ga0207670_100189663 314
326 3300025942 Ga0207689_10073372 Ga0207689_100733722 314
327 3300025949 Ga0207667_10363910 Ga0207667_103639102 314
328 3300026089 Ga0207648_10181500 Ga0207648_101815001 314
329 3300026095 Ga0207676_10142298 Ga0207676_101422982 314
330 3300048914 Ga0496111_0150525 Ga0496111_0150525_24_1001 314
331 3300049823 Ga0501044_0008916 Ga0501044_0008916_1645_2625 314
332 iso_pu_bacteria 2890737413 2890738367 314
333 iso_pu_bacteria 2896344016 2896344895 314
334 3300003323 rootH1_10070881 rootH1_100708811 315
335 3300005535 Ga0070684_100349442 Ga0070684_1003494421 315
336 3300005564 Ga0070664_100136622 Ga0070664_1001366222 315
337 3300025945 Ga0207679_10205330 Ga0207679_102053302 315
338 3300026023 Ga0207677_10018590 Ga0207677_100185903 315
339 3300026116 Ga0207674_10054940 Ga0207674_100549404 315
340 3300031730 Ga0307516_10000749 Ga0307516_1000074913 315
341 3300053727 Ga0500611_000011 Ga0500611_000011_90927_91877 315
342 3300003322 rootL2_10141763 rootL2_101417631 316
343 3300005295 Ga0065707_10112608 Ga0065707_101126082 316
344 3300005330 Ga0070690_100009378 Ga0070690_1000093783 316
345 3300005333 Ga0070677_10141132 Ga0070677_101411321 316
346 3300005334 Ga0068869_100006720 Ga0068869_1000067208 316
347 3300005335 Ga0070666_10017969 Ga0070666_100179691 316
348 3300005337 Ga0070682_100252221 Ga0070682_1002522211 316
349 3300005340 Ga0070689_100196397 Ga0070689_1001963971 316
350 3300005355 Ga0070671_100021831 Ga0070671_1000218312 316
351 3300005457 Ga0070662_100025381 Ga0070662_1000253813 316
352 3300005471 Ga0070698_100036456 Ga0070698_1000364564 316
353 3300005471 Ga0070698_100038004 Ga0070698_1000380042 316
354 3300005530 Ga0070679_100025468 Ga0070679_1000254684 316
355 3300005539 Ga0068853_100210948 Ga0068853_1002109482 316
356 3300005578 Ga0068854_100026904 Ga0068854_1000269043 316
357 3300005616 Ga0068852_100323124 Ga0068852_1003231242 316
358 3300005718 Ga0068866_10020651 Ga0068866_100206512 316
359 3300005840 Ga0068870_10084705 Ga0068870_100847052 316
360 3300005842 Ga0068858_100042146 Ga0068858_1000421462 316
361 3300006237 Ga0097621_100524620 Ga0097621_1005246201 316
362 3300006358 Ga0068871_100062854 Ga0068871_1000628541 316
363 3300006844 Ga0075428_100011686 Ga0075428_1000116867 316
364 3300006880 Ga0075429_100004950 Ga0075429_1000049503 316
365 3300009174 Ga0105241_10214768 Ga0105241_102147681 316
366 3300009176 Ga0105242_10239016 Ga0105242_102390162 316
367 3300009553 Ga0105249_10489185 Ga0105249_104891852 316
368 3300010375 Ga0105239_10364367 Ga0105239_103643671 316
369 3300013102 Ga0157371_10148510 Ga0157371_101485102 316
370 3300013296 Ga0157374_10021178 Ga0157374_100211783 316
371 3300013297 Ga0157378_10405882 Ga0157378_104058822 316
372 3300013306 Ga0163162_10305865 Ga0163162_103058652 316
373 3300013307 Ga0157372_10236288 Ga0157372_102362881 316
374 3300014325 Ga0163163_10096374 Ga0163163_100963743 316
375 3300014969 Ga0157376_10200483 Ga0157376_102004831 316
376 3300014969 Ga0157376_10272136 Ga0157376_102721362 316
377 3300017792 Ga0163161_10034459 Ga0163161_100344593 316
378 3300025893 Ga0207682_10092343 Ga0207682_100923431 316
379 3300025899 Ga0207642_10100082 Ga0207642_101000822 316
380 3300025905 Ga0207685_10036362 Ga0207685_100363622 316
381 3300025933 Ga0207706_10011827 Ga0207706_100118273 316
382 3300025934 Ga0207686_10093936 Ga0207686_100939362 316
383 3300025942 Ga0207689_10012162 Ga0207689_100121628 316
384 3300026035 Ga0207703_10040068 Ga0207703_100400684 316
385 3300026089 Ga0207648_10253749 Ga0207648_102537492 316
386 3300026121 Ga0207683_10029087 Ga0207683_100290876 316
387 3300036401 Ga0373937_0059595 Ga0373937_0059595_1894_2880 316
388 3300046616 Ga0495668_0009083 Ga0495668_0009083_3096_4196 316
389 3300003322 rootL2_10270037 rootL2_102700371 317
390 3300005290 Ga0065712_10002727 Ga0065712_100027276 317
391 3300005290 Ga0065712_10099709 Ga0065712_100997092 317
392 3300005293 Ga0065715_10001847 Ga0065715_100018472 317
393 3300005331 Ga0070670_100165707 Ga0070670_1001657072 317
394 3300005334 Ga0068869_100001176 Ga0068869_1000011768 317
395 3300005334 Ga0068869_100290299 Ga0068869_1002902992 317
396 3300005340 Ga0070689_100005879 Ga0070689_1000058792 317
397 3300005343 Ga0070687_100103037 Ga0070687_1001030372 317
398 3300005344 Ga0070661_100002662 Ga0070661_1000026624 317
399 3300005354 Ga0070675_100072978 Ga0070675_1000729783 317
400 3300005354 Ga0070675_100094358 Ga0070675_1000943582 317
401 3300005364 Ga0070673_100060057 Ga0070673_1000600572 317
402 3300005365 Ga0070688_100017095 Ga0070688_1000170953 317
403 3300005365 Ga0070688_100107249 Ga0070688_1001072492 317
404 3300005366 Ga0070659_100416570 Ga0070659_1004165701 317
405 3300005367 Ga0070667_100071916 Ga0070667_1000719162 317
406 3300005367 Ga0070667_100319218 Ga0070667_1003192181 317
407 3300005459 Ga0068867_100170625 Ga0068867_1001706252 317
408 3300005459 Ga0068867_100322849 Ga0068867_1003228492 317
409 3300005466 Ga0070685_10003936 Ga0070685_100039363 317
410 3300005535 Ga0070684_100011744 Ga0070684_1000117446 317
411 3300005543 Ga0070672_100052949 Ga0070672_1000529494 317
412 3300005549 Ga0070704_100381696 Ga0070704_1003816961 317
413 3300005564 Ga0070664_100008104 Ga0070664_1000081048 317
414 3300005577 Ga0068857_100078978 Ga0068857_1000789782 317
415 3300005577 Ga0068857_100197365 Ga0068857_1001973652 317
416 3300005616 Ga0068852_100182227 Ga0068852_1001822272 317
417 3300005617 Ga0068859_100090245 Ga0068859_1000902452 317
418 3300005617 Ga0068859_100320510 Ga0068859_1003205102 317
419 3300005617 Ga0068859_100391553 Ga0068859_1003915532 317
420 3300005618 Ga0068864_100005892 Ga0068864_1000058928 317
421 3300005834 Ga0068851_10061098 Ga0068851_100610982 317
422 3300005840 Ga0068870_10026129 Ga0068870_100261292 317
423 3300005841 Ga0068863_100381953 Ga0068863_1003819532 317
424 3300005843 Ga0068860_100127794 Ga0068860_1001277943 317
425 3300005844 Ga0068862_100202447 Ga0068862_1002024472 317
426 3300005844 Ga0068862_100214170 Ga0068862_1002141702 317
427 3300006844 Ga0075428_100529151 Ga0075428_1005291512 317
428 3300006881 Ga0068865_100076124 Ga0068865_1000761243 317
429 3300006931 Ga0097620_100090242 Ga0097620_1000902422 317
430 3300006931 Ga0097620_100320543 Ga0097620_1003205432 317
431 3300006931 Ga0097620_100391562 Ga0097620_1003915622 317
432 3300009093 Ga0105240_10001801 Ga0105240_1000180111 317
433 3300009176 Ga0105242_10104147 Ga0105242_101041473 317
434 3300009176 Ga0105242_10265205 Ga0105242_102652051 317
435 3300009177 Ga0105248_10539004 Ga0105248_105390042 317
436 3300009553 Ga0105249_10318462 Ga0105249_103184622 317
437 3300010375 Ga0105239_10341619 Ga0105239_103416192 317
438 3300011119 Ga0105246_10040932 Ga0105246_100409324 317
439 3300011119 Ga0105246_10425986 Ga0105246_104259861 317
440 3300013296 Ga0157374_10003864 Ga0157374_100038643 317
441 3300013296 Ga0157374_10444142 Ga0157374_104441422 317
442 3300013297 Ga0157378_10175409 Ga0157378_101754091 317
443 3300013306 Ga0163162_10030873 Ga0163162_100308735 317
444 3300013308 Ga0157375_10026145 Ga0157375_100261455 317
445 3300014325 Ga0163163_10000638 Ga0163163_1000063820 317
446 3300014325 Ga0163163_10579124 Ga0163163_105791242 317
447 3300014326 Ga0157380_10093735 Ga0157380_100937353 317
448 3300014326 Ga0157380_10138567 Ga0157380_101385671 317
449 3300014745 Ga0157377_10088490 Ga0157377_100884902 317
450 3300014745 Ga0157377_10146796 Ga0157377_101467962 317
451 3300017792 Ga0163161_10115469 Ga0163161_101154692 317
452 3300017792 Ga0163161_10125944 Ga0163161_101259442 317
453 3300021384 Ga0213876_10005408 Ga0213876_100054081 317
454 3300025321 Ga0207656_10032473 Ga0207656_100324732 317
455 3300025904 Ga0207647_10016689 Ga0207647_100166895 317
456 3300025908 Ga0207643_10002603 Ga0207643_100026032 317
457 3300025913 Ga0207695_10000486 Ga0207695_1000048644 317
458 3300025918 Ga0207662_10032143 Ga0207662_100321433 317
459 3300025920 Ga0207649_10007419 Ga0207649_100074192 317
460 3300025926 Ga0207659_10029866 Ga0207659_100298661 317
461 3300025932 Ga0207690_10057401 Ga0207690_100574013 317
462 3300025933 Ga0207706_10114680 Ga0207706_101146802 317
463 3300025934 Ga0207686_10044032 Ga0207686_100440323 317
464 3300025936 Ga0207670_10108833 Ga0207670_101088332 317
465 3300025940 Ga0207691_10012179 Ga0207691_100121796 317
466 3300025942 Ga0207689_10004331 Ga0207689_100043316 317
467 3300025942 Ga0207689_10101535 Ga0207689_101015352 317
468 3300025945 Ga0207679_10004377 Ga0207679_100043773 317
469 3300025961 Ga0207712_10364722 Ga0207712_103647222 317
470 3300025986 Ga0207658_10163799 Ga0207658_101637992 317
471 3300026035 Ga0207703_10107676 Ga0207703_101076762 317
472 3300026035 Ga0207703_10410104 Ga0207703_104101041 317
473 3300026067 Ga0207678_10083692 Ga0207678_100836922 317
474 3300026088 Ga0207641_10001393 Ga0207641_1000139317 317
475 3300026089 Ga0207648_10478277 Ga0207648_104782771 317
476 3300026095 Ga0207676_10001837 Ga0207676_1000183720 317
477 3300026116 Ga0207674_10003775 Ga0207674_1000377516 317
478 3300026116 Ga0207674_10220530 Ga0207674_102205302 317
479 3300026116 Ga0207674_10271940 Ga0207674_102719402 317
480 3300026121 Ga0207683_10151742 Ga0207683_101517422 317
481 3300026142 Ga0207698_10082517 Ga0207698_100825172 317
482 3300026142 Ga0207698_10147067 Ga0207698_101470672 317
483 3300028379 Ga0268266_10107462 Ga0268266_101074623 317
484 3300028380 Ga0268265_10353065 Ga0268265_103530652 317
485 3300028381 Ga0268264_10134601 Ga0268264_101346012 317
486 3300031251 Ga0265327_10054793 Ga0265327_100547932 317
487 3300039437 Ga0436365_1046759 Ga0436365_1046759_243_1244 317
488 3300039437 Ga0436365_1293977 Ga0436365_1293977_243_1247 317
489 3300048913 Ga0496110_0347520 Ga0496110_0347520_246_1235 317
490 3300048914 Ga0496111_0255247 Ga0496111_0255247_59_1048 317
491 3300003323 rootH1_10272894 rootH1_102728942 318
492 3300005329 Ga0070683_100004984 Ga0070683_10000498410 319
493 3300005334 Ga0068869_100007688 Ga0068869_1000076883 319
494 3300005338 Ga0068868_100024837 Ga0068868_1000248373 319
495 3300005339 Ga0070660_100271912 Ga0070660_1002719121 319
496 3300005344 Ga0070661_100003501 Ga0070661_1000035017 319
497 3300005353 Ga0070669_100178639 Ga0070669_1001786392 319
498 3300005364 Ga0070673_100107882 Ga0070673_1001078821 319
499 3300005366 Ga0070659_100024593 Ga0070659_1000245936 319
500 3300005457 Ga0070662_100025769 Ga0070662_1000257693 319
501 3300005535 Ga0070684_100003098 Ga0070684_10000309814 319
502 3300005535 Ga0070684_100187552 Ga0070684_1001875522 319
503 3300005539 Ga0068853_100013079 Ga0068853_1000130793 319
504 3300005564 Ga0070664_100023111 Ga0070664_1000231118 319
505 3300005564 Ga0070664_100322969 Ga0070664_1003229692 319
506 3300005564 Ga0070664_100459566 Ga0070664_1004595661 319
507 3300005577 Ga0068857_100066487 Ga0068857_1000664873 319
508 3300005578 Ga0068854_100151946 Ga0068854_1001519461 319
509 3300005844 Ga0068862_100138337 Ga0068862_1001383372 319
510 3300006881 Ga0068865_100394360 Ga0068865_1003943601 319
511 3300009553 Ga0105249_10007683 Ga0105249_100076832 319
512 3300013296 Ga0157374_10148574 Ga0157374_101485742 319
513 3300013297 Ga0157378_10113056 Ga0157378_101130563 319
514 3300013306 Ga0163162_10004527 Ga0163162_100045273 319
515 3300014745 Ga0157377_10036842 Ga0157377_100368422 319
516 3300025907 Ga0207645_10023675 Ga0207645_100236752 319
517 3300025920 Ga0207649_10006490 Ga0207649_100064903 319
518 3300025933 Ga0207706_10021553 Ga0207706_100215532 319
519 3300025942 Ga0207689_10011366 Ga0207689_100113664 319
520 3300025944 Ga0207661_10017540 Ga0207661_100175403 319
521 3300025945 Ga0207679_10001246 Ga0207679_100012462 319
522 3300025945 Ga0207679_10286722 Ga0207679_102867221 319
523 3300025945 Ga0207679_10394793 Ga0207679_103947931 319
524 3300025960 Ga0207651_10042167 Ga0207651_100421672 319
525 3300025961 Ga0207712_10120836 Ga0207712_101208362 319
526 3300025981 Ga0207640_10092961 Ga0207640_100929612 319
527 3300026023 Ga0207677_10038453 Ga0207677_100384532 319
528 3300026041 Ga0207639_10010742 Ga0207639_100107426 319
529 3300026116 Ga0207674_10012222 Ga0207674_100122229 319
530 3300028380 Ga0268265_10100582 Ga0268265_101005823 319
531 3300044712 Ga0453684_0420599 Ga0453684_0420599_243_1238 319
532 3300005329 Ga0070683_100017759 Ga0070683_1000177596 320
533 3300005331 Ga0070670_100267079 Ga0070670_1002670791 320
534 3300013306 Ga0163162_10297035 Ga0163162_102970352 320
535 3300025925 Ga0207650_10229809 Ga0207650_102298091 320
536 3300025944 Ga0207661_10017757 Ga0207661_100177572 320
537 3300005331 Ga0070670_100089346 Ga0070670_1000893462 321
538 3300005617 Ga0068859_100418455 Ga0068859_1004184552 321
539 3300005844 Ga0068862_100428146 Ga0068862_1004281462 321
540 3300006931 Ga0097620_100418432 Ga0097620_1004184322 321
541 3300028381 Ga0268264_10291547 Ga0268264_102915472 321
542 3300050493 nmdc:mga0k408_3093_c1 nmdc:mga0k408_3093_c1_3401_4387 321
543 3300000545 CNXas_1002612 CNXas_10026122 322
544 3300005290 Ga0065712_10001839 Ga0065712_100018395 322
545 3300005293 Ga0065715_10199576 Ga0065715_101995761 322
546 3300005331 Ga0070670_100355711 Ga0070670_1003557111 322
547 3300005334 Ga0068869_100022268 Ga0068869_1000222684 322
548 3300005340 Ga0070689_100053077 Ga0070689_1000530771 322
549 3300005353 Ga0070669_100017184 Ga0070669_1000171843 322
550 3300005364 Ga0070673_100301207 Ga0070673_1003012071 322
551 3300005365 Ga0070688_100001664 Ga0070688_1000016647 322
552 3300005457 Ga0070662_100006736 Ga0070662_1000067364 322
553 3300005459 Ga0068867_100027826 Ga0068867_1000278263 322
554 3300005543 Ga0070672_100014038 Ga0070672_1000140383 322
555 3300005617 Ga0068859_100015332 Ga0068859_1000153326 322
556 3300005618 Ga0068864_100041065 Ga0068864_1000410653 322
557 3300005719 Ga0068861_100001097 Ga0068861_1000010977 322
558 3300005840 Ga0068870_10006551 Ga0068870_100065515 322
559 3300005844 Ga0068862_100019125 Ga0068862_1000191255 322
560 3300006931 Ga0097620_100015332 Ga0097620_1000153326 322
561 3300009094 Ga0111539_10005231 Ga0111539_1000523111 322
562 3300013306 Ga0163162_10016350 Ga0163162_100163503 322
563 3300013308 Ga0157375_10080546 Ga0157375_100805463 322
564 3300014326 Ga0157380_10001611 Ga0157380_100016114 322
565 3300014745 Ga0157377_10002511 Ga0157377_100025117 322
566 3300017792 Ga0163161_10332476 Ga0163161_103324762 322
567 3300025315 Ga0207697_10027369 Ga0207697_100273693 322
568 3300025925 Ga0207650_10047129 Ga0207650_100471293 322
569 3300025933 Ga0207706_10013284 Ga0207706_100132843 322
570 3300025936 Ga0207670_10015317 Ga0207670_100153174 322
571 3300025940 Ga0207691_10007756 Ga0207691_100077568 322
572 3300025942 Ga0207689_10051384 Ga0207689_100513842 322
573 3300025960 Ga0207651_10292994 Ga0207651_102929942 322
574 3300026095 Ga0207676_10029265 Ga0207676_100292653 322
575 3300026118 Ga0207675_100003516 Ga0207675_10000351610 322
576 3300042135 Ga0450899_010178 Ga0450899_010178_28_1014 322
577 3300042435 Ga0439434_0003068 Ga0439434_0003068_3446_4432 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06574

FAD_syn

FAD synthetase

40

197

0.98

PF01687

Flavokinase

Riboflavin kinase

214

361

0.95

PF01467

CTP_transf_like

Cytidylyltransferase-like

48

201

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s4m-assembly1.cif.gz_A crystal structure of flavin binding to fad synthetase from thermotoga maritina 0.8602 17 320
1t6z-assembly1.cif.gz_B crystal structure of riboflavin bound tm379 0.8554 18 320
2i1l-assembly2.cif.gz_B crystal structure of the c2 form of fad synthetase from thermotoga maritima 0.855 18 320
1t6y-assembly1.cif.gz_A crystal structure of adp, amp, and fmn bound tm379 0.8549 18 320
1s4m-assembly2.cif.gz_B crystal structure of flavin binding to fad synthetase from thermotoga maritina 0.8473 17 320
ID Description Score Start End Superfamily
af_Q2G2Q2_186_320_2.40.30.30 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.9148 186 321 2.40.30.30
af_P0AG40_187_311_2.40.30.30 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.9028 186 320 2.40.30.30
2i1lB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.8941 188 321 2.40.30.30
af_P0AG40_1_186_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8777 1 185 3.40.50.620
af_P0AG40_1_186_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8687 1 185 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7Y5UX16-F1-model_v4 riboflavin kinase (EC 2.7.1.26) 0.9702 163 322 GO:0005524
GO:0008531
GO:0009231
GO:0009398
AF-A0A3C0QX93-F1-model_v4 riboflavin kinase (EC 2.7.1.26) 0.9649 167 320 GO:0005524
GO:0008531
GO:0009231
GO:0009398
AF-A0A521VP53-F1-model_v4 FAD synthase (EC 2.7.7.2) 0.9647 1 154 GO:0003919
GO:0005524
GO:0006747
GO:0008531
GO:0009231
GO:0009398
AF-A0A7Y3D152-F1-model_v4 riboflavin kinase (EC 2.7.1.26) 0.9635 169 322 GO:0005524
GO:0008531
GO:0009231
GO:0009398
AF-A0A7C5R3M7-F1-model_v4 riboflavin kinase (EC 2.7.1.26) 0.9607 201 321 GO:0005524
GO:0008531
GO:0009231
GO:0009398

Feature Viewer

pLDDT pTM Quality
90.09 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map